HHsearch alignment of GI: 254781009 and MMDB domain: 2o8s_A_1-68_193-323

>2o8s_A (A:1-68,A:193-323) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str}
Probab=98.67  E-value=9.2e-09  Score=70.42  Aligned_cols=71  Identities=20%  Similarity=0.223  Sum_probs=40.3

Q ss_pred             HHHHHHHHCCCCCCHHHHHCCHHHHHHHHHHCCCCHHHCCHHHHHHHH-------CCCCCCCHHHHHCCCHHHHHHHHHH
Q ss_conf             458898511345899997243899999999739872120389998874-------1887770023310350569999985
Q gi|254781009|r  140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVL-------TLGLANPKKYFIESRDNRFRAMAEN  212 (750)
Q Consensus       140 ~~~Yf~~~~~~ItsvddLL~D~~L~~vv~tAfGL~~~~~s~~~lk~vL-------tsD~sDp~S~~n~~~~~~y~~lAaa  212 (750)
                      -++||+|++++|+++|+||+|+.|++||+||||||.+...-+.-||+-       -+|+.||.-+..-  -.||..+-..
T Consensus        74 LALYFqR~ap~I~swY~ILgD~aL~~VfeTALGLPssfa~lDIDkQa~li~~k~DlsdlsDP~kvekl--I~RFlA~~di  151 (199)
T 2o8s_A           74 LALYFERKAPTIKSGLDFLADDALAQVFRTTFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKL--LERFTIXWEX  151 (199)
T ss_dssp             HHHHHHHHSTTCCSHHHHHTSHHHHHHHHTTTTC-----CCCCTTHHHHHHHSSCTTTTTCTTHHHHH--HHHHHHHHHH
T ss_pred             HHHHHHHHCHHHCCHHHHHCCHHHHHHHHHHCCCCHHHCCCCHHHHHHHHHHHCCHHHCCCHHHHHHH--HHHHHHHHHH
T ss_conf             99999974332322999967789999999981998666138889999999963379864897999999--9999999998