BLAST/PSIBLAST alignment of GI: 254781009 and GI: 15889789 at iteration 1
>gi|15889789|ref|NP_355470.1| hypothetical protein Atu2524 [Agrobacterium tumefaciens str. C58] Length = 774
>gi|15157715|gb|AAK88255.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 774
 Score = 94.0 bits (232), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 150/325 (46%), Gaps = 36/325 (11%)

Query: 35  YRERIKHISTIDEFIKDK----RLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
           YR  I     +D+F+        + ++ALKAF +     +   +KK+  SDLS+PKS V 
Sbjct: 421 YRRYIGLTKNLDDFLSAAPAAVAIRNFALKAFNIGTEESSTFKLKKVFTSDLSNPKSYVY 480

Query: 91  QLNSLKYQYFARSYDFSP-----PPKVIQSDIQHKTIIQDYKQSHQHKE------EVALE 139
            L   ++   A++++F        P+  Q++ +   I ++Y +     +      E   +
Sbjct: 481 TLKDDRFLRLAKAFNFDAQGKIGSPRFAQAENEIARISRNYLKEVTRWDKDKKIREKGEK 540

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           E  Y+R+ +  + + DQL  DRRLLD++L +  I PK I+  +LK +    L +PK +  
Sbjct: 541 EVGYYREKMGTLETADQLLADRRLLDFMLVAERIDPKSITTDYLKKIFKSDLKDPKSFAN 600

Query: 200 ESRDNRFRAMAENFRFQPDGSLSK--RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN-- 255
             +D RFRA+A +F F   G++S   R  I  +  + +    Y    ++      ++N  
Sbjct: 601 TEKDPRFRALAGSFNFDAKGNISATTRQPIQNNRSLMETRDKYVRQKLE--ERAGEENSG 658

Query: 256 -----YYKLAINSVSSFSDFLKDPKLFKMLQLSLF----PLNPEITA-----DKFLTLMQ 301
                Y+K     +SS  D L D  L ++ + +L       N ++ A     +K L +  
Sbjct: 659 VRLALYFKRMAGGISSAYDILADKALSEVTRTALGIPAETANAKVDAQAKMIEKRLKIKD 718

Query: 302 ENDP-IVSQVKYFFQINFHRDNSSS 325
             DP  V ++   F + F  +NS S
Sbjct: 719 LQDPKKVEKLVNRFLMTFEANNSGS 743