BLAST/PSIBLAST alignment of GI: 254781009 and GI: 222147731 at iteration 1
>gi|222147731|ref|YP_002548688.1| hypothetical protein Avi_0969 [Agrobacterium vitis S4] Length = 727
>gi|221734719|gb|ACM35682.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 727
 Score =  328 bits (842), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 225/721 (31%), Positives = 377/721 (52%), Gaps = 56/721 (7%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +++     ++D+++ L   VS++P V+ E++YY+E I  + T+D+F+ D RL+ Y +
Sbjct: 1   MVSTYIGYDLVNRDMKASL-KRVSQEPEVAREQKYYQENIGKVKTVDDFMNDDRLYQYTM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA GL DM++A+ F+KK+LESDLSD  S  N+L   +Y+ FARS++FS     IQ+D Q 
Sbjct: 60  KANGLEDMTYAKAFMKKVLESDLSDEDSYANKLADDRYRDFARSFNFSAETADIQTDKQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           + +I  YKQS   + + A EE +Y+   I K+ +VD L K+ RL  +VL+S+ +  KY S
Sbjct: 120 EDVIGLYKQSLVTEGDDAKEEVQYYDSAIDKVTNVDDLLKNSRLTKFVLESYGLDTKYYS 179

Query: 180 LPFLKDVLTLGLANPKKYF--IESRDNRFRAMAENFRFQPDGSL-------SKRDKILTD 230
              LK VLT  + +   Y   + +  + +  +A+ F F  DGSL       S +   + D
Sbjct: 180 TDHLKKVLTSDVNDSTSYVNTLTTNKSDYVNIAKAFSFNTDGSLKNATAQTSDQKTAMED 239

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
           + +E++ S     T        +  YYK  I +V+  SD   D +LF  ++ +L  ++  
Sbjct: 240 LYLEEVPS-----TETAYQAEREAAYYKEKIATVTKASDITGDSRLFSYVKTAL-GMDKN 293

Query: 291 ITADKFLTLMQE--NDP-----IVSQVKYFFQ-----INF-HRDNSSSTKIQQDSQIQKM 337
                F  ++    ND         +VK  +       NF    N+++   Q ++Q+ + 
Sbjct: 294 TLKSTFENIVTSDLNDANSYANTQGKVKGEYAKIAAMFNFDTSGNATAGNAQSETQLSQT 353

Query: 338 LDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFAL 397
              Y  N        + SL   Y   +  I  +D+LL             E I  +   +
Sbjct: 354 ATAYMTNYDDEDQANLSSLTTYYSTQMKSITKVDDLL-----------GNEKIYDM--VM 400

Query: 398 DAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM- 456
            AY +   +  +  L+ VLTS+ +DP SYANK++D+RLI L  AFNF  DG+   +P++ 
Sbjct: 401 KAYGIETDEFSKADLKKVLTSDMNDPKSYANKTRDERLISLASAFNFKEDGT-ADVPLLA 459

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
           QS  TI +  K Y  +K    + + +         T  +   E +S+  YY  NI  + S
Sbjct: 460 QSERTITEVAKDYIVQKTRFLEGKEQ---------TDAKTAAEEDSK--YYQENIVKVSS 508

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSF 576
             +LL ++++++F L ++G+D + V +D L ++F SDL DPKSFANT  D  Y + ++S+
Sbjct: 509 VTDLLKDRKLVDFALTAQGLDPKDVSDDMLKQLFSSDLTDPKSFANTQADEGYAKFVASY 568

Query: 577 NFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN 636
           NFD  G++S +    VQ+     +T +LY HQ +E ++ E D  + LALY+ R    I +
Sbjct: 569 NFDSSGKISQENADGVQNRSETFNTENLYLHQTLENEQGESDQGVRLALYWDRMSSTITS 628

Query: 637 HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKA 696
            Y+ILGD+ L +V      L    + +   ++ ++++K + + D  D +K + FL    A
Sbjct: 629 AYDILGDTALLEVFRTAYSLPSDMSNMDIEQQKKVIEKKMDLKDLSDPEKQKKFLQRFTA 688

Query: 697 M 697
           M
Sbjct: 689 M 689