RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781008|ref|YP_003065421.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] (99 letters) >d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Length = 405 Score = 28.0 bits (61), Expect = 0.21 Identities = 7/27 (25%), Positives = 14/27 (51%) Query: 73 RLSSVVYATREDCQKILRALSEVSKLF 99 R S +Y T E+ +++ L + +L Sbjct: 378 RASLAMYNTHEEVDRLVTGLQRIHRLL 404 >d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 408 Score = 26.9 bits (58), Expect = 0.52 Identities = 8/27 (29%), Positives = 13/27 (48%) Query: 73 RLSSVVYATREDCQKILRALSEVSKLF 99 R S Y T+E+ L++L + F Sbjct: 381 RASLYFYNTKEEIDLFLQSLQATIRFF 407 >d1xpma2 c.95.1.2 (A:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Length = 221 Score = 26.0 bits (57), Expect = 0.97 Identities = 8/65 (12%), Positives = 16/65 (24%), Gaps = 7/65 (10%) Query: 8 HSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMSDLSDTVIDLPNHISIIT 67 D I Q W+ Y + ++D + +P Sbjct: 23 GHKYPLVDGALSKDAYIRSFQ-------QSWNEYAKRQGKSLADFASLCFHVPFTKMGKK 75 Query: 68 CMEDM 72 +E + Sbjct: 76 ALESI 80 >d1tocr1 g.8.1.2 (R:1A-56) Ornithodorin {Soft tick (Ornithodoros moubata) [TaxId: 6938]} Length = 57 Score = 24.6 bits (53), Expect = 2.4 Identities = 7/21 (33%), Positives = 13/21 (61%) Query: 67 TCMEDMRLSSVVYATREDCQK 87 TC+ +S YA++ +CQ+ Sbjct: 29 TCLMSPACTSEGYASQHECQQ 49 >d1t3ta2 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 90371]} Length = 262 Score = 24.0 bits (51), Expect = 4.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Query: 47 LHMSDLSDTVIDLPNHISIITC 68 +HMSDL I L N +++ C Sbjct: 37 VHMSDLLGGRIGLGNFHALVAC 58 >d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Length = 462 Score = 23.4 bits (49), Expect = 5.4 Identities = 3/27 (11%), Positives = 8/27 (29%) Query: 73 RLSSVVYATREDCQKILRALSEVSKLF 99 T ++ L ++ +L Sbjct: 433 LFLMTPAETPAKMNNLITQLLQLQRLI 459 >d1xq4a_ b.1.23.1 (A:) ApaG {Bordetella pertussis [TaxId: 520]} Length = 123 Score = 23.2 bits (50), Expect = 6.2 Identities = 7/22 (31%), Positives = 13/22 (59%) Query: 11 IGEHDAKFDITIPIGVLDSPRS 32 +GE+ F++ I +L PR+ Sbjct: 102 VGENGIPFEVPIAEFLLAMPRT 123 >d2nrqa1 d.77.1.2 (A:4-144) Hypothetical protein SSO0741 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 Score = 23.2 bits (50), Expect = 6.3 Identities = 6/22 (27%), Positives = 11/22 (50%), Gaps = 1/22 (4%) Query: 74 LSSVVYATREDCQKILRALSEV 95 +S ++ T ED KI+ + Sbjct: 5 ISVFIHET-EDYNKIVNTIESF 25 >d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Length = 376 Score = 23.1 bits (48), Expect = 6.8 Identities = 7/23 (30%), Positives = 12/23 (52%) Query: 73 RLSSVVYATREDCQKILRALSEV 95 R+S Y T E+ L+ + E+ Sbjct: 350 RISLCKYNTEEEVDYFLKKIEEI 372 >d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Length = 391 Score = 22.6 bits (47), Expect = 9.3 Identities = 4/23 (17%), Positives = 9/23 (39%) Query: 73 RLSSVVYATREDCQKILRALSEV 95 R S + T E+ + + + Sbjct: 353 RFSLGRFTTEEEIDYTIELVRKS 375 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.135 0.398 Gapped Lambda K H 0.267 0.0649 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 360,286 Number of extensions: 14298 Number of successful extensions: 47 Number of sequences better than 10.0: 1 Number of HSP's gapped: 47 Number of HSP's successfully gapped: 18 Length of query: 99 Length of database: 2,407,596 Length adjustment: 61 Effective length of query: 38 Effective length of database: 1,570,066 Effective search space: 59662508 Effective search space used: 59662508 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.1 bits)