BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781008|ref|YP_003065421.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] (99 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781008|ref|YP_003065421.1| hypothetical protein CLIBASIA_04550 [Candidatus Liberibacter asiaticus str. psy62] Length = 99 Score = 202 bits (514), Expect = 9e-55, Method: Compositional matrix adjust. Identities = 99/99 (100%), Positives = 99/99 (100%) Query: 1 MSEDVIIHSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMSDLSDTVIDLP 60 MSEDVIIHSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMSDLSDTVIDLP Sbjct: 1 MSEDVIIHSSIGEHDAKFDITIPIGVLDSPRSIRIQCWSAYKYKHQLHMSDLSDTVIDLP 60 Query: 61 NHISIITCMEDMRLSSVVYATREDCQKILRALSEVSKLF 99 NHISIITCMEDMRLSSVVYATREDCQKILRALSEVSKLF Sbjct: 61 NHISIITCMEDMRLSSVVYATREDCQKILRALSEVSKLF 99 >gi|254780833|ref|YP_003065246.1| hypothetical protein CLIBASIA_03630 [Candidatus Liberibacter asiaticus str. psy62] Length = 371 Score = 23.5 bits (49), Expect = 0.73, Method: Compositional matrix adjust. Identities = 10/37 (27%), Positives = 21/37 (56%) Query: 44 KHQLHMSDLSDTVIDLPNHISIITCMEDMRLSSVVYA 80 K+ + ++D ++ ++ N S+ C E R ++VYA Sbjct: 285 KYIIFLTDGENSSPNIDNKESLFYCNEAKRRGAIVYA 321 >gi|254781211|ref|YP_003065624.1| hypothetical protein CLIBASIA_05590 [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Score = 22.3 bits (46), Expect = 1.8, Method: Compositional matrix adjust. Identities = 8/25 (32%), Positives = 13/25 (52%) Query: 49 MSDLSDTVIDLPNHISIITCMEDMR 73 MSD +D + LP+ ++ C R Sbjct: 1 MSDETDQLTPLPSTPPVVECERSQR 25 >gi|254780379|ref|YP_003064792.1| flagellar hook-basal body protein FliE [Candidatus Liberibacter asiaticus str. psy62] Length = 108 Score = 20.8 bits (42), Expect = 5.1, Method: Compositional matrix adjust. Identities = 9/12 (75%), Positives = 11/12 (91%) Query: 87 KILRALSEVSKL 98 KIL A+SEVSK+ Sbjct: 95 KILSAVSEVSKM 106 >gi|254780682|ref|YP_003065095.1| hypothetical protein CLIBASIA_02845 [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Score = 20.0 bits (40), Expect = 9.8, Method: Compositional matrix adjust. Identities = 7/21 (33%), Positives = 14/21 (66%) Query: 54 DTVIDLPNHISIITCMEDMRL 74 +T I LPN++ C+++ +L Sbjct: 139 ETKIPLPNNLKPNVCVKEKKL 159 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.135 0.398 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,287 Number of Sequences: 1233 Number of extensions: 2462 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 99 length of database: 328,796 effective HSP length: 61 effective length of query: 38 effective length of database: 253,583 effective search space: 9636154 effective search space used: 9636154 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 32 (16.9 bits)