BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781009|ref|YP_003065422.1| hypothetical protein
CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62]
         (750 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040686|gb|ACT57482.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 750

 Score = 1515 bits (3923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 750/750 (100%), Positives = 750/750 (100%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK
Sbjct: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK
Sbjct: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
           TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL
Sbjct: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
           PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY
Sbjct: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240

Query: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM 300
           FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM
Sbjct: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM 300

Query: 301 QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY 360
           QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY
Sbjct: 301 QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY 360

Query: 361 QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP 420
           QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP
Sbjct: 361 QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP 420

Query: 421 SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE 480
           SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE
Sbjct: 421 SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE 480

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
           NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK
Sbjct: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
           VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD
Sbjct: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660
           TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF
Sbjct: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660

Query: 661 AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN 720
           AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN
Sbjct: 661 AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN 720

Query: 721 NSFDDPQNNVSLQLSPQKKSNGRFSILNLF 750
           NSFDDPQNNVSLQLSPQKKSNGRFSILNLF
Sbjct: 721 NSFDDPQNNVSLQLSPQKKSNGRFSILNLF 750


>gi|315122487|ref|YP_004062976.1| hypothetical protein CKC_03695 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495889|gb|ADR52488.1| hypothetical protein CKC_03695 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 757

 Score =  771 bits (1991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/746 (56%), Positives = 545/746 (73%), Gaps = 18/746 (2%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           S  +  K  +T+SKDPIVS EE+YYRE+IK IST++EFI DKRL +Y LKAF LSDMSHA
Sbjct: 23  SDKVYKKSIATISKDPIVSREEKYYREKIKKISTVEEFINDKRLLNYVLKAFDLSDMSHA 82

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSH 130
           + F++KIL SDLS P+SLVN++NS KYQ FA  +DFSP PK IQ+ IQ K +I+DY  S+
Sbjct: 83  KTFLQKILTSDLSVPESLVNKMNSKKYQTFASQFDFSPAPKSIQTTIQQKKVIEDYITSY 142

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
           + KE+ ALEESKYFR+NI+ I SVDQL K+RRL++Y LQSF I P+YISL FLK+ LT  
Sbjct: 143 KRKEKDALEESKYFRQNINNITSVDQLIKNRRLVNYALQSFGINPQYISLSFLKESLTSE 202

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP- 249
           L + K+     ++N   A+A+NFRFQ +GS   +DKILT+MQIE +V NYF++TI  VP 
Sbjct: 203 LDHTKQK--TPKENLLHALADNFRFQSNGSPIHKDKILTNMQIENMVHNYFSHTIMSVPE 260

Query: 250 --IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIV 307
             I SDQ YY+ +INS+ SF   LKDPKL+K+LQ+SL  L+P++T + FL L++ NDP +
Sbjct: 261 EVIFSDQKYYRSSINSIPSFEQLLKDPKLYKILQISL-SLDPKVTENNFLKLIKNNDPSI 319

Query: 308 SQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPL-GK 366
            QVK FFQI++  D +S   IQ   QI K+L LY+ NC+ L   K++SLI++Y+  + G 
Sbjct: 320 VQVKKFFQIDYAGDINSRPAIQTKKQIDKLLFLYQTNCKKLRSQKIESLIENYKKDISGD 379

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
           IKS+D  L+ K +    ++  +PI  L+FAL AY +   DL++ +LR++L S+ SD  SY
Sbjct: 380 IKSVDQFLNMKPKSYISSNKSQPITPLEFALQAYGIKKNDLNKYRLRDILISDSSDSKSY 439

Query: 427 ANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNS 486
            N+ KD+R I L+HAFNFN  G IG   + QS+LT+RDNV +Y   K+S+++ ENK F+S
Sbjct: 440 VNQLKDNRFINLHHAFNFNKKGEIGFNRLTQSKLTLRDNVMNYIGYKKSLYN-ENKIFSS 498

Query: 487 MEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL 546
            + I    RI  + + EV+YYT NI TIHSF +LLANKRILNFLLESK ID +KV+  FL
Sbjct: 499 AQNI----RIKKDTDKEVEYYTSNIQTIHSFNDLLANKRILNFLLESKEIDPKKVKNSFL 554

Query: 547 CEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYK 606
            +IFKSDL + KS ANTYKD+RYKEI+ SFNFDIHG  S++  GKVQDNFHID   DLYK
Sbjct: 555 EKIFKSDLNNTKSLANTYKDSRYKEIMLSFNFDIHGTKSNENTGKVQDNFHIDHVVDLYK 614

Query: 607 HQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER 666
           +Q+++KKEEEKDP++AL LYFKRTIP I+N Y+ILGD  LF+V+SKKL+LSP+F  LPE 
Sbjct: 615 NQILQKKEEEKDPDVALLLYFKRTIPTIKNIYDILGDKNLFQVISKKLRLSPHFPSLPES 674

Query: 667 KKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSS--PNQNKDPWNNSFD 724
            KI ILKK I I DFKD KK+E+FLYA     +QS  +K AL  +  P   KD    S D
Sbjct: 675 TKIHILKKLINIKDFKDPKKLENFLYAVNVNHYQSTTHKIALTLAFFPPLEKD----SMD 730

Query: 725 DPQNNVSLQLSPQKKSNGRFSILNLF 750
           D + N+SLQLSP KK NG+FSILNLF
Sbjct: 731 DHEKNISLQLSPNKKENGKFSILNLF 756


>gi|222147731|ref|YP_002548688.1| hypothetical protein Avi_0969 [Agrobacterium vitis S4]
 gi|221734719|gb|ACM35682.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 727

 Score =  328 bits (842), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 225/721 (31%), Positives = 377/721 (52%), Gaps = 56/721 (7%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +++     ++D+++ L   VS++P V+ E++YY+E I  + T+D+F+ D RL+ Y +
Sbjct: 1   MVSTYIGYDLVNRDMKASL-KRVSQEPEVAREQKYYQENIGKVKTVDDFMNDDRLYQYTM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA GL DM++A+ F+KK+LESDLSD  S  N+L   +Y+ FARS++FS     IQ+D Q 
Sbjct: 60  KANGLEDMTYAKAFMKKVLESDLSDEDSYANKLADDRYRDFARSFNFSAETADIQTDKQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           + +I  YKQS   + + A EE +Y+   I K+ +VD L K+ RL  +VL+S+ +  KY S
Sbjct: 120 EDVIGLYKQSLVTEGDDAKEEVQYYDSAIDKVTNVDDLLKNSRLTKFVLESYGLDTKYYS 179

Query: 180 LPFLKDVLTLGLANPKKYF--IESRDNRFRAMAENFRFQPDGSL-------SKRDKILTD 230
              LK VLT  + +   Y   + +  + +  +A+ F F  DGSL       S +   + D
Sbjct: 180 TDHLKKVLTSDVNDSTSYVNTLTTNKSDYVNIAKAFSFNTDGSLKNATAQTSDQKTAMED 239

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
           + +E++ S     T        +  YYK  I +V+  SD   D +LF  ++ +L  ++  
Sbjct: 240 LYLEEVPS-----TETAYQAEREAAYYKEKIATVTKASDITGDSRLFSYVKTAL-GMDKN 293

Query: 291 ITADKFLTLMQE--NDP-----IVSQVKYFFQ-----INF-HRDNSSSTKIQQDSQIQKM 337
                F  ++    ND         +VK  +       NF    N+++   Q ++Q+ + 
Sbjct: 294 TLKSTFENIVTSDLNDANSYANTQGKVKGEYAKIAAMFNFDTSGNATAGNAQSETQLSQT 353

Query: 338 LDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFAL 397
              Y  N        + SL   Y   +  I  +D+LL             E I  +   +
Sbjct: 354 ATAYMTNYDDEDQANLSSLTTYYSTQMKSITKVDDLL-----------GNEKIYDM--VM 400

Query: 398 DAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM- 456
            AY +   +  +  L+ VLTS+ +DP SYANK++D+RLI L  AFNF  DG+   +P++ 
Sbjct: 401 KAYGIETDEFSKADLKKVLTSDMNDPKSYANKTRDERLISLASAFNFKEDGT-ADVPLLA 459

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
           QS  TI +  K Y  +K    + + +         T  +   E +S+  YY  NI  + S
Sbjct: 460 QSERTITEVAKDYIVQKTRFLEGKEQ---------TDAKTAAEEDSK--YYQENIVKVSS 508

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSF 576
             +LL ++++++F L ++G+D + V +D L ++F SDL DPKSFANT  D  Y + ++S+
Sbjct: 509 VTDLLKDRKLVDFALTAQGLDPKDVSDDMLKQLFSSDLTDPKSFANTQADEGYAKFVASY 568

Query: 577 NFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN 636
           NFD  G++S +    VQ+     +T +LY HQ +E ++ E D  + LALY+ R    I +
Sbjct: 569 NFDSSGKISQENADGVQNRSETFNTENLYLHQTLENEQGESDQGVRLALYWDRMSSTITS 628

Query: 637 HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKA 696
            Y+ILGD+ L +V      L    + +   ++ ++++K + + D  D +K + FL    A
Sbjct: 629 AYDILGDTALLEVFRTAYSLPSDMSNMDIEQQKKVIEKKMDLKDLSDPEKQKKFLQRFTA 688

Query: 697 M 697
           M
Sbjct: 689 M 689


>gi|15889789|ref|NP_355470.1| hypothetical protein Atu2524 [Agrobacterium tumefaciens str. C58]
 gi|15157715|gb|AAK88255.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 774

 Score =  325 bits (834), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 225/760 (29%), Positives = 375/760 (49%), Gaps = 100/760 (13%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+P++      +++++S L   V+ DPI+S + +YY + I  + ++D F+KD +L+SYA+
Sbjct: 1   MLPAYTTYALYNRNMESSL-KRVANDPIISRDAKYYADNIGKVKSLDAFLKDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP--PPKVIQSDI 117
           KA GL +M++A  F+KK+LES+L DP S VN+L   +Y+ FA ++DF      K +Q+  
Sbjct: 60  KAHGLEEMTYATAFMKKVLESNLKDPNSFVNKLKDTRYRDFAAAFDFGTIKTEKTVQTKS 119

Query: 118 QHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           Q   ++  Y  + + + E   EE++Y+   I K+  VD +FK+ RL +YV +SF I P+ 
Sbjct: 120 QQDRLVTAYHDTDKQRNEEQKEETRYYNIVIDKVGQVDDIFKNTRLRNYVFKSFGIDPQT 179

Query: 178 ISLPFLKDVLTLGLANPKKY---------------FIESRDNRFR--------------- 207
                LK VLT  ++    Y                 + RD R +               
Sbjct: 180 FDYQHLKGVLTSDISKADSYVNSTYKPLLEEWQAKIADLRDQRTKIPSTDKTSLEKNDYL 239

Query: 208 ---------------AMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPI 250
                           +A  F F+ DG ++   K  T +Q      NY   N  +     
Sbjct: 240 INQYNKRINGAAKLFELAATFNFRADGLVNDGTKAQTAVQKRLTNENYVLANPRVTQTGA 299

Query: 251 VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEN--DP--- 305
           + +++++  A+  V+       + +L  ML ++    +   T  K    ++EN  DP   
Sbjct: 300 ILNRDFFVQAMKDVTDAGQLTANSRLRTMLIVAFNLEDNSGTDQKIQWALRENPADPQSG 359

Query: 306 --------IVSQVKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS 355
                    +   K F   NF  D   ++   +Q D Q+  +++LY       +DDK ++
Sbjct: 360 LYREKDKGFIDLAKAF---NFGTDGKVAAGKAVQSDGQLSTIMNLYFSR----YDDKQEA 412

Query: 356 ----LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
                IKDY+  +G  K++D+ LS         +A   +    FAL A+N+  ++    +
Sbjct: 413 ADEKTIKDYRRYIGLTKNLDDFLS---------AAPAAVAIRNFALKAFNIGTEESSTFK 463

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
           L+ V TS+ S+P SY    KDDR ++L  AFNF+A G IG     Q+   I    ++Y  
Sbjct: 464 LKKVFTSDLSNPKSYVYTLKDDRFLRLAKAFNFDAQGKIGSPRFAQAENEIARISRNY-- 521

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
                          + +    K+I  +   EV YY   + T+ + ++LLA++R+L+F+L
Sbjct: 522 ------------LKEVTRWDKDKKIREKGEKEVGYYREKMGTLETADQLLADRRLLDFML 569

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
            ++ ID + +  D+L +IFKSDLKDPKSFANT KD R++ +  SFNFD  G +S      
Sbjct: 570 VAERIDPKSITTDYLKKIFKSDLKDPKSFANTEKDPRFRALAGSFNFDAKGNISATTRQP 629

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
           +Q+N  + +T D Y  Q +E++  E++  + LALYFKR    I + Y+IL D  L +V  
Sbjct: 630 IQNNRSLMETRDKYVRQKLEERAGEENSGVRLALYFKRMAGGISSAYDILADKALSEVTR 689

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
             L +    A      + ++++K +KI D +D KKVE  +
Sbjct: 690 TALGIPAETANAKVDAQAKMIEKRLKIKDLQDPKKVEKLV 729



 Score = 94.0 bits (232), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 150/325 (46%), Gaps = 36/325 (11%)

Query: 35  YRERIKHISTIDEFIKDK----RLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
           YR  I     +D+F+        + ++ALKAF +     +   +KK+  SDLS+PKS V 
Sbjct: 421 YRRYIGLTKNLDDFLSAAPAAVAIRNFALKAFNIGTEESSTFKLKKVFTSDLSNPKSYVY 480

Query: 91  QLNSLKYQYFARSYDFSP-----PPKVIQSDIQHKTIIQDYKQSHQHKE------EVALE 139
            L   ++   A++++F        P+  Q++ +   I ++Y +     +      E   +
Sbjct: 481 TLKDDRFLRLAKAFNFDAQGKIGSPRFAQAENEIARISRNYLKEVTRWDKDKKIREKGEK 540

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           E  Y+R+ +  + + DQL  DRRLLD++L +  I PK I+  +LK +    L +PK +  
Sbjct: 541 EVGYYREKMGTLETADQLLADRRLLDFMLVAERIDPKSITTDYLKKIFKSDLKDPKSFAN 600

Query: 200 ESRDNRFRAMAENFRFQPDGSLSK--RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN-- 255
             +D RFRA+A +F F   G++S   R  I  +  + +    Y    ++      ++N  
Sbjct: 601 TEKDPRFRALAGSFNFDAKGNISATTRQPIQNNRSLMETRDKYVRQKLE--ERAGEENSG 658

Query: 256 -----YYKLAINSVSSFSDFLKDPKLFKMLQLSLF----PLNPEITA-----DKFLTLMQ 301
                Y+K     +SS  D L D  L ++ + +L       N ++ A     +K L +  
Sbjct: 659 VRLALYFKRMAGGISSAYDILADKALSEVTRTALGIPAETANAKVDAQAKMIEKRLKIKD 718

Query: 302 ENDP-IVSQVKYFFQINFHRDNSSS 325
             DP  V ++   F + F  +NS S
Sbjct: 719 LQDPKKVEKLVNRFLMTFEANNSGS 743


>gi|327192290|gb|EGE59255.1| hypothetical protein RHECNPAF_2330071 [Rhizobium etli CNPAF512]
          Length = 773

 Score =  322 bits (826), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 208/710 (29%), Positives = 359/710 (50%), Gaps = 33/710 (4%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           ++ ++V+        S   S V+    V+ +  YY++ I  ++T+DEF+ D +L+SYA+K
Sbjct: 47  LVSTYVSYLAVARNLSTSLSNVASQATVARDSAYYKDNIGKVTTVDEFMGDYKLYSYAMK 106

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ FS   K  QSD+Q  
Sbjct: 107 AYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGETKTAQSDVQRD 166

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            ++  Y+ S + + +   +E+ YF +NI  I SVD      RL  YVL +F ++ +Y S 
Sbjct: 167 NLLDAYEASFETEADTIEDETDYFEENIASITSVDDFLSSSRLKSYVLTAFGLSTEYTSS 226

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLKDVLT  L +   +  +  D+ + ++A+ F F  DGS+     ++++ QI  + S Y
Sbjct: 227 SFLKDVLTSDLDDADSFVNQLDDDVYVSLAKAFNFNEDGSVDG--DLMSEDQISLVTSAY 284

Query: 241 FNNTIDCVPIVSDQ------NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               +    I S Q      +Y+   I +++S    + D KL   L+ +    + E  +D
Sbjct: 285 ---AVASATIASTQTGEAYDSYFAAEIGNITSVDQLMSDDKLVSYLRTAYGLTDDE--SD 339

Query: 295 KFLTLMQENDPIVSQVK---YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL- 348
            F++   ++  I   +         NF  D   +     Q   Q       + +N Q+L 
Sbjct: 340 TFISAALKSADIAEAIGLSDLHDAFNFDEDGALADGDSAQTSDQTAATTAAFDENYQVLI 399

Query: 349 HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
            +   +  + +Y   +  + SID+ L      +  ++ + P +  + AL A+ ++   + 
Sbjct: 400 ANTDTEVAVDNYTTRIASVTSIDDFLVSNADDDDDDNDDLPEM-WEMALRAFGIDPDSVS 458

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPM-MQSRLTIRDNVK 467
           + Q+R +L S+P+D  SY N   DDR +    AFNF++DG +  +P+   S   + D   
Sbjct: 459 KSQVRKILESDPTDSKSYVNSLNDDRFVAFRKAFNFDSDGDV-TVPLQAMSESVVDDYAA 517

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
           +Y   K    D +  +                 + E+ Y+   + TI +  E LA+ R++
Sbjct: 518 YYKQNKIRYLDGDELT-----------EATDAADDEITYFREQMATITTASEFLADDRLV 566

Query: 528 NFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK 587
           +F+LE+KG+D   V  D L ++F SDL D  S+ N   DNR+ E++ +FNFD  G +S +
Sbjct: 567 SFVLEAKGLDPDDVTSDQLKKMFSSDLDDEDSYVNKLDDNRFAELVGAFNFDQDGNISAE 626

Query: 588 KIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLF 647
             G+VQ    + +T D Y    +E ++ + +  + LALYF+R    I + Y+ILGDS LF
Sbjct: 627 PTGEVQQRGDVLETVDAYVRLTLEDEQGDSNTGVRLALYFQRKASEISSAYDILGDSALF 686

Query: 648 KVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           +  +    +S Y + +   K+  +++  I I D  D  KV+D +    AM
Sbjct: 687 EFFTTSFNISSYVSNMDVDKQAEMVENFIDIKDLSDPDKVDDLIKRFTAM 736


>gi|209547533|ref|YP_002279451.1| hypothetical protein Rleg2_5534 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538777|gb|ACI58711.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 738

 Score =  318 bits (816), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 207/692 (29%), Positives = 344/692 (49%), Gaps = 33/692 (4%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
            S+V+    VS +  YY+E I  ++T+DEF+ D +L+SYA+KA+GL DM++A+ F+KK+L
Sbjct: 30  LSSVASQGTVSRDSAYYKENIGKVTTVDEFMGDYKLYSYAMKAYGLDDMTYAKAFMKKVL 89

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVAL 138
           ESDLSD  S  N L+  +Y  FA ++ F    K  QSD+Q +T++  Y+ S   + E   
Sbjct: 90  ESDLSDSSSFANSLSDGRYAEFAAAFKFGGETKTAQSDVQRETLLDAYESSFDTEAEDIA 149

Query: 139 EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYF 198
           +E+ YF +NI  I SVD      RL +Y L +F ++  Y S  FLK VLT  L +   + 
Sbjct: 150 DETDYFEENISSITSVDDFLSSSRLKNYALTAFGLSTDYTSSSFLKQVLTSDLDDSDSFV 209

Query: 199 IESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD----- 253
            +  D+ + ++A+ F F  DGS      ++++ QI  + S Y    +    + S      
Sbjct: 210 NQLGDDVYVSLAKAFNFNEDGSTDG--DVMSEDQISLVTSGY---AVASSTVASSDTGEA 264

Query: 254 -QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVK- 311
              Y+   I +++S    + D KL   L+++    + E  +D F++   ++  I   +  
Sbjct: 265 YDTYFAAEIGNITSVDQLMNDDKLVGYLRIAYGLTDDE--SDTFISAALKSADIADAIGL 322

Query: 312 --YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HDDKMQSLIKDYQLPLGK 366
                  NF  D   +     Q   Q       + +N Q+L  +   +  + +Y   +  
Sbjct: 323 SDLHDAFNFDEDGALADGDTAQTSEQTATTTAAFDENYQVLIANTDSEDAVDNYTTRIAS 382

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
           + SID+ L      +   + + P +  + AL A++++   + R Q+R +L S+P+D  SY
Sbjct: 383 VTSIDDFLVSNADDDVDGNDDLPEM-WEMALRAFDIDPDSVSRSQVRKILESDPTDSKSY 441

Query: 427 ANKSKDDRLIKLNHAFNFNADGSIGPIPM-MQSRLTIRDNVKHYANRKRSIHDAENKSFN 485
            N   DDR +    AFNF++DG +  +P+   S   + D   +Y   K    D ++ +  
Sbjct: 442 VNSLDDDRFVAFRKAFNFDSDGDV-TVPLQAMSESVVDDYAAYYKQNKIRYLDGDDLT-- 498

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
                          + E+ Y+   + TI +  E LA+ R+++  LE+KG+D   V  D 
Sbjct: 499 ---------EATDAADDEISYFREQMATITTASEFLADDRLVSLALEAKGLDPDDVTSDQ 549

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           L ++F SDL D  S+ N   D+R+ E++ SFNFD  G +S    G VQ    + +T D Y
Sbjct: 550 LKKMFSSDLDDEDSYVNKLDDSRFAELVGSFNFDQDGNISADPTGTVQQRGDVLETIDSY 609

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
               +E  + + +  + LALYF+R  P I + Y ILGDS LF+  +    LS Y + +  
Sbjct: 610 VRLTLEDDQGDSNTGVRLALYFQRKAPEISSAYGILGDSALFQFFTTTFNLSSYVSNMDV 669

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
            K+  ++   I I D  D  KV+D +    AM
Sbjct: 670 DKQAEMVNNFIDIKDLADPDKVDDLIKRFTAM 701


>gi|86360899|ref|YP_472786.1| hypothetical protein RHE_PF00168 [Rhizobium etli CFN 42]
 gi|86285001|gb|ABC94059.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 727

 Score =  315 bits (808), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 212/710 (29%), Positives = 370/710 (52%), Gaps = 33/710 (4%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ ++V+    ++++ + L S+V+    V+ +  YY+E I  ++T+DEF+ D +L+SYA+
Sbjct: 1   MVSTYVSYLAVARNLNASL-SSVASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ F+   K  QSD Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFAGETKTAQSDEQR 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
            +++  Y+ S   + E   +E+ YF +NI  I SVD L    RL +YVL +F ++ +Y S
Sbjct: 120 DSLLDAYEDSFDTEAENIEDETDYFEENISSITSVDDLLSSSRLKNYVLTAFGLSTEYTS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLKDVLT  L + + +  +  D+ + ++A+ F    DGS      ++++ Q+  + S 
Sbjct: 180 TSFLKDVLTSDLDDSESFVNQLDDDVYVSLAKAFNVSEDGSTDG--DVMSEDQLSLVTSA 237

Query: 240 YFNNTIDCVPIVSDQ---NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
           Y   +       + +    Y+   I +++S    + D KL   L+ +    + E   D F
Sbjct: 238 YAVASSTLASTETGEAYDTYFAAQIGNITSVDQLMSDDKLVSYLRTAYGLSDTET--DNF 295

Query: 297 LTLMQENDPIVSQVK---YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HD 350
           ++   ++  I   +         NF  D   +     Q   Q       + +N Q+L  +
Sbjct: 296 ISAALKSADIADAIGLSDLHDAFNFDEDGALADGETAQTSEQTAATTAAFDENYQVLIAN 355

Query: 351 DKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
            + +  + +Y   +  I SID+ L      +  ++ + P +  + AL A+ ++  ++ + 
Sbjct: 356 TETEDAVDNYTTRIASITSIDDFLVSNADDDDDDNDDLPEL-WEMALRAFGIDSGEVSKS 414

Query: 411 QLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHY- 469
           ++R +L S+P DP SY N  KDDR     +AFNF++DG +  +P+     ++ D+   Y 
Sbjct: 415 EVRKILESDPGDPKSYVNSLKDDRFEAFRNAFNFDSDGDV-TVPLQAMSESVVDDYAAYY 473

Query: 470 -ANRKRSIHDAE-NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
             N+ R +   E  ++ ++ ++             E++Y+   + TI S  E LA+ R++
Sbjct: 474 KQNKIRYLEGDELTEATDAADE-------------EIEYFRDQMATITSASEFLADDRLV 520

Query: 528 NFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK 587
            F LE+KG+D + V  D L +IF SDL D  S+ N  +D+R+ E++ SFNFD  G +S  
Sbjct: 521 AFALEAKGLDPEDVTSDDLEKIFSSDLDDEDSYVNKLEDSRFAELVGSFNFDRDGNISAD 580

Query: 588 KIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLF 647
             G VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y+ILGDS LF
Sbjct: 581 PTGTVQQRGDVLETVDAYVRLTLEDDQGDSNTGVRLALYFEREAPEISSAYDILGDSALF 640

Query: 648 KVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           +  +    LS Y + +   K+  +++  I I D  D  KV+D +    AM
Sbjct: 641 EFFTTSFNLSSYVSNMDVDKQAEMIENFIDIKDLADPDKVDDLIKRFTAM 690


>gi|325293876|ref|YP_004279740.1| hypothetical protein AGROH133_08567 [Agrobacterium sp. H13-3]
 gi|325061729|gb|ADY65420.1| hypothetical protein AGROH133_08567 [Agrobacterium sp. H13-3]
          Length = 775

 Score =  315 bits (807), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 236/763 (30%), Positives = 375/763 (49%), Gaps = 105/763 (13%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           V+ DP+VS + +YY + I  +  +D F+KD RL+SYA+KA GL +M +A  F+KK+LES+
Sbjct: 23  VANDPVVSRDAKYYADNIGTVKNLDAFLKDFRLYSYAMKAHGLEEMIYATAFMKKVLESN 82

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP--PPKVIQSDIQHKTIIQDYKQSHQHKEEVALE 139
           L+DP S  N+L   +Y+ FA S+DF      K +Q+  Q   +I  Y  + + +     E
Sbjct: 83  LNDPNSFANKLKDTRYRDFAASFDFGTIKAEKSVQTKSQQDRLIATYHATIEQEGAELKE 142

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYF- 198
           E++++   I K+  VD +FK+ R+ DY+ +SF I P+  S   +K+VLT  ++N   Y  
Sbjct: 143 ETRFYNIAIEKVGHVDDIFKNTRVRDYIFKSFGIDPETFSYKHVKNVLTSDISNADSYIN 202

Query: 199 -----------------------IESRD---------------------NRFRAMAENFR 214
                                  + S D                     N+   MA  F 
Sbjct: 203 KTYKSLIPEWKAKAADLRIERAGVASTDKPALAKIDYLISQYNKRINDANKLFEMAAAFN 262

Query: 215 FQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPIVSDQNYYKLAINSVSSFSDFLK 272
           F+ DG +       T  Q   I   Y   N  +     V ++ Y+   + +++  S   +
Sbjct: 263 FRDDGRVDDGMPAQTAAQRRLINETYVLSNPRLTQAGAVLNREYFVDKMKTITEASQMTQ 322

Query: 273 DPKLFKMLQLSLFPLNPEITADK---FLTLMQENDP-----------IVSQVKYFFQINF 318
             +L  ML +S F L      DK   +  L   NDP           +V   + F   NF
Sbjct: 323 FARLRTMLIVS-FNLTDNDETDKKIGWAVLQDPNDPQSPIHKEKDKGLVDLARAF---NF 378

Query: 319 HRDNSSST-KIQQDS-QIQKMLDLYKKNCQILHDDKMQSL----IKDYQLPLGKIKSIDN 372
             D    T K+ Q + Q+  M++LY       +DDK ++     IK+YQ  +G  K++++
Sbjct: 379 GADGKIKTGKVAQTAEQLNTMMNLYFSR----YDDKDEAADEKAIKNYQRYIGLTKNLED 434

Query: 373 LLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKD 432
            LS         +A+  +I   FAL A+++  ++     L+ V TS+ SDP SY    KD
Sbjct: 435 FLS---------NAQGAVIIRNFALKAFDITAEEASSFTLKRVFTSDLSDPKSYVYTLKD 485

Query: 433 DRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQIST 492
           +R ++L  AFNF+A+G IG   + QS   I    ++Y                 + +   
Sbjct: 486 ERFVRLAKAFNFDAEGKIGSPRLAQSENEITRISRNY--------------LKEVTRWDK 531

Query: 493 QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKS 552
            K++  +   EV YY   + TI + ++LL+++R+L+F+L ++ ID + V  D+L +IFKS
Sbjct: 532 DKKVREKGEKEVAYYRQKMETIETVDQLLSDRRLLDFMLIAQRIDPKTVTTDYLKKIFKS 591

Query: 553 DLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEK 612
           DLKDPKSFANT KD R++ +  SFNFD  G +  K    VQ+   + +T D Y  Q +E+
Sbjct: 592 DLKDPKSFANTEKDARFRALAGSFNFDAKGNIVAKAGQSVQNTRSLMETRDKYVRQTLEQ 651

Query: 613 KEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRIL 672
           +  E++  + LALYFKR   +I N Y+IL D+ L +     L +    A      + +++
Sbjct: 652 RVGEENSGVRLALYFKRMAASISNPYDILADNALAEFTRTALGIPAETANSKVDAQAKMI 711

Query: 673 KKHIKINDFKDSKKVED----FLYAAKAMDHQSIDYKKALFSS 711
           +K +KI D +D KKVE     FL   +A +  S D + ALF S
Sbjct: 712 EKKLKIKDLQDPKKVEKLVNRFLLTFEANNATS-DPRLALFGS 753


>gi|241113587|ref|YP_002973422.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861795|gb|ACS59461.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 727

 Score =  306 bits (783), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 207/712 (29%), Positives = 356/712 (50%), Gaps = 37/712 (5%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ ++V+    ++++ + L S+V+    VS +  YY+E I  ++T+DEF+ D +L+SYA+
Sbjct: 1   MVSTYVSYLSVARNLNASL-SSVASQATVSRDSAYYKENIDKVTTVDEFMSDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+ K+LESDLSD  S  N L+  +Y  FA ++ F+   K  QSD+Q 
Sbjct: 60  KAYGLEDMTYAKAFMTKVLESDLSDSSSFANSLSDTRYAEFAAAFKFAGETKTAQSDVQR 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             ++  Y++S   + +   + + YF +NI  I SVD L    +L +YVL +F ++ +Y S
Sbjct: 120 DNLLDAYEESFDTEADDIADATDYFEENISSITSVDDLLSSSKLKNYVLTAFGLSTEYTS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLK VLT  L +   +  +  D  +  +A+ F F  DGS      ++++ QI  + S 
Sbjct: 180 TSFLKSVLTSDLEDADSFVNQLDDAVYVNLAKAFNFNEDGSTDG--DVMSEDQISLVTSA 237

Query: 240 YFNNTIDCVPIVSDQ------NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITA 293
           Y    +    I S +       Y+   I +++S  + + D KL   L+ +    + E   
Sbjct: 238 Y---AVASATIASSETGEAYDTYFAAQIGNITSVDELMSDDKLVSYLRTAYGLTDSET-- 292

Query: 294 DKFLTLMQENDPIVSQVKY-----FFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQIL 348
           D F++   ++  +   +        F  +   D +     Q   Q       + +N Q+L
Sbjct: 293 DNFISAALKSADVADAIGLSDLHDAFNFDEDGDLADGDTAQTSDQTATTTAAFDENYQVL 352

Query: 349 -HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             +   +    +Y   +  + SID+ L      +  ++ + P +  + AL AY+++   +
Sbjct: 353 VANASTEDATDNYTTRIASVTSIDDFLVSNDDDDDDDNDDLPEL-WEMALRAYDIDPDSV 411

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            R ++R +L S+P+D  SY N   DDR +    AFNF+ +G +  +P+     ++ D+  
Sbjct: 412 SRSEVRKILESDPADSKSYVNSLDDDRFVAFRKAFNFDDNGDV-TVPLQAMSESVVDDYA 470

Query: 468 HY--ANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
            Y   N+ R +  AE                    N E+ Y+   + TI +  E LA+ R
Sbjct: 471 AYYKQNKIRYLEGAE------------LTEATDAANDEITYFREQMATITTASEFLADDR 518

Query: 526 ILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELS 585
           +++F LE+KG+D   V  D L ++F SDL D  S+ N   DNR+ E++ +FNFD  G +S
Sbjct: 519 LVSFALEAKGLDPDDVTSDELEKMFSSDLDDEDSYVNKLDDNRFAELVGAFNFDQDGNIS 578

Query: 586 HKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSK 645
               G VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y ILGDS 
Sbjct: 579 ADPTGTVQQRGDVLETIDAYVRLTLEDDQGDSNTGVRLALYFQRKAPEISSAYNILGDSA 638

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           LF+  +    LS Y + +   K+  ++   I + D  D  KV+D +    AM
Sbjct: 639 LFEFFTTTFNLSSYVSNMDVDKQAEMVDNFIDMKDLSDPDKVDDLIKRFTAM 690


>gi|116248743|ref|YP_764584.1| putative flagella associated protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115253393|emb|CAK11781.1| putative flagella associated protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 727

 Score =  302 bits (774), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 209/712 (29%), Positives = 361/712 (50%), Gaps = 37/712 (5%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ ++V+    ++++ + L S V+    V+ +  YY+E I  ++T+DEF+ D +L+SYA+
Sbjct: 1   MVSTYVSYLTVARNLNASL-SNVASQATVARDSAYYKENIDKVTTVDEFMSDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ F+   K  QSD+Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDTRYAEFAAAFKFAGETKTAQSDVQR 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             ++  Y++S   +     + + YF  NI  I SVD L    +L +YVL +F ++ +Y S
Sbjct: 120 DNLLDAYEESFDTEAGDIADATDYFEDNISSITSVDDLLSSSKLKNYVLTAFGLSTEYTS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLK VLT  L     +  +  D  +  +++ F F  DG L+  D ++++ QI  + S 
Sbjct: 180 SSFLKSVLTSDLDETDSFVNQLDDEVYVNLSKAFNFNEDG-LTDGD-VMSEDQISLVTSA 237

Query: 240 YFNNTIDCVPIVSDQ------NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITA 293
           Y    +    I S +       Y+   I +++S  + + D KL   L+ +    + E   
Sbjct: 238 Y---AVASATIASSETGEAYDTYFAAQIGNITSVDELMSDDKLVSYLRTAYGLTDSET-- 292

Query: 294 DKFLTLMQENDPIVSQV---KYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL 348
           D F++   ++  I   +   +     NF  D   +     Q   Q       + +N ++L
Sbjct: 293 DNFISAALKSADIADAIGLSELHDAFNFDEDGALADGDTAQTSEQTAATTAAFDENYEVL 352

Query: 349 -HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             +   +  + +Y   +  + SID+ L      +  ++ + P +  + AL AY+++   +
Sbjct: 353 IANTDTEDAVDNYTTRIASVTSIDDFLVSNDDDDDDDNDDLPEL-WEMALRAYDIDPDSV 411

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            R ++R +L S+PSD  SY N   DDR +    AFNF+ +G +  +P+     ++ D+  
Sbjct: 412 SRSEVRKILESDPSDSKSYVNSLDDDRFVAFRKAFNFDDNGDV-TVPLQAMSESVVDDYA 470

Query: 468 HY--ANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
            Y   N+ R +   E      M + +         +  + Y+   + TI +  E LA+ R
Sbjct: 471 TYYKQNKIRYLEGDE------MTEATDAA------DEGITYFREQMATITTASEFLADDR 518

Query: 526 ILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELS 585
           +++F+LE+KG+D   V  D L E+F SDL D  S+ N   DNR+ E++ +FNFD  G +S
Sbjct: 519 LVSFVLEAKGLDPDDVTSDALEEMFASDLDDEDSYVNKLDDNRFAELVGAFNFDQDGNIS 578

Query: 586 HKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSK 645
            +  G VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y+ILGDS 
Sbjct: 579 AEPTGTVQQRGDVLETIDAYVRLTLEDDQGDSNTGVRLALYFQRKAPEISSAYDILGDSA 638

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           LF+  +    LS Y + +   K+  ++   I I D  D  KV+D +    AM
Sbjct: 639 LFEFFTTSFNLSSYVSNMDVDKQAEMIDNFIDIEDLSDPDKVDDLIKRFTAM 690


>gi|300023907|ref|YP_003756518.1| hypothetical protein Hden_2400 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525728|gb|ADJ24197.1| protein of unknown function DUF1217 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 710

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 207/710 (29%), Positives = 325/710 (45%), Gaps = 64/710 (9%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           S+  + VS    VS    YY   I  + ++D+F+ + RLFSYA+KA+GL DM++A+ F+K
Sbjct: 16  SRSLARVSGQAEVSSATAYYNANIGKVKSVDDFMNNHRLFSYAMKAYGLEDMTYAKAFMK 75

Query: 76  KILESDLSDP----KSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKT------IIQD 125
           K+L SD+S      KS V +L   ++  FA+++ FS   KV    +  +       +I  
Sbjct: 76  KVLTSDISTSTNLQKSFVGKLTDPRFLKFAQAFQFSADGKVATQPVTAQQANDQSDLINL 135

Query: 126 YKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
           Y Q   +K   A ++S Y++ NI  + SVD L  + RLL+Y L ++ I     S   +K 
Sbjct: 136 YTQQQVNKGATAADDSAYYQANIGNVASVDDLVGNTRLLNYALTAYGIDASIASASAIKQ 195

Query: 186 VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN--N 243
           VLT  L++P   F       ++ +AE F F  DGS++      +D  +   V  Y++   
Sbjct: 196 VLTSDLSDPGS-FANQMPGNYKLLAEAFSFNTDGSINGASAQSSD-DVSFTVYRYYDASG 253

Query: 244 TIDCVPIVS-DQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL----- 297
           T    P  +    YY+ AI  VSS  D L + +LF  L+ + F L+P   +   L     
Sbjct: 254 TGGSAPAAAFKSQYYQDAIAGVSSVDDLLGNARLFIYLETA-FGLDPSEQSTAILRNVLT 312

Query: 298 ---------TLMQENDPIVSQVKYFFQINFHRDNS-SSTKIQQDSQIQKMLDLYKKNCQI 347
                       Q ND   +    F   NF+ D S + ++ Q  SQ    +  +  N   
Sbjct: 313 SDLSDPNSYANQQTNDAYRALAAAF---NFNTDGSINGSEAQTASQTDSTVSSFMTNNTT 369

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             +    S I  Y+  + KI S+ + +     L G            F L A+ ++    
Sbjct: 370 AVEKYQSSQINFYKTDIAKIASVSDFIK-DTGLYG------------FVLSAFGIDPSKT 416

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +  VL S+ S+P SYAN S +    KL  AFNF+ADG        Q   ++   +K
Sbjct: 417 SKLTIEKVLESDASNPSSYANMSHNSAYSKLAAAFNFDADGKAKTASSAQVNASLVSTIK 476

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
            Y N +     AE K                + + E  YY   I TI S +E L NKR++
Sbjct: 477 LY-NSEMGDAKAEKK----------------QTSDEDTYYGNTIGTIKSVDEFLKNKRLV 519

Query: 528 NFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK 587
            F L +  +  + +  D L +I  SD  DPKSF N  +++ Y+ +  +FNF   G+    
Sbjct: 520 TFALTAFDLQDKALSNDTLRKILTSDPTDPKSFINKPENSAYRSMAVAFNFGTDGKDLTT 579

Query: 588 KIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLF 647
              +VQ    +  T D Y  Q +E+   +++    LALYF+R  P+I + Y IL D  L 
Sbjct: 580 PTQQVQTRSQMVATTDAYARQTLEENAGDQNEGARLALYFQRLAPSITSAYSILADKALL 639

Query: 648 KVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           +V    L L    +      +  ++ K +KI D +D +K++ FL    AM
Sbjct: 640 QVAQTALGLPTSMSNADIDVQANMITKKLKIADLQDPEKLKKFLARFSAM 689



 Score = 93.2 bits (230), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 89/386 (23%), Positives = 163/386 (42%), Gaps = 64/386 (16%)

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
           D+ +   ++    ++ S    Y   +GK+KS+D+ ++                   +A+ 
Sbjct: 14  DMSRSLARVSGQAEVSSATAYYNANIGKVKSVDDFMNNHR-------------LFSYAMK 60

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPD----SYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
           AY L      +  ++ VLTS+ S       S+  K  D R +K   AF F+ADG +   P
Sbjct: 61  AYGLEDMTYAKAFMKKVLTSDISTSTNLQKSFVGKLTDPRFLKFAQAFQFSADGKVATQP 120

Query: 455 MMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVD--YYTLNIN 512
           +              AN +  + +           + TQ+++N    +  D  YY  NI 
Sbjct: 121 V----------TAQQANDQSDLIN-----------LYTQQQVNKGATAADDSAYYQANIG 159

Query: 513 TIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEI 572
            + S ++L+ N R+LN+ L + GID+       + ++  SDL DP SFAN    N YK +
Sbjct: 160 NVASVDDLVGNTRLLNYALTAYGIDASIASASAIKQVLTSDLSDPGSFANQMPGN-YKLL 218

Query: 573 ISSFNFDIHGELSHKKIGKVQD-NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTI 631
             +F+F+  G ++        D +F +      Y++                + Y++  I
Sbjct: 219 AEAFSFNTDGSINGASAQSSDDVSFTV------YRYYDASGTGGSAPAAAFKSQYYQDAI 272

Query: 632 PNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
             + +  ++LG+++LF      + L   F + P  +   IL +++  +D  D        
Sbjct: 273 AGVSSVDDLLGNARLF------IYLETAFGLDPSEQSTAIL-RNVLTSDLSDPNS----- 320

Query: 692 YAAKAMDHQSIDYKKALFSSPNQNKD 717
           YA    + Q+ D  +AL ++ N N D
Sbjct: 321 YA----NQQTNDAYRALAAAFNFNTD 342


>gi|222085079|ref|YP_002543609.1| hypothetical protein Arad_1171 [Agrobacterium radiobacter K84]
 gi|221722527|gb|ACM25683.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 836

 Score =  270 bits (689), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 193/702 (27%), Positives = 318/702 (45%), Gaps = 81/702 (11%)

Query: 30  CEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLV 89
            E  Y+ + I  + T+D+ + + RL +Y L+A+GL     +  F+K++L SDLSDP S V
Sbjct: 140 TETTYFSQNISSVKTVDDLLGNSRLKNYVLQAYGLDPTYTSNSFLKQMLTSDLSDPDSFV 199

Query: 90  NQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIH 149
           NQ  S   +     ++F+    V                    K   A  ++ Y+  +I 
Sbjct: 200 NQNGSAADKAIVAEFNFNADGTV--------------------KTSTADADTTYYENHIS 239

Query: 150 KINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAM 209
            I SV QL  D +L +YV  +F I P YI+                K   +        M
Sbjct: 240 TITSVSQLTADPKLFNYVKTAFDI-PAYITATQFNAAAKDASVAATKGLTD-------VM 291

Query: 210 AENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNN------TID-----------CVP--- 249
           A+ F FQ DG+++   +  T  QI      Y  N      T+             VP   
Sbjct: 292 AQ-FNFQSDGTVASGSQAQTSAQISATTDAYATNYKGGPQTLGQMADVMSAYNSAVPSYT 350

Query: 250 --IVSDQN--YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDP 305
             + ++ N  YYK  I S+++  +   D +LF  ++ +       I AD    +++    
Sbjct: 351 TDVGANDNDLYYKEHIGSITTVDELTSDTRLFDYIKTAY-----GIDADTPAVVLKNAFS 405

Query: 306 IVSQVKYFF------QINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLI 357
             S    F       Q NF  D +  S    Q  + I      Y KN Q          +
Sbjct: 406 SSSTAAIFGLTDVVSQFNFQADGTLASGDTAQSQTAIDAASTAYMKNYQTSQTSLTTKAV 465

Query: 358 KDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
            +YQ  +  +K+ID+  +     +   S +      Q A+ AY ++  ++ + Q++ +L 
Sbjct: 466 SNYQTRIAAVKTIDDFFATNATADSDTSNDSLPELYQMAMRAYGISPDEMTKTQMKKILE 525

Query: 418 SNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKR-SI 476
           S+P DP SY N  KD R   L  AFNF++DG + P     S+  I   V  Y++R +  +
Sbjct: 526 SDPYDPKSYVNSLKDTRFTNLAKAFNFDSDGKLKPPVQALSQTQINSYVSEYSSRSKIGL 585

Query: 477 HDAE-NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
             AE  K+ +  +   T             Y+  NI  + S  +LLA+ ++ +++L++ G
Sbjct: 586 TGAELTKATSDAKDAGT-------------YFATNIVKVTSVTDLLADSKLTDYILKANG 632

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           ID + V    L + F SD  D KSF NT    ++K I+++FNFD  G L++ K+G  Q+ 
Sbjct: 633 IDPKTVDTATLKKAFASDPSDSKSFINTDDGAQFKSIVNAFNFDTDGNLTNTKLGTAQNQ 692

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
             I DT DL+ HQ +E +E E +  + LALYF+R  P+I + Y+I+GD+ L++V++    
Sbjct: 693 GTIADTNDLFLHQTLEDQEGETNTGVQLALYFQRKAPDISSIYDIMGDTALYQVITTTYS 752

Query: 656 LSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           L    + +    + ++L K + ++D +D  KV   L    AM
Sbjct: 753 LPSSMSSMDVDTQAKLLAKFVDVSDLQDPTKVNKLLQRFSAM 794



 Score =  187 bits (474), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 170/663 (25%), Positives = 283/663 (42%), Gaps = 99/663 (14%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           YY   I  ++ +D+F+ D +L+SYA++A+GLSDM++A+ F+K++L SDLSD  S  N+L 
Sbjct: 34  YYNANIGKVTNVDDFMGDYQLYSYAMEAYGLSDMTYAKAFMKQVLTSDLSDSTSFANKLT 93

Query: 94  SLKYQYFARSYDFSPPPKVIQSDIQHK-TIIQDYKQSHQHKEEVALEESKYFRKNIHKIN 152
             +Y+ FA +++F             +  +I  Y QS   +   A  E+ YF +NI  + 
Sbjct: 94  DPRYKEFAAAFNFGTGSSSTAQSSTQEDDLIGLYNQSFTTEATNAQTETTYFSQNISSVK 153

Query: 153 SVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAEN 212
           +VD L  + RL +YVLQ++ + P Y S  FLK +LT  L++P  +  ++     +A+   
Sbjct: 154 TVDDLLGNSRLKNYVLQAYGLDPTYTSNSFLKQMLTSDLSDPDSFVNQNGSAADKAIVAE 213

Query: 213 FRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLK 272
           F F  DG                        T+      +D  YY+  I++++S S    
Sbjct: 214 FNFNADG------------------------TVKTSTADADTTYYENHISTITSVSQLTA 249

Query: 273 DPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQ--VKYFFQINFHRDNS--SSTKI 328
           DPKLF  ++ + F +   ITA +F    ++     ++       Q NF  D +  S ++ 
Sbjct: 250 DPKLFNYVK-TAFDIPAYITATQFNAAAKDASVAATKGLTDVMAQFNFQSDGTVASGSQA 308

Query: 329 QQDSQIQKMLDLYKKNC----QIL---------HDDKMQSLIKD---------YQLPLGK 366
           Q  +QI    D Y  N     Q L         ++  + S   D         Y+  +G 
Sbjct: 309 QTSAQISATTDAYATNYKGGPQTLGQMADVMSAYNSAVPSYTTDVGANDNDLYYKEHIGS 368

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
           I ++D L S     +         I   + +DA      D     L+N  +S+ +     
Sbjct: 369 ITTVDELTSDTRLFD--------YIKTAYGIDA------DTPAVVLKNAFSSSST----- 409

Query: 427 ANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYA-NRKRSIHDAENKSF- 484
              +    L  +   FNF ADG++      QS+  I      Y  N + S      K+  
Sbjct: 410 ---AAIFGLTDVVSQFNFQADGTLASGDTAQSQTAIDAASTAYMKNYQTSQTSLTTKAVS 466

Query: 485 NSMEQISTQKRIN--LEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVR 542
           N   +I+  K I+     N+  D  T N     S  EL          + + GI   ++ 
Sbjct: 467 NYQTRIAAVKTIDDFFATNATADSDTSN----DSLPEL------YQMAMRAYGISPDEMT 516

Query: 543 EDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE-------LSHKKIGKVQDN 595
           +  + +I +SD  DPKS+ N+ KD R+  +  +FNFD  G+       LS  +I      
Sbjct: 517 KTQMKKILESDPYDPKSYVNSLKDTRFTNLAKAFNFDSDGKLKPPVQALSQTQINSYVSE 576

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
           +       L   ++ +   + KD       YF   I  + +  ++L DSKL   + K   
Sbjct: 577 YSSRSKIGLTGAELTKATSDAKDAGT----YFATNIVKVTSVTDLLADSKLTDYILKANG 632

Query: 656 LSP 658
           + P
Sbjct: 633 IDP 635



 Score = 68.6 bits (166), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 83/175 (47%), Gaps = 14/175 (8%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           ++ Q+++Q +   +I    DYY  NI  + + ++ + + ++ ++ +E+ G+      + F
Sbjct: 18  TLNQVASQSQSKRQI----DYYNANIGKVTNVDDFMGDYQLYSYAMEAYGLSDMTYAKAF 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++  SDL D  SFAN   D RYKE  ++FNF   G  S  +    +     DD   LY
Sbjct: 74  MKQVLTSDLSDSTSFANKLTDPRYKEFAAAFNFGT-GSSSTAQSSTQE-----DDLIGLY 127

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660
                 +    +        YF + I +++   ++LG+S+L   V +   L P +
Sbjct: 128 NQSFTTEATNAQTETT----YFSQNISSVKTVDDLLGNSRLKNYVLQAYGLDPTY 178



 Score = 60.8 bits (146), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 103/507 (20%), Positives = 187/507 (36%), Gaps = 98/507 (19%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           K      +  YY   I  I+++ +   D +LF+Y   AF +     A +F     ++ ++
Sbjct: 223 KTSTADADTTYYENHISTITSVSQLTADPKLFNYVKTAFDIPAYITATQFNAAAKDASVA 282

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESK- 142
             K L + +    +Q        S      Q          +YK   Q   ++A   S  
Sbjct: 283 ATKGLTDVMAQFNFQSDGTVASGSQAQTSAQISATTDAYATNYKGGPQTLGQMADVMSAY 342

Query: 143 ------------------YFRKNIHKINSVDQLFKDRRLLDYVLQSFSI---TPKYISLP 181
                             Y++++I  I +VD+L  D RL DY+  ++ I   TP  +   
Sbjct: 343 NSAVPSYTTDVGANDNDLYYKEHIGSITTVDELTSDTRLFDYIKTAYGIDADTPAVV--- 399

Query: 182 FLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF 241
            LK+  +   ++    F          +   F FQ DG+L+  D   +   I+   + Y 
Sbjct: 400 -LKNAFS--SSSTAAIF------GLTDVVSQFNFQADGTLASGDTAQSQTAIDAASTAYM 450

Query: 242 NN-----TIDCVPIVSDQNYYKLAINSVSSFSDFLKD-------------PKLFKMLQLS 283
            N     T      VS+   Y+  I +V +  DF                P+L++M  + 
Sbjct: 451 KNYQTSQTSLTTKAVSN---YQTRIAAVKTIDDFFATNATADSDTSNDSLPELYQM-AMR 506

Query: 284 LFPLNPEITADKFLTLMQENDP--------------IVSQVKYFFQINFHRDNSSSTKIQ 329
            + ++P+      +  + E+DP                +  K F   NF  D      +Q
Sbjct: 507 AYGISPDEMTKTQMKKILESDPYDPKSYVNSLKDTRFTNLAKAF---NFDSDGKLKPPVQ 563

Query: 330 QDSQIQ--KMLDLYKKNCQI-LHDDKMQSLIKD-------YQLPLGKIKSIDNLLSGKCQ 379
             SQ Q    +  Y    +I L   ++     D       +   + K+ S+ +LL     
Sbjct: 564 ALSQTQINSYVSEYSSRSKIGLTGAELTKATSDAKDAGTYFATNIVKVTSVTDLL----- 618

Query: 380 LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
                 A+  +    + L A  ++ + +D   L+    S+PSD  S+ N     +   + 
Sbjct: 619 ------ADSKLT--DYILKANGIDPKTVDTATLKKAFASDPSDSKSFINTDDGAQFKSIV 670

Query: 440 HAFNFNADGSI--GPIPMMQSRLTIRD 464
           +AFNF+ DG++    +   Q++ TI D
Sbjct: 671 NAFNFDTDGNLTNTKLGTAQNQGTIAD 697



 Score = 43.5 bits (101), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 87/426 (20%), Positives = 156/426 (36%), Gaps = 103/426 (24%)

Query: 255 NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYF- 313
           +YY   I  V++  DF+ D +L+    +  + L+    A  F+  +  +D  +S    F 
Sbjct: 33  DYYNANIGKVTNVDDFMGDYQLYS-YAMEAYGLSDMTYAKAFMKQVLTSD--LSDSTSFA 89

Query: 314 ----------FQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLP 363
                     F   F+    SS+  Q  +Q   ++ LY ++         Q+    +   
Sbjct: 90  NKLTDPRYKEFAAAFNFGTGSSSTAQSSTQEDDLIGLYNQSFTT-EATNAQTETTYFSQN 148

Query: 364 LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
           +  +K++D+LL G  +L+             + L AY L+        L+ +LTS+ SDP
Sbjct: 149 ISSVKTVDDLL-GNSRLK------------NYVLQAYGLDPTYTSNSFLKQMLTSDLSDP 195

Query: 424 DSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKS 483
           DS+ N++       +   FNFNADG++                      K S  DA+   
Sbjct: 196 DSFVNQNGSAADKAIVAEFNFNADGTV----------------------KTSTADADTT- 232

Query: 484 FNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE 543
                                 YY  +I+TI S  +L A+ ++ N++         K   
Sbjct: 233 ----------------------YYENHISTITSVSQLTADPKLFNYV---------KTAF 261

Query: 544 DFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
           D    I  +        A+        ++++ FNF   G ++     + Q +  I  T D
Sbjct: 262 DIPAYITATQFNAAAKDASVAATKGLTDVMAQFNFQSDGTVASGS--QAQTSAQISATTD 319

Query: 604 LYK-------HQMIEKKEEEKDPNIALA------------LYFKRTIPNIRNHYEILGDS 644
            Y          + +  +     N A+             LY+K  I +I    E+  D+
Sbjct: 320 AYATNYKGGPQTLGQMADVMSAYNSAVPSYTTDVGANDNDLYYKEHIGSITTVDELTSDT 379

Query: 645 KLFKVV 650
           +LF  +
Sbjct: 380 RLFDYI 385


>gi|307309365|ref|ZP_07589028.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
 gi|307320101|ref|ZP_07599522.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
 gi|306894316|gb|EFN25081.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
 gi|306900234|gb|EFN30852.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
          Length = 769

 Score =  263 bits (672), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 199/734 (27%), Positives = 341/734 (46%), Gaps = 96/734 (13%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VS+  IV+ + +YYRE I  ++++DEF+ D RL+SYA+KA+GL+DM  +  F++K+LESD
Sbjct: 22  VSEQTIVARDTQYYRENIGSVASVDEFLADYRLYSYAMKAYGLADMIESVAFMRKVLESD 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
           LSD  S  N+L   +Y+ F  ++ FS    V Q++ Q   +I  Y  S     E   EE+
Sbjct: 82  LSDDNSFANKLTDERYRDFTMAFSFSGGTAVSQTEAQLDEMIGLYNTSIASIGETQKEET 141

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY---F 198
           +Y+   I K+ SVDQL  + RL  YV   F I     S   L+ VL+    +P  Y    
Sbjct: 142 RYYNVMIDKVTSVDQLLNNDRLRTYVFTVFGIDESTYSRETLRKVLSSNADDPDSYENTV 201

Query: 199 IESR-----------------------------------------DNRFRAMAENFRFQP 217
           +E R                                          + + AMA  F+F+ 
Sbjct: 202 LEPRLSELEAARADAQAKLQQSGTTQAEKLELQAKIATYNKSISTVSNYLAMAAAFQFEA 261

Query: 218 DGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS--DQNYYKLAINSVSSFSDFLKDPK 275
           DG+++      T    + +   Y ++     P  +  ++ Y++  I S+++ S+ + D +
Sbjct: 262 DGTVAA-GSAQTAAHKKTMNELYVSSNSRVTPQAALLNKAYFEEKIASITTVSELVADTR 320

Query: 276 L-------FKMLQLSLFPLNPE--ITAD-----KFL-TLMQENDPIVSQVKYFFQINFHR 320
           L       F + ++++ P   +  +T+D      ++ T+ + N+   +  + F   NF  
Sbjct: 321 LYNYIRTAFDLNEVTIVPATIKNILTSDPDDPNSYINTIGKGNENYKALARAF---NFQA 377

Query: 321 DNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKC 378
           D +  +    Q   Q       Y        D   +  I  Y+L + K+ S+ + +    
Sbjct: 378 DGTLAAGDAAQTAEQTTLTSSRYMTRYNDKDDAADEKAIGAYKLAVEKMTSVSDFI---- 433

Query: 379 QLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKL 438
                    E      FAL A  L+        ++ VLTS+ +DP+S+    KD+R +KL
Sbjct: 434 ---------ETASIYDFALQAVGLDPDSESARTIKRVLTSDLTDPESFVYTLKDERYLKL 484

Query: 439 NHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINL 498
              FNF   G IG   + QS   I++  K Y   K      E+K+               
Sbjct: 485 AQLFNFTTSGDIGVPALAQSETLIQETAKTYIVNKSRFGSEEDKT--------------- 529

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           +  +E +YYT  +  + S +E LA+ R+++F LE+ GID + V  DFL +IF SDL DPK
Sbjct: 530 KAEAEAEYYTAEVAKLSSLDEFLADSRLVDFALEANGIDPENVTLDFLRDIFTSDLDDPK 589

Query: 559 SFANTYKD-NRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEK 617
           SF N  ++   Y  +++SFNFD  G +  +    +     + +T D Y HQ +E++  E 
Sbjct: 590 SFINQQQNSGAYIALVTSFNFDSGGNVLREDKSVIITRQGLYETLDRYLHQSLEEQAGED 649

Query: 618 DPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK 677
           +  + LALYF+R   ++ + Y++L D  L +V      L   F+ +   ++ +I++K++ 
Sbjct: 650 NAGVRLALYFERQAGSLVDAYDLLADDALAEVFRTIFSLPDEFSSMDIDQQAKIVEKNLD 709

Query: 678 INDFKDSKKVEDFL 691
           +    D  +++  L
Sbjct: 710 LEKLSDPAELKKLL 723


>gi|15964619|ref|NP_384972.1| hypothetical protein SMc00986 [Sinorhizobium meliloti 1021]
 gi|15073797|emb|CAC45438.1| Hypothetical protein SMc00986 [Sinorhizobium meliloti 1021]
          Length = 769

 Score =  257 bits (657), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 199/734 (27%), Positives = 338/734 (46%), Gaps = 96/734 (13%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VS+  IV+ + +YYRE I  ++++DEF+ D RL SYA+KA+GL+DM  +  F++K+LESD
Sbjct: 22  VSEQTIVARDTQYYRENIGSVASVDEFLADYRLHSYAMKAYGLADMIESVAFMRKVLESD 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
           LSD  S  N+L   +Y+ F  ++ FS    V Q++ Q   +I  Y  S     E   EE+
Sbjct: 82  LSDDNSFANKLTDERYRDFTMAFSFSGGTAVSQTEAQLDEMIGLYNTSIASIGETQKEET 141

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY---F 198
           +Y+   I K+ SVDQL  + RL  YV   F I     S   L+ VL+    +P  Y    
Sbjct: 142 RYYNVMIDKVTSVDQLLNNDRLRTYVFTVFGIDESTYSRETLRKVLSSNADDPDSYENTV 201

Query: 199 IESR-----------------------------------------DNRFRAMAENFRFQP 217
           +E R                                          + + AMA  F+F+ 
Sbjct: 202 LEPRLSELEAARADAQAKLQQSGTTQAEKLELQAKIATYNKSISTVSNYLAMAAAFQFEA 261

Query: 218 DGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNY--YKLAINSVSSFSDFLKDPK 275
           DG+++      T    + +   Y ++     P  +  N   ++  I S+++ S+ + D +
Sbjct: 262 DGTVAA-GSAQTAAHKKTMNELYVSSNSRVTPQAALLNKADFEEKIASITTVSELVADTR 320

Query: 276 L-------FKMLQLSLFPLNPE--ITAD-----KFL-TLMQENDPIVSQVKYFFQINFHR 320
           L       F + ++++ P   +  +T+D      ++ T+ + N+   +  + F   NF  
Sbjct: 321 LYNYIRTAFDLNEVTIVPATIKNILTSDPDDPNSYINTIGKGNENYKALARAF---NFQA 377

Query: 321 DNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKC 378
           D +  +    Q   Q       Y        D   +  I  Y+L + K+ S+ + +    
Sbjct: 378 DGTLAAGDAAQTAEQTTLTSSRYMTRYNDKDDAADEKAIGAYKLAVEKMTSVSDFI---- 433

Query: 379 QLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKL 438
                    E      FAL A  L+        ++ VLTS+ +DP+S+    KD+R +KL
Sbjct: 434 ---------ETASIYDFALQAVGLDPDSESARTIKRVLTSDLTDPESFVYTLKDERYLKL 484

Query: 439 NHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINL 498
              FNF   G IG   + QS   I++  K Y   K      E+K+               
Sbjct: 485 AQLFNFTTSGDIGVPALAQSETLIQETAKTYIVNKSRFGSEEDKT--------------- 529

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           +  +E +YYT  +  + S +E LA+ R+++F LE+ GID + V  DFL +IF SDL DPK
Sbjct: 530 KAEAEAEYYTAEVAKLSSLDEFLADSRLVDFALEANGIDPENVTLDFLRDIFTSDLDDPK 589

Query: 559 SFANTYKD-NRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEK 617
           SF N  ++   Y  +++SFNFD  G +  +    +     + +T D Y HQ +E++  E 
Sbjct: 590 SFINQQQNSGAYIALVTSFNFDSGGNVLREDKSVIITRQGLYETLDRYLHQSLEEQAGED 649

Query: 618 DPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK 677
           +  + LALYF+R   ++ + Y++L D  L +V      L   F+ +   ++ +I++K++ 
Sbjct: 650 NAGVRLALYFERQAGSLVDAYDLLADDALAEVFRTIFSLPDEFSSMDIDQQAKIVEKNLD 709

Query: 678 INDFKDSKKVEDFL 691
           +    D  +++  L
Sbjct: 710 LEKLSDPAELKKLL 723


>gi|90420304|ref|ZP_01228212.1| putative IMP dehydrogenase/GMP reductase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335638|gb|EAS49388.1| putative IMP dehydrogenase/GMP reductase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 725

 Score =  257 bits (656), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 193/699 (27%), Positives = 319/699 (45%), Gaps = 64/699 (9%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           ++ DP+V  E  YYR  I  +STIDEF+ D RL+SYA+KA GL +   ++  IKK+LESD
Sbjct: 32  IAADPVVKREAEYYRTNIHSVSTIDEFMADYRLYSYAMKAHGLEEQIGSKALIKKVLESD 91

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDF----SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVA 137
           LSD KSL N+L+  +Y+ FA+++ F     PP  V Q+  Q   +++ Y        +V 
Sbjct: 92  LSDSKSLANKLSDERYRTFAKAFSFINTAEPPVLVAQTVGQTDLVVEAYSDYRTRAGQVH 151

Query: 138 LEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY 197
              +K +   I  I++VD+      L +  L S  I P   S  F++DVLT    N    
Sbjct: 152 ATAAKAYMDGIGAISNVDEFLNSTHLFNVSLASVGIDPSIASRSFIRDVLT---GNAADG 208

Query: 198 FIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNN---TIDCVPIVSDQ 254
              + DNR+  +A    F+PDGS+     + ++ +    V  YF                
Sbjct: 209 PAANGDNRYADLAAMLAFEPDGSIPA-GGLQSEKEANNTVFEYFAKKGLATSEQAAAYQV 267

Query: 255 NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE--------ITAD-----KFLTLMQ 301
           +YY+  I  + +  + + DP+LF +   S+   + E        IT+D       L  M 
Sbjct: 268 SYYESEIAKIRTADELVNDPRLFGIALSSVGLSDSEMPSYAWTLITSDPDDPNSDLNQMP 327

Query: 302 ENDP--IVSQVKY-FFQINFHRDNSSSTKI----QQDSQIQKMLDLYKKN--CQILHDDK 352
           E+ P  +  + KY      F+ D   +  +    Q D+  +  +D Y  N       +DK
Sbjct: 328 EDTPASLARKEKYKLLNERFNFDTQGNLPVGEPAQSDAAREATVDGYFANYRTATAGNDK 387

Query: 353 MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQL 412
           + + +  +++ +  + ++   +S                   +AL A+ L+     R  +
Sbjct: 388 IATSL--FRVAVSGMSTVRQFVSSSA-------------VYDYALKAFGLDPATESRSSI 432

Query: 413 RNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANR 472
             VL S+PSDP SYAN   +DR +KL  AFNF+  G I    + Q+     D    YA  
Sbjct: 433 MRVLRSDPSDPSSYANSLNNDRYVKLAAAFNFDDSGKIAAQRIAQTEANQIDTATRYAG- 491

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                     SF      +  K I     +    Y   + +I S  + ++NK ++NF L+
Sbjct: 492 ----------SFGDTPTTAESKAITEATTA----YKKALLSIVSVNDFVSNKTVVNFALK 537

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G+++ ++ +  L  I  SD  DP+SF N   D R  E  +++ F   G +  + + ++
Sbjct: 538 AYGLEADRLSQKDLVSILTSDPSDPESFVNKSGDRRLIEFAAAYAFTPDGGI-ERGVHEI 596

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q       T D Y  Q +E++    + ++ LALYF+R  P + + YEIL D  L  VV  
Sbjct: 597 QSASDFLSTQDFYLRQTMEEEAGADNESVRLALYFRRLAPELTSIYEILADPALLTVVQT 656

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
            + L    +      + R ++K + +   KD K +E F+
Sbjct: 657 AVGLPAESSQSNLDLQKRTIEKKLDLETLKDPKGLERFI 695


>gi|227821060|ref|YP_002825030.1| putative flagella associated protein [Sinorhizobium fredii NGR234]
 gi|227340059|gb|ACP24277.1| putative flagella associated protein [Sinorhizobium fredii NGR234]
          Length = 769

 Score =  253 bits (646), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 192/735 (26%), Positives = 335/735 (45%), Gaps = 98/735 (13%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VS+  +V+ + +YY+E I ++S++D F+ D RL+SYA+ AFGL DM  +  F++K+LESD
Sbjct: 22  VSEQTVVARDTQYYKENIGNVSSVDAFLDDYRLYSYAMTAFGLGDMIDSVAFMRKVLESD 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
           LSD  S  N L   +Y+ FA +Y FS    V Q++ Q   II  Y  S  +  E   EE+
Sbjct: 82  LSDTSSFANSLTDDRYREFALAYSFSGATAVSQTEAQLDEIIGLYDTSILNIAETQEEET 141

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL------------ 189
           +Y+   I KI SVDQL  + RL  YV  +F +     S   ++ VL+             
Sbjct: 142 RYYNVMIDKITSVDQLLNNDRLRAYVFTAFGVDESTYSRQTIRSVLSSSSGDASSYENTV 201

Query: 190 ----------------------GLANPKKYFIESRD----------NRFRAMAENFRFQP 217
                                 GL + ++  +ES+           N +  +A  F F  
Sbjct: 202 IAPKLSELETAKAAAEAQLTAGGLTDEEEAELESKITTYANSIATLNNYIDLAAAFDFNS 261

Query: 218 DGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPK 275
           DG+++      TD   E     Y   N+ +     + ++ Y++  I S+++ ++ L D +
Sbjct: 262 DGTVTA-GAAQTDENKETTNELYISSNSRVTSQAALLNKAYFEETIASITTVTELLADTR 320

Query: 276 LFKMLQLSLFPLNPEITA----------------DKFLTLMQENDPIVSQVKYFFQINFH 319
           L+  ++ + F L+ E+T                 D ++  +   D     +   F  NF 
Sbjct: 321 LYNYIRTA-FDLD-EVTIVSATIKNILTSDPDDPDSYVNTIGGGDANYLALANAF--NFQ 376

Query: 320 RDNSSSTKIQQDSQIQKML--DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGK 377
            D + +      +  Q  L  + Y        D+  +  +  Y+  +  + S+D+ + G 
Sbjct: 377 EDGTLAVGDSAQTAAQTTLTSNRYMTRYNDKDDEADEKAVSAYKTAVASMTSVDDFI-GS 435

Query: 378 CQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIK 437
             +              FAL A  L+        ++ VLTS+ +DP SY    KD+R + 
Sbjct: 436 ASI------------YDFALKAVGLDPDTASTRTIKRVLTSDLTDPKSYVYSLKDERYVT 483

Query: 438 LNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRIN 497
           L   FNF  +G IGP  + QS   I++  K++   K      ++K+              
Sbjct: 484 LAKLFNFTTEGEIGPPALAQSETQIQETAKNHIVIKSRFGSEDDKT-------------- 529

Query: 498 LEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDP 557
            +   E +YYT  +  + S +E LA+ R++   LE+ GID + V  D L +IF SDL DP
Sbjct: 530 -KAQEESEYYTAGVAKLSSLDEFLADDRLVTIALEANGIDPEGVTADVLRQIFNSDLDDP 588

Query: 558 KSFANTYKDNR-YKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEE 616
           +S  N  +++  Y  +++SFNFD  G +  +    +     + +T D Y  Q +E++  E
Sbjct: 589 ESVINEQENSAAYVSLVTSFNFDSEGNVLREDRDSIVTRQGLYETLDQYLRQTLEEQAGE 648

Query: 617 KDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHI 676
            +  + LALYF+R   ++ + Y++L D  L +V      L   F+ +   ++ +I++K++
Sbjct: 649 SNEGVRLALYFERKAGSLVDAYDLLADDALAEVFRTIFSLPDEFSTMDIDQQAKIVEKNL 708

Query: 677 KINDFKDSKKVEDFL 691
            +    D  +++  L
Sbjct: 709 DLEKLSDPAELKKLL 723


>gi|27379820|ref|NP_771349.1| hypothetical protein blr4709 [Bradyrhizobium japonicum USDA 110]
 gi|27352973|dbj|BAC49974.1| blr4709 [Bradyrhizobium japonicum USDA 110]
          Length = 687

 Score =  241 bits (616), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 202/715 (28%), Positives = 329/715 (46%), Gaps = 79/715 (11%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           V+ E  YY+  I  + T+D+ +KD RL+ YALKA+GL DM++A+ F++K+LESDLSD KS
Sbjct: 28  VAREAAYYKANIGKVKTVDDLMKDYRLYHYALKAYGLEDMAYAKAFMRKVLESDLSDAKS 87

Query: 88  LVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRK 146
            VN+L   +Y+ FA ++ F+     V QS+ Q    I  Y  + + + +   +++KY+  
Sbjct: 88  FVNKLVDKRYREFAAAFSFNGTATPVAQSENQTDETIGLYTATKKSQVDALADDTKYYSA 147

Query: 147 NIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRF 206
            I  I+S DQL  + RL +YV  +F I         +  VL    ++P  Y   +  ++ 
Sbjct: 148 QIGSISSADQLLNNDRLRNYVYSAFGIDQSKWPPDTISQVLRSDPSDPNSYVNTAFASQL 207

Query: 207 RAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDC----VPIVSDQNYYKLAIN 262
             +          + +K D   T+ +I    +       D     V I+ ++ + +    
Sbjct: 208 TGLNAQL------AQAKSDVSATNTKIADYTAQLSQPGADVAQLNVQILVEKYHLESYTK 261

Query: 263 SVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHR-D 321
           S+SS +D +     F  L  +      E +AD  L        + +Q      +   R D
Sbjct: 262 SISSLNDQIATIGGFVDLAGAF-----EFSADGSLP-----SGVPAQTAANVTLTTKRFD 311

Query: 322 NSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKD---YQLPLGKIKSIDNLLSGKC 378
           +S S      S + +     +    I   D +Q+ +     Y   LG +           
Sbjct: 312 DSKSDVYAAASPLNEAFATVQFRNAIGKIDSVQAFVSTPAVYDFALGAV----------- 360

Query: 379 QLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKL 438
              G + AE    T++ AL+                   S+ SDP S+    KD+R ++L
Sbjct: 361 ---GLDPAEVSQATVKAALE-------------------SDLSDPKSFVYTLKDNRYVEL 398

Query: 439 NHAFNFNADGSIGPIPMMQSRLTIRDNVKHY--ANRKRSIHDAENKSFNSMEQISTQKRI 496
             AFNF+A+G++    + Q    +    K Y  A  K++          S EQ   QK +
Sbjct: 399 ARAFNFDANGNLTTPLVAQDSAKVLQTAKDYVIAVLKQA----------SPEQ---QKAV 445

Query: 497 NLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKD 556
             +   +   Y   I  I S  ELLAN+++++F+L +KG+D +KV  ++L +IF SDL +
Sbjct: 446 REQAQKDATSYQEAIAGIDSVSELLANRKMVDFILVAKGLDPKKVSTEYLKKIFASDLNN 505

Query: 557 PKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEE 616
           PKSFANT  D+R+ EI +SFNFD    ++   +   Q    + +T   Y  Q +E+++ +
Sbjct: 506 PKSFANTESDHRFAEIAASFNFDSKDNVARLAMVGPQKQVQLRETQANYLQQSLEQQQGD 565

Query: 617 KDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHI 676
            +P + LALYF+R    I + Y+IL D  L +V      L    A +P  ++ + + K +
Sbjct: 566 TNPGVRLALYFQRKAGEITSAYDILADKALSEVFRTTFNLPDSMAAMPIDQQAKFVDKFM 625

Query: 677 KINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVS 731
           KI D  D  KVE  L    AM     D K     S  Q + P  N F    + +S
Sbjct: 626 KIKDLSDPAKVEKLLGRFSAM----YDVKNG--QSIGQGQSPLLNLFQGSGSGLS 674



 Score = 78.2 bits (191), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 107/256 (41%), Gaps = 58/256 (22%)

Query: 310 VKYFFQINF--HRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKI 367
           V  +F  N+  H    S T+++Q + + +    YK N                   +GK+
Sbjct: 2   VSTYFSYNYISHHLKQSLTRVEQQTDVAREAAYYKAN-------------------IGKV 42

Query: 368 KSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYA 427
           K++D+L+             +      +AL AY L      +  +R VL S+ SD  S+ 
Sbjct: 43  KTVDDLM-------------KDYRLYHYALKAYGLEDMAYAKAFMRKVLESDLSDAKSFV 89

Query: 428 NKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSM 487
           NK  D R  +   AF+FN   +    P+ QS     + +  Y   K+S  DA        
Sbjct: 90  NKLVDKRYREFAAAFSFNGTAT----PVAQSENQTDETIGLYTATKKSQVDA-------- 137

Query: 488 EQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC 547
                       +  +  YY+  I +I S ++LL N R+ N++  + GID  K   D + 
Sbjct: 138 ------------LADDTKYYSAQIGSISSADQLLNNDRLRNYVYSAFGIDQSKWPPDTIS 185

Query: 548 EIFKSDLKDPKSFANT 563
           ++ +SD  DP S+ NT
Sbjct: 186 QVLRSDPSDPNSYVNT 201



 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 107/492 (21%), Positives = 189/492 (38%), Gaps = 103/492 (20%)

Query: 18  LFSTVSKDPI--VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           L++   K  +  ++ + +YY  +I  IS+ D+ + + RL +Y   AFG+         I 
Sbjct: 126 LYTATKKSQVDALADDTKYYSAQIGSISSADQLLNNDRLRNYVYSAFGIDQSKWPPDTIS 185

Query: 76  KILESDLSDPKSLVN-----QLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDY-KQS 129
           ++L SD SDP S VN     QL  L  Q      D S             T I DY  Q 
Sbjct: 186 QVLRSDPSDPNSYVNTAFASQLTGLNAQLAQAKSDVSAT----------NTKIADYTAQL 235

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD-VLT 188
            Q   +VA       + N+       Q+  ++    Y L+S++      S+  L D + T
Sbjct: 236 SQPGADVA-------QLNV-------QILVEK----YHLESYT-----KSISSLNDQIAT 272

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
           +G               F  +A  F F  DGSL       T   +      + ++  D  
Sbjct: 273 IG--------------GFVDLAGAFEFSADGSLPSGVPAQTAANVTLTTKRFDDSKSDVY 318

Query: 249 PIVSDQN------YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
              S  N       ++ AI  + S   F+  P ++    L    L+P   +   +    E
Sbjct: 319 AAASPLNEAFATVQFRNAIGKIDSVQAFVSTPAVYD-FALGAVGLDPAEVSQATVKAALE 377

Query: 303 NDPIVSQVKYFF-------------QINFHRDNSSSTK-IQQDSQ---------IQKMLD 339
           +D  +S  K F                NF  + + +T  + QDS          +  +L 
Sbjct: 378 SD--LSDPKSFVYTLKDNRYVELARAFNFDANGNLTTPLVAQDSAKVLQTAKDYVIAVLK 435

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
                 Q    ++ Q     YQ  +  I S+  LL+ +  ++             F L A
Sbjct: 436 QASPEQQKAVREQAQKDATSYQEAIAGIDSVSELLANRKMVD-------------FILVA 482

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM--Q 457
             L+ + +  + L+ +  S+ ++P S+AN   D R  ++  +FNF++  ++  + M+  Q
Sbjct: 483 KGLDPKKVSTEYLKKIFASDLNNPKSFANTESDHRFAEIAASFNFDSKDNVARLAMVGPQ 542

Query: 458 SRLTIRDNVKHY 469
            ++ +R+   +Y
Sbjct: 543 KQVQLRETQANY 554



 Score = 59.3 bits (142), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 76/160 (47%), Gaps = 10/160 (6%)

Query: 487 MEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL 546
           ++Q  T+     ++  E  YY  NI  + + ++L+ + R+ ++ L++ G++     + F+
Sbjct: 15  LKQSLTRVEQQTDVAREAAYYKANIGKVKTVDDLMKDYRLYHYALKAYGLEDMAYAKAFM 74

Query: 547 CEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYK 606
            ++ +SDL D KSF N   D RY+E  ++F+F+             Q     D+T  LY 
Sbjct: 75  RKVLESDLSDAKSFVNKLVDKRYREFAAAFSFN------GTATPVAQSENQTDETIGLY- 127

Query: 607 HQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKL 646
                 K+ + D       Y+   I +I +  ++L + +L
Sbjct: 128 ---TATKKSQVDALADDTKYYSAQIGSISSADQLLNNDRL 164



 Score = 58.9 bits (141), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 71/146 (48%), Gaps = 4/146 (2%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
           + + +VA  E+ Y++ NI K+ +VD L KD RL  Y L+++ +     +  F++ VL   
Sbjct: 23  EQQTDVA-REAAYYKANIGKVKTVDDLMKDYRLYHYALKAYGLEDMAYAKAFMRKVLESD 81

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPI 250
           L++ K +  +  D R+R  A  F F    +   + +  TD  I  + +    + +D   +
Sbjct: 82  LSDAKSFVNKLVDKRYREFAAAFSFNGTATPVAQSENQTDETI-GLYTATKKSQVDA--L 138

Query: 251 VSDQNYYKLAINSVSSFSDFLKDPKL 276
             D  YY   I S+SS    L + +L
Sbjct: 139 ADDTKYYSAQIGSISSADQLLNNDRL 164


>gi|150395704|ref|YP_001326171.1| hypothetical protein Smed_0479 [Sinorhizobium medicae WSM419]
 gi|150027219|gb|ABR59336.1| protein of unknown function DUF1217 [Sinorhizobium medicae WSM419]
          Length = 822

 Score =  232 bits (592), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 193/737 (26%), Positives = 331/737 (44%), Gaps = 102/737 (13%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VS+  IV+ + +YYRE I  ++++D F+ D RL+SYA+KA+GL DM  +  F++K+LESD
Sbjct: 75  VSEQTIVARDTQYYRENIASVASVDAFLADYRLYSYAMKAYGLGDMIDSVAFMRKVLESD 134

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
           L+D  S  N+L   +Y+ FA ++ FS    V Q++ Q   +I  Y  S     E   EE+
Sbjct: 135 LADDNSFANKLTDERYREFAMAFSFSGGTAVSQTEAQLDEMIGLYNTSIASIGETQKEET 194

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY---F 198
           +Y+   + K+ SVDQL  + RL  Y+   F I     S   L++VL+    +P  Y    
Sbjct: 195 RYYNLMVDKVTSVDQLLNNDRLRAYIFTVFGIDESTYSRETLRNVLSSNADDPDSYENTV 254

Query: 199 IESRDNRFR-----------------------------------------AMAENFRFQP 217
           +E R    +                                         AMA  F+F  
Sbjct: 255 LEPRLTELQTARADAQAKLQQSGTTQAEKLELQAKIATYNKSISTVSNYLAMAAAFQFSA 314

Query: 218 DGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS--DQNYYKLAINSVSSFSDFLKDPK 275
           DG+++      T    + +   Y ++     P  +  ++ Y++  I S+++ S+ + D +
Sbjct: 315 DGTVAA-GSAQTAAHKKTMNELYVSSNPRITPQAALLNKAYFEEKIASITNVSELVADTR 373

Query: 276 LFKMLQLSLFPLNPEITA----------------DKFL-TLMQENDPIVSQVKYFFQINF 318
           ++  ++ + F LN E+T                 D ++ T+ + N+   +  + F   NF
Sbjct: 374 IYNYIRTA-FDLN-EVTIVPATIKNILTSDPDDPDSYINTIGKGNENYKALARAF---NF 428

Query: 319 HRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSG 376
             D +  +    Q   Q       Y        D   +  I  Y+L + K+ S+ + +  
Sbjct: 429 QADGTLAAGDAAQTAEQTTLTSSRYMTRYNDKDDAADEKAIGAYKLAVEKMVSVGDFI-- 486

Query: 377 KCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLI 436
                      E      FAL A  L+        ++ VL S+ +DP S+    KD+R +
Sbjct: 487 -----------ETASIYDFALKAVGLDPDAESTRTIKRVLMSDLTDPGSFVYTLKDERYL 535

Query: 437 KLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHY-ANRKRSIHDAENKSFNSMEQISTQKR 495
           KL   FNF   G IG   + Q    I++  K Y  N+ R         F S E  +  + 
Sbjct: 536 KLAQLFNFTTSGDIGVPALAQPETLIQETAKTYIVNKSR---------FGSEEDKAEAEA 586

Query: 496 INLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLK 555
                 +EV         + S +  LA+ R++ F LE+ GID + V  DFL EIF SDL 
Sbjct: 587 EAEYYTAEV-------AKLASLDAFLADSRLVAFALEANGIDPENVTIDFLREIFTSDLD 639

Query: 556 DPKSFANTYKD-NRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKE 614
           DPKSF N  ++   Y  +++S+NFD  G +  +    +     + +T D Y HQ +E++ 
Sbjct: 640 DPKSFINQQQNSGSYIALVTSYNFDRSGNILREDKSVIITRQGLYETFDRYLHQTLEEQA 699

Query: 615 EEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKK 674
            E +  + LALYF+R   ++ + Y++L D  L +V      L   F+ +   ++ +I++K
Sbjct: 700 GEDNAGVRLALYFERQAGSLVDAYDLLADDALAEVFRTIFSLPDEFSSMDIDQQAKIVEK 759

Query: 675 HIKINDFKDSKKVEDFL 691
           ++ +    +  +++  L
Sbjct: 760 NLDLEKLSEPAELKKLL 776



 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 85/170 (50%), Gaps = 10/170 (5%)

Query: 111 KVIQSDIQHKTIIQDYKQSHQHKEE--VALEESKYFRKNIHKINSVDQLFKDRRLLDYVL 168
           +++ + + +  I +D K S +   E  +   +++Y+R+NI  + SVD    D RL  Y +
Sbjct: 53  RMVSTYLDYNLIARDMKLSLRRVSEQTIVARDTQYYRENIASVASVDAFLADYRLYSYAM 112

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKIL 228
           +++ +     S+ F++ VL   LA+   +  +  D R+R  A  F F    ++S+     
Sbjct: 113 KAYGLGDMIDSVAFMRKVLESDLADDNSFANKLTDERYREFAMAFSFSGGTAVSQ----- 167

Query: 229 TDMQIEKIVSNYFNNTIDCVPIV--SDQNYYKLAINSVSSFSDFLKDPKL 276
           T+ Q+++++  Y N +I  +      +  YY L ++ V+S    L + +L
Sbjct: 168 TEAQLDEMIGLY-NTSIASIGETQKEETRYYNLMVDKVTSVDQLLNNDRL 216


>gi|190890609|ref|YP_001977151.1| hypothetical protein RHECIAT_CH0000988 [Rhizobium etli CIAT 652]
 gi|190695888|gb|ACE89973.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 1111

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 174/671 (25%), Positives = 300/671 (44%), Gaps = 124/671 (18%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  +  +D+F+ D +L+SYA+
Sbjct: 1   MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVKDVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPDKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DDLIGLYKQSFVDADKAAAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++   +  T  Q    +  
Sbjct: 180 KDFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTVTGTAQ--TAAQKASAIET 237

Query: 240 YFNNTIDCV---PIVSD------------QNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+   +    + SD            Q YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNAVGSDVVYVSKTAADYNQAYYTAKIGTITNVDDLVADARLTSYIK-TA 296

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYFFQI----NFHRDNSSST--KIQQDSQIQKML 338
           + +  + TA     ++   DP  +Q+  F  +    NF  D S+ST  + Q   Q  K+ 
Sbjct: 297 YSMGADFTAPALRMVL--TDPSYAQLMGFTNVYNAFNFKSDGSTSTTARAQTIDQANKLA 354

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
                           S           I ++D+LL+               +  ++  D
Sbjct: 355 SAASSTANYYSVTSQSS----------GITNVDDLLADS-------------VMARYIKD 391

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQS 458
           AY L + +    +L+N+LT +     SYA          LN  FNFNADGS         
Sbjct: 392 AYGLGV-NFSNAELKNILTDS-----SYAAAQGQ---AGLNADFNFNADGS--------- 433

Query: 459 RLTIRDNVKHYANRKRSIHD--AENKS-FNSMEQISTQKRINLEINSEVDYYTLNINTIH 515
              I  +V   A +++S  D  A N + FN+M                       I ++ 
Sbjct: 434 ---INGSVIQTAAQRKSTTDKSAANAAHFNAM-----------------------IGSVT 467

Query: 516 SFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISS 575
           + ++++++   +++L       S ++ +       ++ L DP + +       Y ++   
Sbjct: 468 NVDDIMSDPVAVSYLRT-----SMQIADSVSDATLRTFLVDPAAASA----QGYSDVHDL 518

Query: 576 FNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIR 635
           FNF   G ++                  LY  Q   +         + A+Y++ TI  I 
Sbjct: 519 FNFKTDGSVAT-----------------LYATQTAAQSANTTSKADSAAVYYQSTIAGIS 561

Query: 636 NHYEILGDSKL 646
           N  ++L D KL
Sbjct: 562 NVDQLLADQKL 572



 Score =  184 bits (468), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 167/685 (24%), Positives = 305/685 (44%), Gaps = 66/685 (9%)

Query: 29   SCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSL 88
            +    ++   I  ++ +D+ + D    SY L+    + M  A+      L + L DP + 
Sbjct: 453  AANAAHFNAMIGSVTNVDDIMSDPVAVSY-LR----TSMQIADSVSDATLRTFLVDPAAA 507

Query: 89   VNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNI 148
              Q  S  +  F    D S         +      Q   QS     + A   + Y++  I
Sbjct: 508  SAQGYSDVHDLFNFKTDGS---------VATLYATQTAAQSANTTSK-ADSAAVYYQSTI 557

Query: 149  HKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRA 208
              I++VDQL  D++L ++V  ++ I P  ++   L+++LT           +S    +  
Sbjct: 558  AGISNVDQLLADQKLNNFVRNAYGI-PATVTDVDLRNILT----------DQSGTGTYAN 606

Query: 209  MAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFS 268
            +A  F F+ DGSL        D    +  S   N  I       D   Y   + ++++  
Sbjct: 607  VAAAFNFKADGSLE-------DGLAAQTSSQTTNTKIAAGARTDD---YSSRMATIANVD 656

Query: 269  DFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQ--INFHRDNS--S 324
            + + DP +   L+ S + L  +I+  +  +++ +     +          NF  D S  +
Sbjct: 657  ELIADPAITNFLK-STYNLPFDISDAELKSILTDATAAAAAGHADLNADFNFAADGSLPA 715

Query: 325  STKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ---------LPLGKIKSIDNLLS 375
             + +Q   Q Q   D Y        D+ ++ +  +Y          L   +IK++++ L 
Sbjct: 716  VSSVQTADQAQTTNDNYMARYDDERDEAIEEVADNYSSMMADSTSLLDTAEIKTVNDFLR 775

Query: 376  GKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRL 435
                 +   S ++       AL A+ L  Q++ R  +R +LTS+  DP+ Y    KD+R+
Sbjct: 776  TNAAADFKKSNDKLPDPYHVALQAFGLTDQEVPRSMMRKILTSDAYDPNGYIASLKDERI 835

Query: 436  IKLNHAFNFNADG-SIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSM--EQIST 492
              L  AFNF  DG +  P+  +         +  YA         + K+  +M  +    
Sbjct: 836  TNLARAFNFGPDGKAAAPLQALPDA-----TLAKYAT--------DYKAHVTMLLKAGPV 882

Query: 493  QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKS 552
            + + + +  +EVDY+   +  + S ++ LA+ R+ + +L++  +D +   +  L +IF S
Sbjct: 883  KDKASKDATTEVDYFAKGMAKVQSLDDFLADSRLTDLVLKANNLDPKDYDKATLKKIFTS 942

Query: 553  DLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEK 612
            D  D KS+ NT  D R+K+I+++FNFD  G L+  KIG +Q+      T DLY  Q +E 
Sbjct: 943  DPDDKKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGAIQNKAAEAHTQDLYVKQTLET 1002

Query: 613  KEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRIL 672
            ++ E +  + LALYF R  P+I + Y ILGD  L++V++    L    + +   K+  ++
Sbjct: 1003 QQGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVAKQADLI 1062

Query: 673  KKHIKINDFKDSKKVEDFLYAAKAM 697
             + +K+ D +D KKV+  L    AM
Sbjct: 1063 NRFVKLEDLQDPKKVDKLLRRFTAM 1087



 Score = 70.5 bits (171), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 90/177 (50%), Gaps = 15/177 (8%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           +S+ ++++Q      +  +  YY  +IN +   ++ L + ++ ++ +++ G++     + 
Sbjct: 17  SSLNKVASQA----TVKKDAQYYADHINKVKDVDDFLGDYKLYSYAMKAYGLEDMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +SDL DP S+AN   D RY+E  ++FNF+   +        VQ +   DD   L
Sbjct: 73  FMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPDK-------DVQTDAQEDDLIGL 125

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
           YK   ++  +       A + Y+   I +++   +++ +++L   V K  K+ P +A
Sbjct: 126 YKQSFVDADKAAA----AESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYA 178



 Score = 45.4 bits (106), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 77/174 (44%), Gaps = 13/174 (7%)

Query: 22   VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
             SKD   + E  Y+ + +  + ++D+F+ D RL    LKA  L    + +  +KKI  SD
Sbjct: 886  ASKD--ATTEVDYFAKGMAKVQSLDDFLADSRLTDLVLKANNLDPKDYDKATLKKIFTSD 943

Query: 82   LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS---DIQHKTI--------IQDYKQSH 130
              D KS +N     +++    +++F     + ++    IQ+K          ++   ++ 
Sbjct: 944  PDDKKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGAIQNKAAEAHTQDLYVKQTLETQ 1003

Query: 131  QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
            Q +    +  + YF +    I S+  +  D+ L   +  ++S+  +  S+   K
Sbjct: 1004 QGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVAK 1057


>gi|218674013|ref|ZP_03523682.1| hypothetical protein RetlG_21992 [Rhizobium etli GR56]
          Length = 993

 Score =  207 bits (526), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 170/669 (25%), Positives = 305/669 (45%), Gaps = 120/669 (17%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  ++++D+F+ D +L+SYA+
Sbjct: 1   MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPDSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DELIGLYKQSFVDADKAAATESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++   +  T  Q   ++  
Sbjct: 180 KDFLRQVLTSDLSDPTSIVNTQGGDKYKALAAQFSFNADGTVTGTAQ--TAAQKASVIET 237

Query: 240 YFNNTIDCV---PIVSD------------QNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+   +    + SD            + YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVYYVGKTAAEYNKAYYTAKIGTITNVDDLVADSRLTSYIKTA- 296

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYFFQI----NFHRDNSSS--TKIQQDSQIQKML 338
           + +  + TA    T++   DP  +Q+  F  +    NF  D S+S   ++Q   Q  ++ 
Sbjct: 297 YSMGADFTAAALRTVL--TDPSYAQLMGFTNVYNAFNFKSDGSTSNTARVQSVEQANQLK 354

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
                           S           I ++D+LL+               +  ++  D
Sbjct: 355 SAASSTTNYYSVTSQSS----------SITNVDDLLADS-------------VLARYIKD 391

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI-GPIPMMQ 457
           AY L + +    +L+N+LT    D    A + K      LN  FNFNADGSI G +    
Sbjct: 392 AYGLGV-NFSNAELKNILT----DSAYAAAQGK----AGLNADFNFNADGSINGSV---- 438

Query: 458 SRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSF 517
               I+ + +  +   +S  +A +  FNSM                       I ++ + 
Sbjct: 439 ----IQTDTQRQSTTGKSAANATH--FNSM-----------------------IASVTNV 469

Query: 518 EELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
           ++++++   ++++      +S ++ +       ++ L DP + +       Y ++   FN
Sbjct: 470 DDIMSDPIAVSYIR-----NSMQIADSVSDATLRTFLVDPAAASA----QGYSDVHDLFN 520

Query: 578 FDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNH 637
           F   G ++                  LY  Q   +           A+Y++ TI  I N 
Sbjct: 521 FKTDGSVAT-----------------LYSGQTAAQSASTASKADDAAVYYQATIAGISNV 563

Query: 638 YEILGDSKL 646
            ++L D KL
Sbjct: 564 DQLLADQKL 572



 Score =  134 bits (338), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 133/581 (22%), Positives = 243/581 (41%), Gaps = 66/581 (11%)

Query: 29  SCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSL 88
           +    ++   I  ++ +D+ + D    SY   +     M  A+      L + L DP + 
Sbjct: 453 AANATHFNSMIASVTNVDDIMSDPIAVSYIRNS-----MQIADSVSDATLRTFLVDPAAA 507

Query: 89  VNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNI 148
             Q  S  +  F    D S     + +    +T  Q    + +     A + + Y++  I
Sbjct: 508 SAQGYSDVHDLFNFKTDGS-----VATLYSGQTAAQSASTASK-----ADDAAVYYQATI 557

Query: 149 HKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRA 208
             I++VDQL  D++L ++V  +F I P  ++   L+D+LT           +S    +  
Sbjct: 558 AGISNVDQLLADQKLNNFVRNAFGI-PSTVTDLALRDILT----------DQSGTGTYAD 606

Query: 209 MAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFS 268
           +A  F F+ DG+L       TD Q+  I           +   +  N Y   + ++++  
Sbjct: 607 VAAAFNFKADGTLEDGMPAQTDSQVTNI----------KIAATARTNDYSARMGTIANVD 656

Query: 269 DFLKDPKLFKMLQLSL-FPLNPEITADKFLTLMQENDPIVSQVKYF---FQINFHRDNS- 323
           D + DP +   L+ +   P N    +D  L  +  +    +   Y       NF  D S 
Sbjct: 657 DLIADPAITNFLKSTYNLPFN---ISDADLRSILTDSTAAAAAGYADLNADFNFAADGSL 713

Query: 324 -SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ---------LPLGKIKSIDNL 373
            + + +Q  +Q Q   D Y        D+ +  +  +Y+         L   +I S+++ 
Sbjct: 714 PAVSSVQTAAQAQTTNDNYMARYDDERDEAIAEVASNYKSMMADSTSLLDFSEITSVNDF 773

Query: 374 LSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDD 433
           L      +   S +        AL A+ L  Q++ R  +R +LTS+  DPD Y    KD+
Sbjct: 774 LRTNSSADFKKSNDNLPDPFHVALQAFGLTDQEVSRSMMRKILTSDAYDPDGYIASLKDE 833

Query: 434 RLIKLNHAFNFNADG-SIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQIST 492
           R+  L  AFNF  DG +  P   +      +    + A+    +     K          
Sbjct: 834 RITNLARAFNFGPDGKAASPFQALPDATMAKYATDYKAHMTMLLKAGPVK---------- 883

Query: 493 QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKS 552
             +   +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF S
Sbjct: 884 -DKAAKDATAEVDYFAKTMAKVKSLDDFLDDSRLTDLVLKANNLDPEDYDKATLKKIFTS 942

Query: 553 DLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
           D  D KS+ N+  D R+K+I+++FNFD  G L+  KIG +Q
Sbjct: 943 DPDDKKSYLNSKADARFKDIVAAFNFDKDGNLTRAKIGTIQ 983



 Score = 84.7 bits (208), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 154/653 (23%), Positives = 254/653 (38%), Gaps = 103/653 (15%)

Query: 28  VSCEERYY--RERIKHISTIDEFIKDKRLFSYALKAFGLS-DMSHAEKFIKKILESDLSD 84
            S    YY    +   I+ +D+ + D  L  Y   A+GL  + S+AE  +K IL    +D
Sbjct: 357 ASSTTNYYSVTSQSSSITNVDDLLADSVLARYIKDAYGLGVNFSNAE--LKNIL----TD 410

Query: 85  PKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYF 144
                 Q  +     F  + D S    VIQ+D Q        +QS   K       + +F
Sbjct: 411 SAYAAAQGKAGLNADFNFNADGSINGSVIQTDTQ--------RQSTTGKSAA---NATHF 459

Query: 145 RKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDN 204
              I  + +VD +  D   + Y+  S  I    +S   L+  L    A   + + +  D 
Sbjct: 460 NSMIASVTNVDDIMSDPIAVSYIRNSMQIADS-VSDATLRTFLVDPAAASAQGYSDVHDL 518

Query: 205 RFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSV 264
                   F F+ DGS++      T  Q     S   +  +          YY+  I  +
Sbjct: 519 --------FNFKTDGSVATLYSGQTAAQSASTASKADDAAV----------YYQATIAGI 560

Query: 265 SSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNS- 323
           S+    L D KL   ++ + F +   +T      ++ +     +        NF  D + 
Sbjct: 561 SNVDQLLADQKLNNFVR-NAFGIPSTVTDLALRDILTDQSGTGTYADVAAAFNFKADGTL 619

Query: 324 -SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEG 382
                 Q DSQ+         N +I       +   DY   +G I ++D+L++       
Sbjct: 620 EDGMPAQTDSQV--------TNIKI----AATARTNDYSARMGTIANVDDLIA------- 660

Query: 383 PNSAEEPIITLQFALDAYNL--NMQDLDRDQLRNVLT-SNPSDPDSYANKSKDDRLIKLN 439
                +P IT  F    YNL  N+ D D   LR++LT S  +    YA+         LN
Sbjct: 661 -----DPAIT-NFLKSTYNLPFNISDAD---LRSILTDSTAAAAAGYAD---------LN 702

Query: 440 HAFNFNADGSIGPIPMMQSRL---TIRDNVKHYANRKRSIHDAENKS-FNSMEQISTQKR 495
             FNF ADGS+  +  +Q+     T  DN     + +R    AE  S + SM   ST   
Sbjct: 703 ADFNFAADGSLPAVSSVQTAAQAQTTNDNYMARYDDERDEAIAEVASNYKSMMADSTSLL 762

Query: 496 INLEINSEVDYYTLNINTIHSFEELLANKRI---LNFLLESKGIDSQKVREDFLCEIFKS 552
              EI S  D+  L  N+   F++  +N  +    +  L++ G+  Q+V    + +I  S
Sbjct: 763 DFSEITSVNDF--LRTNSSADFKK--SNDNLPDPFHVALQAFGLTDQEVSRSMMRKILTS 818

Query: 553 DLKDPKSFANTYKDNRYKEIISSFNFDIHGE-------LSHKKIGKVQDNFHIDDTCDLY 605
           D  DP  +  + KD R   +  +FNF   G+       L    + K   ++    T  L 
Sbjct: 819 DAYDPDGYIASLKDERITNLARAFNFGPDGKAASPFQALPDATMAKYATDYKAHMTMLLK 878

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
              + +K  ++    +    YF +T+  +++  + L DS+L  +V K   L P
Sbjct: 879 AGPVKDKAAKDATAEVD---YFAKTMAKVKSLDDFLDDSRLTDLVLKANNLDP 928



 Score = 70.5 bits (171), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 101/452 (22%), Positives = 183/452 (40%), Gaps = 85/452 (18%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           + K +++  N       +  D  YY   IN V+S  DFL D KL+    +  + L     
Sbjct: 11  LSKDMTSSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYS-YAMKAYGLEDMTY 69

Query: 293 ADKFLTLMQENDPI--------VSQVKYF-FQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           A  F+  + E+D          +S  +Y  F   F+  N+    +Q D+Q  +++ LYK+
Sbjct: 70  AKAFMKKVLESDLTDPDSYANKLSDTRYREFAAAFNF-NAPEKDVQTDAQEDELIGLYKQ 128

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
           +  +  D    +    Y   +  ++++D+L++   +L              + L  + ++
Sbjct: 129 SF-VDADKAAATESTYYSNNIDSVQTVDDLVN-NTRLR------------TYVLKTFKID 174

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
                +D LR VLTS+ SDP S  N    D+   L   F+FNADG++             
Sbjct: 175 PTYASKDFLRQVLTSDLSDPTSIVNTQGGDKYKALAAQFSFNADGTVT------------ 222

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEV------------DYYTLNI 511
                 A +K S+   E  + NS   I     I+  + S+V             YYT  I
Sbjct: 223 -GTAQTAAQKASV--IETYTLNSQSVI-----IDNSVGSDVYYVGKTAAEYNKAYYTAKI 274

Query: 512 NTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKE 571
            TI + ++L+A+ R+ +++  +  + +     DF     ++ L DP S+A       +  
Sbjct: 275 GTITNVDDLVADSRLTSYIKTAYSMGA-----DFTAAALRTVLTDP-SYAQLMG---FTN 325

Query: 572 IISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRT- 630
           + ++FNF   G  S+                   + Q +E+  + K    +   Y+  T 
Sbjct: 326 VYNAFNFKSDGSTSNTA-----------------RVQSVEQANQLKSAASSTTNYYSVTS 368

Query: 631 -IPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
              +I N  ++L DS L + +     L   F+
Sbjct: 369 QSSSITNVDDLLADSVLARYIKDAYGLGVNFS 400


>gi|327188120|gb|EGE55342.1| hypothetical protein RHECNPAF_944004 [Rhizobium etli CNPAF512]
          Length = 1111

 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 174/671 (25%), Positives = 303/671 (45%), Gaps = 124/671 (18%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  +  +D+F+ D +L+SYA+
Sbjct: 1   MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVKDVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPDKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DDLIGLYKQSFVDADKAAAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++   +  T  Q   ++  
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVTGTAQ--TAAQKASVIET 237

Query: 240 Y--------FNNTI--DCVPI---VSDQN--YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y         +N++  D V +    +D N  YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVVYVSKTAADYNKAYYTAKIGTITNVDDLVADARLTSYIK-TA 296

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYFFQI----NFHRDNSSST--KIQQDSQIQKML 338
           + +  + TA     ++   DP  +Q+  F  +    NF  D S+ST  + Q   Q  K+ 
Sbjct: 297 YSMGADFTAPALRMVL--TDPSYAQLMGFTNVYNAFNFKADGSTSTTARAQTIDQANKLA 354

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
                           S           I ++D+LL+               +  ++  D
Sbjct: 355 SAASSTANYYSVTSQSS----------GITNVDDLLADS-------------VMARYIKD 391

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQS 458
           AY L + +    +L+N+LT +     SYA          LN  FNFNADGS         
Sbjct: 392 AYGLGV-NFSNAELKNILTDS-----SYAAAQGQ---AGLNADFNFNADGS--------- 433

Query: 459 RLTIRDNVKHYANRKRSIHD--AENKS-FNSMEQISTQKRINLEINSEVDYYTLNINTIH 515
              I  +V   A +++S  D  A N + FN+M                       I  + 
Sbjct: 434 ---INGSVIQTAAQRKSTTDKSAANAAHFNAM-----------------------IGNVT 467

Query: 516 SFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISS 575
           + ++++++   +++L       S ++ +       ++ L DP + +       Y ++   
Sbjct: 468 NVDDIMSDPVAVSYLRT-----SMQIADSVSDATLRTFLVDPAAASA----QGYSDVHDL 518

Query: 576 FNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIR 635
           FNF   G ++                  L+  Q   +         + A+Y++ TI  I 
Sbjct: 519 FNFKTDGSVAT-----------------LHATQTAAQSANTTSKADSAAVYYQSTIAGIS 561

Query: 636 NHYEILGDSKL 646
           N  ++L D KL
Sbjct: 562 NVDQLLADQKL 572



 Score =  188 bits (477), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 170/685 (24%), Positives = 309/685 (45%), Gaps = 66/685 (9%)

Query: 29   SCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSL 88
            +    ++   I +++ +D+ + D    SY L+    + M  A+      L + L DP + 
Sbjct: 453  AANAAHFNAMIGNVTNVDDIMSDPVAVSY-LR----TSMQIADSVSDATLRTFLVDPAAA 507

Query: 89   VNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNI 148
              Q  S  +  F    +F     V      H T  Q   QS     + A   + Y++  I
Sbjct: 508  SAQGYSDVHDLF----NFKTDGSVA---TLHAT--QTAAQSANTTSK-ADSAAVYYQSTI 557

Query: 149  HKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRA 208
              I++VDQL  D++L ++V  ++ I P  ++   L+++LT           +S    +  
Sbjct: 558  AGISNVDQLLADQKLNNFVRNAYGI-PSTVTDVDLRNILT----------DQSGTGTYAD 606

Query: 209  MAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFS 268
            +A  F F+ DGSL        D    +  S   N  I       D   Y   + ++++  
Sbjct: 607  VAAAFNFKADGSLE-------DGLAAQTSSQTTNTKIAAGARTDD---YSSRMATIANVD 656

Query: 269  DFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQ--INFHRDNS--S 324
            + + DP +   L+ S + L  +I+  +  +++ +     +          NF  D S  +
Sbjct: 657  ELIADPAITNFLK-STYNLPFDISDAELKSILTDATAAAAAGHADLNADFNFAADGSLPA 715

Query: 325  STKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ---------LPLGKIKSIDNLLS 375
             + +Q   Q Q   D Y        D+ ++ +  +Y          L   +IK++++ L 
Sbjct: 716  VSSVQTADQAQTTNDNYMARYDDERDEAIEEVADNYSSMMADSTSLLDTAEIKTVNDFLR 775

Query: 376  GKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRL 435
                 +   S ++       AL A+ L  Q++ R  +R +LTS+  DP+ Y    KD+R+
Sbjct: 776  TNAAADFKKSNDKLPDPYHVALQAFGLTDQEVPRSMMRKILTSDAYDPNGYIASLKDERI 835

Query: 436  IKLNHAFNFNADG-SIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSM--EQIST 492
              L  AFNF  DG +  P+  +         +  YA         + K+  +M  +    
Sbjct: 836  TNLARAFNFGPDGKAAAPLQALPDA-----TLAKYAT--------DYKAHVTMLLKAGPV 882

Query: 493  QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKS 552
            + + + +  +EVDY+   +  + S ++ LA+ R+ + +L++  +D +K  +  L +IF S
Sbjct: 883  KDKASKDATTEVDYFAKGMAKVQSLDDFLADSRLTDLVLKANNLDPKKYDKATLEKIFTS 942

Query: 553  DLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEK 612
            D  D KS+ NT  D R+K+I+++FNFD  G L+  KIG +Q+      T DLY  Q +E 
Sbjct: 943  DPDDKKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGTIQNKAAEAHTQDLYVKQTLET 1002

Query: 613  KEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRIL 672
            ++ E +  + LALYF R  P+I + Y ILGD  L++V++    L    + +   K+  ++
Sbjct: 1003 QQGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVAKQADLI 1062

Query: 673  KKHIKINDFKDSKKVEDFLYAAKAM 697
             + +K+ D +D KKV+  L    AM
Sbjct: 1063 NRFVKLEDLQDPKKVDKLLRRFTAM 1087



 Score = 70.5 bits (171), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 90/177 (50%), Gaps = 15/177 (8%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           +S+ ++++Q      +  +  YY  +IN +   ++ L + ++ ++ +++ G++     + 
Sbjct: 17  SSLNKVASQA----TVKKDAQYYADHINKVKDVDDFLGDYKLYSYAMKAYGLEDMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +SDL DP S+AN   D RY+E  ++FNF+   +        VQ +   DD   L
Sbjct: 73  FMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPDK-------DVQTDAQEDDLIGL 125

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
           YK   ++  +       A + Y+   I +++   +++ +++L   V K  K+ P +A
Sbjct: 126 YKQSFVDADKAAA----AESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYA 178



 Score = 43.9 bits (102), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 77/174 (44%), Gaps = 13/174 (7%)

Query: 22   VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
             SKD   + E  Y+ + +  + ++D+F+ D RL    LKA  L    + +  ++KI  SD
Sbjct: 886  ASKD--ATTEVDYFAKGMAKVQSLDDFLADSRLTDLVLKANNLDPKKYDKATLEKIFTSD 943

Query: 82   LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS---DIQHKTI--------IQDYKQSH 130
              D KS +N     +++    +++F     + ++    IQ+K          ++   ++ 
Sbjct: 944  PDDKKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGTIQNKAAEAHTQDLYVKQTLETQ 1003

Query: 131  QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
            Q +    +  + YF +    I S+  +  D+ L   +  ++S+  +  S+   K
Sbjct: 1004 QGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVAK 1057


>gi|209548151|ref|YP_002280068.1| hypothetical protein Rleg2_0545 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533907|gb|ACI53842.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 1111

 Score =  203 bits (516), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 175/669 (26%), Positives = 304/669 (45%), Gaps = 120/669 (17%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  +  YY + I  ++++D+F+ D +L+SYA+
Sbjct: 1   MITASLAYTILSKDMTSSL-NKVASQATVKKDAEYYADHINKVTSVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFASAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++    ES Y+  NI  + +VD L  + RL  YVL++F+I P Y S
Sbjct: 120 DDLIGLYKQSFIDADKATTAESTYYSNNIDSVTTVDDLVNNTRLRTYVLKTFNIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++   +  T  Q   ++  
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVTGTAQ--TAAQKASVIET 237

Query: 240 YFNNTIDCV---PIVSD------------QNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+   +    + SD            Q YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVVYVNKTAADYNQAYYTAKIGTITNVDDLVADKRLTSYIK-TA 296

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYFFQI----NFHRDNSSST--KIQQDSQIQKML 338
           + +  + TA    T++   DP  +Q+  F  +    NF  D S+S+  +++   Q  K+ 
Sbjct: 297 YSMGADFTAAALRTVL--TDPGYAQLMGFTNVYNAFNFKSDGSTSSTARVRTLDQANKL- 353

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
                           S   +Y     +  SI N+      L   N A       ++  D
Sbjct: 354 ------------SSAASQTANYYKVTSQSSSITNV---DALLADGNMA-------RYIKD 391

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI-GPIPMMQ 457
           AY L     + D L+N+LT    D    A +   D    LN  FNF ADGSI G +    
Sbjct: 392 AYGLGTGFSNAD-LKNILT----DSAYAAAQGHAD----LNADFNFQADGSINGSV---- 438

Query: 458 SRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSF 517
               I+ + +  +   +S  +A +  FN+M                       I+++ S 
Sbjct: 439 ----IQTDTQRKSTTDKSAANAAH--FNAM-----------------------IDSVTSV 469

Query: 518 EELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
           ++++++   +++L       S +V +       ++ L DP + +       Y ++   FN
Sbjct: 470 DDIMSDPVAVSYLRT-----SMQVADSVSDATLRTFLVDPAAASA----QGYSDVHDLFN 520

Query: 578 FDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNH 637
           F   G ++                  LY  Q   +           A+Y++ TI  I N 
Sbjct: 521 FKTDGSVAT-----------------LYASQTAAQSASTSSKADNAAVYYQATIAGIANV 563

Query: 638 YEILGDSKL 646
            ++L D KL
Sbjct: 564 DQLLSDQKL 572



 Score =  183 bits (464), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 170/691 (24%), Positives = 300/691 (43%), Gaps = 78/691 (11%)

Query: 29   SCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSL 88
            +    ++   I  ++++D+ + D    SY L+    + M  A+      L + L DP + 
Sbjct: 453  AANAAHFNAMIDSVTSVDDIMSDPVAVSY-LR----TSMQVADSVSDATLRTFLVDPAAA 507

Query: 89   VNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNI 148
              Q  S  +  F    D S     + +    +T  Q    S +     A   + Y++  I
Sbjct: 508  SAQGYSDVHDLFNFKTDGS-----VATLYASQTAAQSASTSSK-----ADNAAVYYQATI 557

Query: 149  HKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRA 208
              I +VDQL  D++L ++V  +F I P  ++   L+ +LT           +S    +  
Sbjct: 558  AGIANVDQLLSDQKLNNFVRNAFGI-PSTVTDVALRGILT----------DQSGTGTYAD 606

Query: 209  MAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFS 268
            +A  F F+ DGSL       TD QI         NT       +D   Y   + ++++  
Sbjct: 607  VAAAFNFKADGSLKDGLAAQTDTQIR--------NTKFAAGARTDD--YSARMATIANVD 656

Query: 269  DFLKDPKLFKMLQLSL-FPLN---------------------PEITADKFLTLMQENDPI 306
            D + DP +   L+ +   PLN                      ++ AD F      + P+
Sbjct: 657  DLIADPAITNFLKSTYNLPLNISNADLKSYLTDATAASAAGYADLNAD-FNFAADGSLPV 715

Query: 307  VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
            VS V+   Q     DN  +   + D + ++ +D    N   +  D   SL     L   +
Sbjct: 716  VSSVQTADQAQTTNDNYMA---RYDDEREEAIDEVASNYSSMMADST-SL-----LDTAE 766

Query: 367  IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
            IKS+++ +      +   S +        AL A+ L  QD+ R  +R +LTS+  DP+ Y
Sbjct: 767  IKSVNDFMRTNATADFKKSNDNLPDPYHVALQAFGLTEQDVPRSMMRKILTSDAYDPNGY 826

Query: 427  ANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNS 486
                KD+R+  +  AFNF  DG            T+      Y      +          
Sbjct: 827  IASLKDERITNMARAFNFGPDGKAASPFQALPDATLAKYATDYKAHMTML---------- 876

Query: 487  MEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL 546
            ++    + + + +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L
Sbjct: 877  LKAGPVKDKASKDATTEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATL 936

Query: 547  CEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYK 606
             +IF SD  D KS+ N   D R+K+I+++FNFD  G L+  K+G +Q+    + T +LY 
Sbjct: 937  KKIFTSDPDDKKSYLNAKADARFKDIVAAFNFDKDGNLTRAKMGTIQNKAAEEHTQELYV 996

Query: 607  HQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER 666
             Q +E ++ E +  + LALYF R  P+I + Y ILGD  L++VV+    L    + +   
Sbjct: 997  QQTMEAQQGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVVTTAYSLPSQMSGMDVT 1056

Query: 667  KKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
            K+  +L + +K+ D +D KKV+  +    AM
Sbjct: 1057 KQADLLNRFVKLEDLQDPKKVDKLVRRFTAM 1087



 Score = 72.4 bits (176), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 90/177 (50%), Gaps = 15/177 (8%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           +S+ ++++Q      +  + +YY  +IN + S ++ L + ++ ++ +++ G++     + 
Sbjct: 17  SSLNKVASQA----TVKKDAEYYADHINKVTSVDDFLGDYKLYSYAMKAYGLEDMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +SDL DP S+AN   D RY+E  S+FNF+   +        VQ +   DD   L
Sbjct: 73  FMKKVLESDLTDPNSYANKLSDTRYREFASAFNFNAPEK-------DVQTDAQEDDLIGL 125

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
           YK   I+  +       A + Y+   I ++    +++ +++L   V K   + P +A
Sbjct: 126 YKQSFIDADK----ATTAESTYYSNNIDSVTTVDDLVNNTRLRTYVLKTFNIDPTYA 178



 Score = 48.1 bits (113), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 88/206 (42%), Gaps = 22/206 (10%)

Query: 22   VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
             SKD   + E  Y+ + +  + ++D+F+ D RL    LKA  L    + +  +KKI  SD
Sbjct: 886  ASKD--ATTEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSD 943

Query: 82   LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS---DIQHKTI--------IQDYKQSH 130
              D KS +N     +++    +++F     + ++    IQ+K          +Q   ++ 
Sbjct: 944  PDDKKSYLNAKADARFKDIVAAFNFDKDGNLTRAKMGTIQNKAAEEHTQELYVQQTMEAQ 1003

Query: 131  QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
            Q +    +  + YF +    I S+  +  D+ L   V  ++S+  +   +   K    L 
Sbjct: 1004 QGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVVTTAYSLPSQMSGMDVTKQADLLN 1063

Query: 191  -------LANPKKYFIESRDNRFRAM 209
                   L +PKK  ++    RF AM
Sbjct: 1064 RFVKLEDLQDPKK--VDKLVRRFTAM 1087


>gi|116250732|ref|YP_766570.1| hypothetical protein RL0958 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255380|emb|CAK06455.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 1109

 Score =  199 bits (507), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 182/727 (25%), Positives = 314/727 (43%), Gaps = 130/727 (17%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    S+D+ S L + V+    V  + +YY + I  +  +D+F+ D +L+SYA+
Sbjct: 1   MISASLAYTILSRDMTSSL-NKVASQATVKKDAQYYADHINKVENVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F+I P Y S
Sbjct: 120 DDLIGLYKQSFVDADKAASAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFNIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++   +  T  Q   ++ +
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVTGTAQ--TAAQKASVIES 237

Query: 240 YFNNTIDCV---PIVSD------------QNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+   +    + SD            + YY   I ++++  D + D +L   +  + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVYYVGQTAADYNKAYYTAKIGTITNVDDLVADKRLTSYIT-TA 296

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYFFQI----NFHRDNSSST--KIQQDSQIQKML 338
           + +  + TA    T++   DP  +Q+  F  +    NF  D S+S+  ++Q   Q   + 
Sbjct: 297 YSMGADFTAAALRTVL--TDPGYAQLMGFTNVYNAFNFKADGSASSTARVQTVDQANSL- 353

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
               KN   +  +   +  +        I ++D+LL+               +  ++  D
Sbjct: 354 ----KNAATMTGNYYTTTSQS-----TGITNVDDLLADN-------------VLARYIKD 391

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQS 458
           AY L   D     L+N+LT    D    A +   D    LN  FNF ADGSI        
Sbjct: 392 AYGLGT-DFSNADLKNILT----DSAYAAAQGHAD----LNADFNFQADGSING------ 436

Query: 459 RLTIRDNVKHYANRKRSIHD--AENKS-FNSMEQISTQKRINLEINSEVDYYTLNINTIH 515
                 +V   A +++S  D  A N + FNSM                       I  + 
Sbjct: 437 ------SVIQTAAQRKSTTDKSAVNAAHFNSM-----------------------IGNVT 467

Query: 516 SFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISS 575
           + ++++++   ++++  S  I       D     F  D     +         Y ++   
Sbjct: 468 NVDDIMSDAVAVSYIRNSMQI--ADSVSDATLRTFLVDRTAASA-------QGYSDVHDL 518

Query: 576 FNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIR 635
           FNF   G ++                  LY  Q   +           A+Y++ TI  I 
Sbjct: 519 FNFKSDGSIAT-----------------LYASQTATQSASTTSKADNAAVYYQSTIAGIS 561

Query: 636 NHYEILGDSKLFKVVSKKLKLSPYF------AVLPERKKIRILKKHIKINDFKDSKKVED 689
           N  ++L D KL   V     +          A+L ++             +FK    +ED
Sbjct: 562 NVDQLLADQKLNNFVRNAYGIPSTVSDVDLRAILTDQSGTGTYADVAAAFNFKADGTLED 621

Query: 690 FLYAAKA 696
            + A  A
Sbjct: 622 GMAAQTA 628



 Score =  175 bits (443), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 147/568 (25%), Positives = 252/568 (44%), Gaps = 45/568 (7%)

Query: 143  YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESR 202
            Y++  I  I++VDQL  D++L ++V  ++ I P  +S   L+ +LT           +S 
Sbjct: 552  YYQSTIAGISNVDQLLADQKLNNFVRNAYGI-PSTVSDVDLRAILT----------DQSG 600

Query: 203  DNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAIN 262
               +  +A  F F+ DG+L       T  QI    S  F  T       +  + Y   ++
Sbjct: 601  TGTYADVAAAFNFKADGTLEDGMAAQTATQIS---STKFAAT-------ARTDDYSARMS 650

Query: 263  SVSSFSDFLKDPKLFKMLQLSL-FPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRD 321
            ++S+  D L D  +   L+ +   P N      K +                   NF  D
Sbjct: 651  TISNVDDLLADSAITNFLKSTYNLPFNISDADLKSILTDATAAAAAGHADLNADFNFAAD 710

Query: 322  NS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ---------LPLGKIKSI 370
             S    + +Q   Q Q   D Y        D+ +  +  +YQ         L    + S+
Sbjct: 711  GSLPVVSSVQTADQAQTTNDNYAARYDDERDEAIDEVASNYQKLMADSSSLLNFSDVNSV 770

Query: 371  DNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKS 430
            ++ L      +   S +        AL A+ L  Q++ R  +R +LTS+  DPD Y    
Sbjct: 771  NDFLRSNSAADFSKSNDNLPDLFHVALQAFGLTDQEVSRSMMRKILTSDAYDPDGYVASL 830

Query: 431  KDDRLIKLNHAFNFNADG-SIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQ 489
            KD+R+  L  AFNF  DG +  P   +         +  YA   RS H         M+ 
Sbjct: 831  KDERITNLARAFNFGPDGKAASPFQALPDA-----TMAKYATDYRS-HITM-----LMKD 879

Query: 490  ISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
               + +   +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +I
Sbjct: 880  GPVKDKAAKDATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKI 939

Query: 550  FKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
            F SD  D KS+ N   D R+++I+++FNFD  G L+  KIG +Q+    + T +LY  Q 
Sbjct: 940  FTSDPDDKKSYLNATADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEEHTQELYVQQT 999

Query: 610  IEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKI 669
            +E ++ E +  + LALYF R   +I + Y ILGD  L++V++    L    + +   K+ 
Sbjct: 1000 MEAQQGESNDGVRLALYFSRKASSITSIYGILGDKALYQVITTAYSLPSQISGMDVAKQA 1059

Query: 670  RILKKHIKINDFKDSKKVEDFLYAAKAM 697
             ++ + +K+ D +D KKV+  L    AM
Sbjct: 1060 DLINRFVKLEDLQDPKKVDKLLRRFTAM 1087



 Score = 81.6 bits (200), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 86/192 (44%), Gaps = 18/192 (9%)

Query: 54  LFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVI 113
           LF  AL+AFGL+D   +   ++KIL SD  DP   V  L   +    AR+++F P  K  
Sbjct: 792 LFHVALQAFGLTDQEVSRSMMRKILTSDAYDPDGYVASLKDERITNLARAFNFGPDGKAA 851

Query: 114 QS-----DIQHKTIIQDYKQSH-----------QHKEEVALEESKYFRKNIHKINSVDQL 157
                  D        DY+ SH               + A  E  YF K + K+ S+D  
Sbjct: 852 SPFQALPDATMAKYATDYR-SHITMLMKDGPVKDKAAKDATAEVDYFAKGMAKVKSLDDF 910

Query: 158 FKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP 217
             D RL D VL++ ++ PK      LK + T    + K Y   + D RF+ +   F F  
Sbjct: 911 LDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNATADARFQDIVAAFNFDK 970

Query: 218 DGSLSKRDKILT 229
           DG+L+ R KI T
Sbjct: 971 DGNLT-RAKIGT 981



 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 132/619 (21%), Positives = 243/619 (39%), Gaps = 132/619 (21%)

Query: 4    SHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFG 63
              +A   +    ++  ST SK    +    YY+  I  IS +D+ + D++L ++   A+G
Sbjct: 525  GSIATLYASQTATQSASTTSKADNAAV---YYQSTIAGISNVDQLLADQKLNNFVRNAYG 581

Query: 64   L-SDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTI 122
            + S +S  +  ++ I          L +Q  +  Y   A +++F      ++  +  +T 
Sbjct: 582  IPSTVSDVD--LRAI----------LTDQSGTGTYADVAAAFNF-KADGTLEDGMAAQTA 628

Query: 123  IQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
             Q         +  A   +  +   +  I++VD L  D  + +++  ++++ P  IS   
Sbjct: 629  TQ-----ISSTKFAATARTDDYSARMSTISNVDDLLADSAITNFLKSTYNL-PFNISDAD 682

Query: 183  LKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF- 241
            LK +LT   A       +        +  +F F  DGSL     + T  Q +    NY  
Sbjct: 683  LKSILTDATAAAAAGHAD--------LNADFNFAADGSLPVVSSVQTADQAQTTNDNYAA 734

Query: 242  ------NNTIDCVPIVSDQNYYKLAINS--------VSSFSDFLKD-------------P 274
                  +  ID V      NY KL  +S        V+S +DFL+              P
Sbjct: 735  RYDDERDEAIDEVA----SNYQKLMADSSSLLNFSDVNSVNDFLRSNSAADFSKSNDNLP 790

Query: 275  KLFKMLQLSLFPLNPE----------ITADKF----LTLMQENDPIVSQVKYFFQINFHR 320
             LF  + L  F L  +          +T+D +         +++ I +  + F   NF  
Sbjct: 791  DLFH-VALQAFGLTDQEVSRSMMRKILTSDAYDPDGYVASLKDERITNLARAF---NFGP 846

Query: 321  DNSSSTKIQQ--DSQIQKMLDLYKKNCQILHDDK---------MQSLIKDYQLPLGKIKS 369
            D  +++  Q   D+ + K    Y+ +  +L  D            + +  +   + K+KS
Sbjct: 847  DGKAASPFQALPDATMAKYATDYRSHITMLMKDGPVKDKAAKDATAEVDYFAKGMAKVKS 906

Query: 370  IDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANK 429
            +D+ L            ++  +T    L A NL+ +D D+  L+ + TS+P D  SY N 
Sbjct: 907  LDDFL------------DDSRLT-DLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNA 953

Query: 430  SKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSME- 488
            + D R   +  AFNF+ DG++            R  +    N+    H  E     +ME 
Sbjct: 954  TADARFQDIVAAFNFDKDGNL-----------TRAKIGTIQNKAAEEHTQELYVQQTMEA 1002

Query: 489  -QISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES-------KGIDSQK 540
             Q  +   + L +     Y++   ++I S   +L +K +   +  +        G+D  K
Sbjct: 1003 QQGESNDGVRLAL-----YFSRKASSITSIYGILGDKALYQVITTAYSLPSQISGMDVAK 1057

Query: 541  VREDFLCEIFK-SDLKDPK 558
             + D +    K  DL+DPK
Sbjct: 1058 -QADLINRFVKLEDLQDPK 1075


>gi|86356543|ref|YP_468435.1| hypothetical protein RHE_CH00897 [Rhizobium etli CFN 42]
 gi|86280645|gb|ABC89708.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 1110

 Score =  199 bits (505), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 175/670 (26%), Positives = 298/670 (44%), Gaps = 122/670 (18%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  +  +D+F+ D RL+SYA+
Sbjct: 1   MITASLAYTILSKDMTSSL-NKVAAQATVKKDAQYYADNINKVKDVDDFLGDYRLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DELIGLYKQSFVDADKAAATESTYYSNNIDSVQTVDDLVDNARLRTYVLKAFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++   +  T  Q   I+  
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVNGSAQTAT--QKASIIET 237

Query: 240 YFNNTIDCV---PIVSD------------QNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+   +    + SD            Q YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVVYVSKTAAEYNQAYYTAKIGTITNVDDLVADSRLTSYIKTA- 296

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYFFQI----NFHRDNSSST--KIQQDSQIQKML 338
           + +  + TA    T++   DP  +Q+  F  +    NF  D ++ST  + Q   Q  K+ 
Sbjct: 297 YSMGADFTAAALRTVL--TDPGYAQLMGFTNVYNAFNFKADGTTSTTARAQTIDQSNKLK 354

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
           D               +           I ++D+LL+               +  ++  D
Sbjct: 355 DAAASTANYYSVTSRST----------SITNVDDLLADS-------------VLARYIKD 391

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQS 458
           AY L        +L+++LT +     +YA          LN  FNF ADGSI    M+Q+
Sbjct: 392 AYGLGTS-FSNAELKSILTDS-----TYATAQGH---ADLNADFNFQADGSING-SMIQT 441

Query: 459 RLTIRDNVKHYANRKRSI-HDAENKS-FNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
                      A RK +    A N + FNSM                       I  + +
Sbjct: 442 D----------AQRKSTTDKSAANAAHFNSM-----------------------IGNVTN 468

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSF 576
            ++++++   +++L       S ++ +       +S L DP + +       Y ++   F
Sbjct: 469 VDDIMSDPVAVSYLRT-----SMQIADSVSDATLRSFLVDPAAASA----QGYSDVHDLF 519

Query: 577 NFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN 636
           NF   G ++                  LY  Q   +           A+Y++ TI  I N
Sbjct: 520 NFKTDGSVAT-----------------LYATQSAAQSASTASKADDAAVYYQATIAGISN 562

Query: 637 HYEILGDSKL 646
             ++L D +L
Sbjct: 563 VDQLLSDRRL 572



 Score =  191 bits (484), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 155/577 (26%), Positives = 269/577 (46%), Gaps = 51/577 (8%)

Query: 137  ALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKK 196
            A + + Y++  I  I++VDQL  DRRL +++  ++ I P  +S   L+ +LT        
Sbjct: 546  ADDAAVYYQATIAGISNVDQLLSDRRLNNFIRNAYGI-PSTVSDVDLRAILT-------- 596

Query: 197  YFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNY 256
               +S    +  +A  F F+ DGSL       T  QI        N  I       D   
Sbjct: 597  --DQSGTGTYADVAAAFNFKADGSLEDGMAAQTAAQIT-------NTKIAATARTDD--- 644

Query: 257  YKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYF--- 313
            Y   +  +S+  D + DP +   L+ S + L  +IT D  L  +  +    +   Y    
Sbjct: 645  YSARVARISNVDDLIADPAITNFLK-STYNLPFDIT-DADLKSILTDATAAAAAGYSDLN 702

Query: 314  FQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ---------L 362
               NF  D S    + IQ   Q Q   D Y        D+ ++ +  +Y+         L
Sbjct: 703  ADFNFAADGSLPVVSSIQTADQAQTTNDNYMARYDDERDEAIEEVADNYKSMMADSSSLL 762

Query: 363  PLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSD 422
                +K++++ L      +   S +        AL A+ L  QD+ R  +R +LTS+  D
Sbjct: 763  NFSDVKTVNDFLRTNRSADFTKSNDNLPDLYHVALQAFGLTDQDVPRSMMRKILTSDAYD 822

Query: 423  PDSYANKSKDDRLIKLNHAFNFNADG-SIGPIPMM-QSRLTIRDNVKHYANRKRSIHDAE 480
            PD Y    KD+R+  L  AFNF  DG +  P+  + Q+ +      K+  + K  +    
Sbjct: 823  PDGYIASLKDERITNLARAFNFGPDGKAASPLQALPQATM-----AKYATDYKAHVT--- 874

Query: 481  NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
                  ++    + + + +  +EVDY+   +  + S ++ L + R+ + +L++  +D + 
Sbjct: 875  ----MLLKAGPVKDKASKDATAEVDYFAKGMAKVQSLDDFLDDSRLTDLVLKANNLDPKD 930

Query: 541  VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
              +  L +IF SD  D KS+ NT  D R+K+I+++FNFD  G L+  KIG +Q+    ++
Sbjct: 931  YDKATLKKIFTSDPDDKKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGAIQNKAAEEN 990

Query: 601  TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660
            T +LY  Q +E ++ E +  + LALYF R  P+I + Y ILGD  L++V++    L    
Sbjct: 991  TQELYIKQTLETQQGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQI 1050

Query: 661  AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
            + +   K+  ++ + +K++D +D KKV+  L    AM
Sbjct: 1051 SSMDVAKQADLINRFVKLDDLQDPKKVDKLLRRFTAM 1087



 Score = 74.7 bits (182), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 104/457 (22%), Positives = 181/457 (39%), Gaps = 95/457 (20%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           + K +++  N       +  D  YY   IN V    DFL D +L+    +  + L     
Sbjct: 11  LSKDMTSSLNKVAAQATVKKDAQYYADNINKVKDVDDFLGDYRLYS-YAMKAYGLEDMTY 69

Query: 293 ADKFLTLMQENDPI--------VSQVKYF-FQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           A  F+  + E+D          +S  +Y  F   F+  N+    +Q D+Q  +++ LYK+
Sbjct: 70  AKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNF-NAPEKDVQTDAQEDELIGLYKQ 128

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
           +  +  D    +    Y   +  ++++D+L+    +L              + L A+ ++
Sbjct: 129 SF-VDADKAAATESTYYSNNIDSVQTVDDLVD-NARLR------------TYVLKAFKID 174

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
                +D LR VLTS+ SDP S  N    D+   L   F+FNADG++             
Sbjct: 175 PTYASKDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTV------------- 221

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEV------------DYYTLNI 511
           +     A +K SI   E  + NS   I     I+  + S+V             YYT  I
Sbjct: 222 NGSAQTATQKASI--IETYTLNSQSVI-----IDNSVGSDVVYVSKTAAEYNQAYYTAKI 274

Query: 512 NTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK-----SFANTYKD 566
            TI + ++L+A+ R+ +++  +  + +     DF     ++ L DP       F N Y  
Sbjct: 275 GTITNVDDLVADSRLTSYIKTAYSMGA-----DFTAAALRTVLTDPGYAQLMGFTNVY-- 327

Query: 567 NRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALY 626
                  ++FNF   G  S                    + Q I++  + KD   + A Y
Sbjct: 328 -------NAFNFKADGTTSTTA-----------------RAQTIDQSNKLKDAAASTANY 363

Query: 627 FKRT--IPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
           +  T    +I N  ++L DS L + +     L   F+
Sbjct: 364 YSVTSRSTSITNVDDLLADSVLARYIKDAYGLGTSFS 400



 Score = 45.8 bits (107), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 77/174 (44%), Gaps = 13/174 (7%)

Query: 22   VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
             SKD   + E  Y+ + +  + ++D+F+ D RL    LKA  L    + +  +KKI  SD
Sbjct: 886  ASKD--ATAEVDYFAKGMAKVQSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSD 943

Query: 82   LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS---DIQHKTI--------IQDYKQSH 130
              D KS +N     +++    +++F     + ++    IQ+K          I+   ++ 
Sbjct: 944  PDDKKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGAIQNKAAEENTQELYIKQTLETQ 1003

Query: 131  QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
            Q +    +  + YF +    I S+  +  D+ L   +  ++S+  +  S+   K
Sbjct: 1004 QGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVAK 1057


>gi|115524603|ref|YP_781514.1| hypothetical protein RPE_2596 [Rhodopseudomonas palustris BisA53]
 gi|115518550|gb|ABJ06534.1| protein of unknown function DUF1217 [Rhodopseudomonas palustris
           BisA53]
          Length = 799

 Score =  196 bits (497), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 186/711 (26%), Positives = 300/711 (42%), Gaps = 140/711 (19%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           V  + RYY  +I  I+T+D+ + + RL +Y   AFG+ D + +   +K IL SD SDP S
Sbjct: 138 VGEDTRYYNAKIGSIATVDQLLNNDRLRTYVFSAFGIDDGTWSRATMKNILGSDPSDPGS 197

Query: 88  LVNQLNSLKYQYFARSYDFSPP----------PKVIQSDIQHKTIIQDYKQSHQH----- 132
            +N +             + PP           +   +D   K  I DY           
Sbjct: 198 YINTV-------------WGPPLDDAIASFNLAQAESTDASSK--IDDYTAQMAQPGADL 242

Query: 133 ---KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
              K ++ALE+ +     + K +S    F                         K ++ +
Sbjct: 243 ADLKAKIALEQGR-----VAKASSDMSGFN------------------------KTIIAI 273

Query: 190 GLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF----NNTI 245
           G      YF          +A  F F  DG+L+      TD +  KI +  F      T 
Sbjct: 274 G-----HYF---------ELASAFEFSTDGTLASGVAAQTD-ENRKITNEKFIADQPRTS 318

Query: 246 DCVPIVSDQNYYKLAINSVSSFSDFLKDPKL---------FKMLQLSLFPLNPEITADK- 295
               +V ++ Y++   +S  +  +   D            F +  L L  L   +T+D+ 
Sbjct: 319 PAAALV-EKAYFEQQASSARTVDELFADDAFRMAKFIGVAFGVGTLPLSTLKSILTSDRD 377

Query: 296 ------FLTLMQENDPIVSQVKYFFQINFHRDNS------SSTKIQQDSQIQKMLDLYKK 343
                 F+ L   N    +++   F  NF +D +      + +  Q  + I + +  Y  
Sbjct: 378 VNNASSFVNLAGSNKDAYTRLMNAF--NFKQDGTLDAGVDAQSATQSSATIGRYMTAYND 435

Query: 344 NCQILHDDKMQSLIKD-YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNL 402
                 D+  + L K  ++  +  I SI+  +S             P +   FAL+A  L
Sbjct: 436 -----ADEASEKLAKQMFKSGVYGITSIEKFVS------------TPSV-YNFALEAVGL 477

Query: 403 NMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTI 462
           +   +    ++  L S+ SDP SY    KDDR ++L   FNF++ G +    + Q    +
Sbjct: 478 DPDSVSATTVKAALKSDLSDPKSYVYTLKDDRYVQLARYFNFDSKGQLTTPLVAQDAAEV 537

Query: 463 RDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVD--YYTLNINTIHSFEEL 520
            +  K Y   K     A  K+              L+  +E D  YY   I  + S  EL
Sbjct: 538 TNIAKDYVIAKTKFASAAEKA-------------GLQEAAEKDALYYKNAIAGVDSVSEL 584

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
           LA+K+++NF+L +KG+D +KV  D+L +IF SDL D KSFAN   D R+ EI +SFNFD 
Sbjct: 585 LADKKLVNFILVAKGLDPKKVTNDYLRKIFSSDLSDAKSFANKESDLRFAEIAASFNFDK 644

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
            G+++       Q    + +T + Y  Q +E ++   +P + LALYF+R  P I + Y+I
Sbjct: 645 KGKVTRIAATGPQSREQLLETQNNYLQQSLESQQGNTNPGVRLALYFQRKAPEITSAYQI 704

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
           L D  LF+V      L    A  P  K+ +I++KH+K+ D  D  K+   L
Sbjct: 705 LADKALFEVFRTTYSLPDTMANAPIEKQAKIVEKHLKLKDLGDPAKLGRVL 755



 Score =  128 bits (321), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 64/177 (36%), Positives = 103/177 (58%), Gaps = 1/177 (0%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           V++   V+    YY+E I  + T+D+F+K+ RL+ YA+KA+GL DM+ A+ F+KK+LESD
Sbjct: 22  VAQQTDVTRAASYYKENIGKVKTVDDFMKNDRLYRYAMKAYGLEDMTFAKAFMKKVLESD 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           L+D KS  N+L   +YQ FA ++ F S    V Q+  Q   ++  Y  + Q + +   E+
Sbjct: 82  LTDSKSFANKLTDKRYQEFAAAFSFNSATTAVAQTSYQTDEMVGLYTATLQQQADAVGED 141

Query: 141 SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY 197
           ++Y+   I  I +VDQL  + RL  YV  +F I     S   +K++L    ++P  Y
Sbjct: 142 TRYYNAKIGSIATVDQLLNNDRLRTYVFSAFGIDDGTWSRATMKNILGSDPSDPGSY 198



 Score = 62.4 bits (150), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 82/184 (44%), Gaps = 14/184 (7%)

Query: 15  QSKLFSTVSKDPIVSCEER---YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAE 71
           ++K  S   K  +    E+   YY+  I  + ++ E + DK+L ++ L A GL       
Sbjct: 548 KTKFASAAEKAGLQEAAEKDALYYKNAIAGVDSVSELLADKKLVNFILVAKGLDPKKVTN 607

Query: 72  KFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVI-------QSDIQ----HK 120
            +++KI  SDLSD KS  N+ + L++   A S++F    KV        QS  Q      
Sbjct: 608 DYLRKIFSSDLSDAKSFANKESDLRFAEIAASFNFDKKGKVTRIAATGPQSREQLLETQN 667

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
             +Q   +S Q      +  + YF++   +I S  Q+  D+ L +    ++S+     + 
Sbjct: 668 NYLQQSLESQQGNTNPGVRLALYFQRKAPEITSAYQILADKALFEVFRTTYSLPDTMANA 727

Query: 181 PFLK 184
           P  K
Sbjct: 728 PIEK 731



 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 70/148 (47%), Gaps = 10/148 (6%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++     YY  NI  + + ++ + N R+  + +++ G++     + F+ ++ +SDL D K
Sbjct: 27  DVTRAASYYKENIGKVKTVDDFMKNDRLYRYAMKAYGLEDMTFAKAFMKKVLESDLTDSK 86

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           SFAN   D RY+E  ++F+F+             Q ++  D+   LY   +    +++ D
Sbjct: 87  SFANKLTDKRYQEFAAAFSFN------SATTAVAQTSYQTDEMVGLYTATL----QQQAD 136

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKL 646
                  Y+   I +I    ++L + +L
Sbjct: 137 AVGEDTRYYNAKIGSIATVDQLLNNDRL 164



 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 112/294 (38%), Gaps = 62/294 (21%)

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +GK+K++D+ +                   ++A+ AY L      +  ++ VL S+
Sbjct: 35  YKENIGKVKTVDDFMKNDR-------------LYRYAMKAYGLEDMTFAKAFMKKVLESD 81

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            +D  S+ANK  D R  +   AF+FN+        + Q+     + V  Y    +   DA
Sbjct: 82  LTDSKSFANKLTDKRYQEFAAAFSFNS----ATTAVAQTSYQTDEMVGLYTATLQQQADA 137

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
                               +  +  YY   I +I + ++LL N R+  ++  + GID  
Sbjct: 138 --------------------VGEDTRYYNAKIGSIATVDQLLNNDRLRTYVFSAFGIDDG 177

Query: 540 KVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHID 599
                 +  I  SD  DP S+ NT       + I+SFN          +      +  ID
Sbjct: 178 TWSRATMKNILGSDPSDPGSYINTVWGPPLDDAIASFNL--------AQAESTDASSKID 229

Query: 600 DTCDLYKHQMIEKKEEEKDPNIALAL-------------YFKRTIPNIRNHYEI 640
           D    Y  QM +   +  D    +AL              F +TI  I +++E+
Sbjct: 230 D----YTAQMAQPGADLADLKAKIALEQGRVAKASSDMSGFNKTIIAIGHYFEL 279



 Score = 50.4 bits (119), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 85/191 (44%), Gaps = 30/191 (15%)

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQ 309
           +    +YYK  I  V +  DF+K+ +L++   +  + L     A  F+  + E+D  ++ 
Sbjct: 28  VTRAASYYKENIGKVKTVDDFMKNDRLYRY-AMKAYGLEDMTFAKAFMKKVLESD--LTD 84

Query: 310 VKYF-----------FQINFHRDNSSSTKIQQDS-QIQKMLDLYKKNCQILHDDKMQSLI 357
            K F           F   F   NS++T + Q S Q  +M+ LY    Q    D +    
Sbjct: 85  SKSFANKLTDKRYQEFAAAFSF-NSATTAVAQTSYQTDEMVGLYTATLQ-QQADAVGEDT 142

Query: 358 KDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
           + Y   +G I ++D LL+            + + T  F+  A+ ++     R  ++N+L 
Sbjct: 143 RYYNAKIGSIATVDQLLN-----------NDRLRTYVFS--AFGIDDGTWSRATMKNILG 189

Query: 418 SNPSDPDSYAN 428
           S+PSDP SY N
Sbjct: 190 SDPSDPGSYIN 200



 Score = 49.7 bits (117), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 62/136 (45%), Gaps = 3/136 (2%)

Query: 141 SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
           + Y+++NI K+ +VD   K+ RL  Y ++++ +     +  F+K VL   L + K +  +
Sbjct: 32  ASYYKENIGKVKTVDDFMKNDRLYRYAMKAYGLEDMTFAKAFMKKVLESDLTDSKSFANK 91

Query: 201 SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLA 260
             D R++  A  F F    +   +    TD ++  + +       D V    D  YY   
Sbjct: 92  LTDKRYQEFAAAFSFNSATTAVAQTSYQTD-EMVGLYTATLQQQADAVG--EDTRYYNAK 148

Query: 261 INSVSSFSDFLKDPKL 276
           I S+++    L + +L
Sbjct: 149 IGSIATVDQLLNNDRL 164


>gi|218674655|ref|ZP_03524324.1| hypothetical protein RetlG_25976 [Rhizobium etli GR56]
          Length = 469

 Score =  192 bits (487), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 129/450 (28%), Positives = 229/450 (50%), Gaps = 20/450 (4%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ ++V+        S   S V+    V+ +  YY+E I  ++T+DEF+ D +L+SYA+K
Sbjct: 1   MVSAYVSYLAVARNLSASLSNVASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ FS   K  QSD+Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFSGETKTAQSDVQRD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
           +++  Y++S + + +   +E+ YF +NI  I SVD      RL +YVL +F ++ +Y S 
Sbjct: 121 SLLDAYEESFETEADAIEDETDYFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTST 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLKDVLT  L +   +  +  D+ + ++A+ F F  DGS+     ++++ QI  + S Y
Sbjct: 181 SFLKDVLTSDLDDADSFVNQLGDDVYVSLAKAFNFNEDGSVDG--DLMSEDQILLVTSAY 238

Query: 241 FNNTIDCVPIVSDQ------NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               +    I S +       Y+   I +++S    + D KL   L+ +    + E  +D
Sbjct: 239 ---AVASATIASSETGEAYDTYFAAEIGNITSVDQLMSDDKLVSYLRTAYGLTDDE--SD 293

Query: 295 KFLTLMQENDPIVSQVK---YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL- 348
            F++   ++  I   +         NF  D   +     Q   Q       + +N Q+L 
Sbjct: 294 TFISAALKSADIADAIGLSDLHDAFNFDEDGALADGDTAQTSDQTAATTAAFDENYQVLI 353

Query: 349 HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
            +   +  + +Y   +  + SID+ L      +  ++ + P +  + AL A++++   + 
Sbjct: 354 ANTDTEDAVDNYTTRIASVTSIDDFLVSNADDDDDDNDDLPEM-WEMALRAFDIDPDSVS 412

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKL 438
           R ++R +L S+P+D  SY N   DDR +  
Sbjct: 413 RSEVRKILESDPTDAKSYVNSLDDDRFVAF 442



 Score = 67.4 bits (163), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 113/269 (42%), Gaps = 41/269 (15%)

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
            +A+ AY L      +  ++ VL S+ SD  S+AN   D R  +   AF F+     G  
Sbjct: 56  SYAMKAYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFS-----GET 110

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
              QS +           ++ S+ DA  +SF +             I  E DY+  NI +
Sbjct: 111 KTAQSDV-----------QRDSLLDAYEESFETEADA---------IEDETDYFEENIAS 150

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEII 573
           I S ++ L++ R+ N++L + G+ ++     FL ++  SDL D  SF N   D+ Y  + 
Sbjct: 151 ITSVDDFLSSSRLKNYVLTAFGLSTEYTSTSFLKDVLTSDLDDADSFVNQLGDDVYVSLA 210

Query: 574 SSFNFDIHGE-----LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFK 628
            +FNF+  G      +S  +I  V   + +           I   E  +    A   YF 
Sbjct: 211 KAFNFNEDGSVDGDLMSEDQILLVTSAYAV-------ASATIASSETGE----AYDTYFA 259

Query: 629 RTIPNIRNHYEILGDSKLFKVVSKKLKLS 657
             I NI +  +++ D KL   +     L+
Sbjct: 260 AEIGNITSVDQLMSDDKLVSYLRTAYGLT 288



 Score = 45.1 bits (105), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 71/153 (46%), Gaps = 11/153 (7%)

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK 565
           YY  NI+ + + +E + + ++ ++ +++ G++     + F+ ++ +SDL D  SFAN+  
Sbjct: 34  YYKENIDKVTTVDEFMGDYKLYSYAMKAYGLEDMTYAKAFMKKVLESDLSDSSSFANSLS 93

Query: 566 DNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALAL 625
           D RY E  ++F F   GE         Q +   D   D Y+    E  E E D       
Sbjct: 94  DGRYAEFAAAFKF--SGETK-----TAQSDVQRDSLLDAYE----ESFETEADAIEDETD 142

Query: 626 YFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
           YF+  I +I +  + L  S+L   V     LS 
Sbjct: 143 YFEENIASITSVDDFLSSSRLKNYVLTAFGLST 175


>gi|241203339|ref|YP_002974435.1| hypothetical protein Rleg_0592 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857229|gb|ACS54896.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 1111

 Score =  190 bits (482), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 170/672 (25%), Positives = 297/672 (44%), Gaps = 126/672 (18%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    S+D+ S L + V+    V  + +YY + I  ++++D+F+ D +L+SYA+
Sbjct: 1   MITASLAYTILSRDMTSSL-NKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNEPAKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+   I  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DDLIGLYKQSFIDADKAASAESSYYGTAIDGVTTVDDLVNNTRLRTYVLKTFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++   +  T  Q   ++  
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFGFNADGTVNGTAQ--TAAQKASVIET 237

Query: 240 YFNNTIDCV---PIVSD------------QNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+   +    + SD            + YY   I ++++  D + D +L   +  + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVYYVGKTAADYNKAYYTAKIGTITNVDDLVADKRLTSYITTA- 296

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYFFQI----NFHRDNSSSTKIQQDSQIQKMLDL 340
           + +  + TA    T++   DP  +Q+  F  +    NF  D S+S+     +++Q +   
Sbjct: 297 YSMGADFTAAALRTVL--TDPGYAQLMGFTNVYNAFNFKADGSTSST----ARVQTV--- 347

Query: 341 YKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAY 400
                     D+  SL    Q      K+   + S    +   ++     +  ++  DAY
Sbjct: 348 ----------DQANSL----QAAASGTKNYYTVTSQSSGITNVDALLADNVLARYIKDAY 393

Query: 401 NLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRL 460
            L     + D L+++LT    D    A +   D    LN  FNF ADGSI          
Sbjct: 394 GLGTSFSNAD-LKSILT----DSTYAAAQGHAD----LNADFNFQADGSING-------- 436

Query: 461 TIRDNVKHYANRKRSIHD--AENKS-FNSMEQISTQKRINLEINSEVDYYTLNINTIHSF 517
               +V   A +++S  D  A N + FNSM                       I  + + 
Sbjct: 437 ----SVIQTAAQRKSTTDKSAANAAHFNSM-----------------------IGNVTNV 469

Query: 518 EELLANKRILNFLLESKGID---SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
           ++++++   ++++  S  I    S      FL +   +  +             Y ++  
Sbjct: 470 DDIMSDAVAVSYIRNSMQIADSVSDATLRTFLVDRTAASAQ------------GYSDVHD 517

Query: 575 SFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI 634
            FNF   G +                   LY  Q   +           A+Y++ TI  I
Sbjct: 518 LFNFKSDGSVPT-----------------LYASQSATQSASTTSKASDAAVYYQATIAGI 560

Query: 635 RNHYEILGDSKL 646
            N  ++L D KL
Sbjct: 561 SNVDQLLADQKL 572



 Score =  183 bits (464), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 148/574 (25%), Positives = 258/574 (44%), Gaps = 45/574 (7%)

Query: 137  ALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKK 196
            A + + Y++  I  I++VDQL  D++L ++V  +F I P  ++   L+++LT        
Sbjct: 546  ASDAAVYYQATIAGISNVDQLLADQKLNNFVRNAFGI-PSTVTDVALRNILT-------- 596

Query: 197  YFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNY 256
               +S    +  +A  F F+ DG+L    +  T  QI          T D          
Sbjct: 597  --DQSGTGTYADVAGAFNFKADGTLEDGLQAQTATQISSTKFAAEARTDD---------- 644

Query: 257  YKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQ- 315
            Y   + ++++  D L D  +   L+ S + L  +I+     +++ +     +        
Sbjct: 645  YSARMATIANVDDLLADSAITNFLK-STYNLPFDISDADLKSILTDATAAAAAGHADLNA 703

Query: 316  -INFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ---------LP 363
              NF  D S    + +Q   Q Q   D Y        D+ +  +  +YQ         L 
Sbjct: 704  DFNFAADGSLPVVSSVQTADQAQTTNDNYAARYDDERDEALDEVASNYQKLMADSSSLLN 763

Query: 364  LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
               +KS+++ L      +   S +        AL A+ L  QD+ R  +R VLTS+  DP
Sbjct: 764  FSDVKSVNDFLRSNSAADFSKSNDNLPDLYHVALQAFGLTDQDVPRSMMRKVLTSDAYDP 823

Query: 424  DSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKS 483
            D Y    KD+R+  L  AFNF  DG            T+      Y +    +       
Sbjct: 824  DGYIASLKDERITNLARAFNFGPDGKAASPFQALPDATLAKYATDYKSHITML------- 876

Query: 484  FNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE 543
               M+    + +   +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +
Sbjct: 877  ---MKDGPVKDKAAKDATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDK 933

Query: 544  DFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
              L +IF SD  D KS+ NT  D R+++I+++FNFD  G L+  KIG +Q+    + T +
Sbjct: 934  ATLKKIFTSDPDDKKSYLNTKADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEEHTQE 993

Query: 604  LYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVL 663
            LY  Q +E ++ E +  + LALYF R  P+I + Y ILGD  L++V++    L    + +
Sbjct: 994  LYVQQTMEAQQGESNDGVRLALYFARKAPSITSIYSILGDKALYQVITTAYNLPSQISGM 1053

Query: 664  PERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
               K+  +L + +K+ D +D KKV+  L    AM
Sbjct: 1054 DVTKQRDLLSRFVKLEDLQDPKKVDKLLRRFTAM 1087



 Score = 76.6 bits (187), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 84/192 (43%), Gaps = 18/192 (9%)

Query: 54  LFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVI 113
           L+  AL+AFGL+D       ++K+L SD  DP   +  L   +    AR+++F P  K  
Sbjct: 792 LYHVALQAFGLTDQDVPRSMMRKVLTSDAYDPDGYIASLKDERITNLARAFNFGPDGKAA 851

Query: 114 Q-----SDIQHKTIIQDYKQSH-----------QHKEEVALEESKYFRKNIHKINSVDQL 157
                  D        DYK SH               + A  E  YF K + K+ S+D  
Sbjct: 852 SPFQALPDATLAKYATDYK-SHITMLMKDGPVKDKAAKDATAEVDYFAKGMAKVKSLDDF 910

Query: 158 FKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP 217
             D RL D VL++ ++ PK      LK + T    + K Y     D RF+ +   F F  
Sbjct: 911 LDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNTKADARFQDIVAAFNFDK 970

Query: 218 DGSLSKRDKILT 229
           DG+L+ R KI T
Sbjct: 971 DGNLT-RAKIGT 981



 Score = 72.8 bits (177), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 89/177 (50%), Gaps = 15/177 (8%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           +S+ ++++Q      +  +  YY  +IN + S ++ L + ++ ++ +++ G++     + 
Sbjct: 17  SSLNKVASQA----TVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMKAYGLEDMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +SDL DP S+AN   D RY+E  ++FNF       ++    VQ +   DD   L
Sbjct: 73  FMKKVLESDLTDPNSYANKLSDTRYREFAAAFNF-------NEPAKDVQTDAQEDDLIGL 125

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
           YK   I+  +       A + Y+   I  +    +++ +++L   V K  K+ P +A
Sbjct: 126 YKQSFIDADKAAS----AESSYYGTAIDGVTTVDDLVNNTRLRTYVLKTFKIDPTYA 178



 Score = 66.6 bits (161), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 136/601 (22%), Positives = 230/601 (38%), Gaps = 128/601 (21%)

Query: 20   STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
            ST SK    S    YY+  I  IS +D+ + D++L ++   AFG+               
Sbjct: 541  STTSK---ASDAAVYYQATIAGISNVDQLLADQKLNNFVRNAFGIPST-----------V 586

Query: 80   SDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALE 139
            +D++    L +Q  +  Y   A +++F      ++  +Q +T  Q    S +   E   +
Sbjct: 587  TDVALRNILTDQSGTGTYADVAGAFNF-KADGTLEDGLQAQTATQ--ISSTKFAAEARTD 643

Query: 140  ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
            +   +   +  I +VD L  D  + +++  ++++ P  IS   LK +LT   A       
Sbjct: 644  D---YSARMATIANVDDLLADSAITNFLKSTYNL-PFDISDADLKSILTDATAAAAAGHA 699

Query: 200  ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF-------NNTIDCVPIVS 252
            +        +  +F F  DGSL     + T  Q +    NY        +  +D V    
Sbjct: 700  D--------LNADFNFAADGSLPVVSSVQTADQAQTTNDNYAARYDDERDEALDEVA--- 748

Query: 253  DQNYYKLAINS--------VSSFSDFLKD-------------PKLFKMLQLSLFPLN--- 288
              NY KL  +S        V S +DFL+              P L+  + L  F L    
Sbjct: 749  -SNYQKLMADSSSLLNFSDVKSVNDFLRSNSAADFSKSNDNLPDLYH-VALQAFGLTDQD 806

Query: 289  -PEITADKFLT---------LMQENDPIVSQVKYFFQINFHRDNSSSTKIQQ--DSQIQK 336
             P     K LT         +    D  ++ +   F  NF  D  +++  Q   D+ + K
Sbjct: 807  VPRSMMRKVLTSDAYDPDGYIASLKDERITNLARAF--NFGPDGKAASPFQALPDATLAK 864

Query: 337  MLDLYKKNCQILHDDK---------MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAE 387
                YK +  +L  D            + +  +   + K+KS+D+ L            +
Sbjct: 865  YATDYKSHITMLMKDGPVKDKAAKDATAEVDYFAKGMAKVKSLDDFL------------D 912

Query: 388  EPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNAD 447
            +  +T    L A NL+ +D D+  L+ + TS+P D  SY N   D R   +  AFNF+ D
Sbjct: 913  DSRLT-DLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNTKADARFQDIVAAFNFDKD 971

Query: 448  GSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSME--QISTQKRINLEINSEVD 505
            G++            R  +    N+    H  E     +ME  Q  +   + L +     
Sbjct: 972  GNL-----------TRAKIGTIQNKAAEEHTQELYVQQTMEAQQGESNDGVRLAL----- 1015

Query: 506  YYTLNINTIHSFEELLANKRILNFLLES-------KGIDSQKVREDFLCEIFK-SDLKDP 557
            Y+     +I S   +L +K +   +  +        G+D  K R D L    K  DL+DP
Sbjct: 1016 YFARKAPSITSIYSILGDKALYQVITTAYNLPSQISGMDVTKQR-DLLSRFVKLEDLQDP 1074

Query: 558  K 558
            K
Sbjct: 1075 K 1075


>gi|15887995|ref|NP_353676.1| hypothetical protein Atu0653 [Agrobacterium tumefaciens str. C58]
 gi|15155605|gb|AAK86461.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 812

 Score =  173 bits (439), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 157/688 (22%), Positives = 302/688 (43%), Gaps = 85/688 (12%)

Query: 31  EERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
           E RYY+  I  ++  D+ +++ R  +Y  + F + + +++   IK ++ SD++DP S +N
Sbjct: 140 ETRYYKAIIGTVTNADQLLRNDRTRAYIFQVFNIDEKTYSYAHIKGLMTSDVNDPNSYIN 199

Query: 91  QLNSLKYQYFARSYDFSPPPKVIQSDIQ-HKTIIQ-------DYKQSHQHKEE-VALEES 141
           Q        +  +Y+ +     ++ +I+ H  +         D   +    EE   LE  
Sbjct: 200 Q-------NYGAAYNDAVEKLTMKGNIELHAQVTARITAIDTDLAGTGLTAEERTKLEAE 252

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
           K  R+N  ++  ++ +   +   D  L +       +S                     +
Sbjct: 253 KVTRQN--QLTQLEAVLPPKDQWDAKLAAIKAEQTTLSNAV------------------T 292

Query: 202 RDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS--DQNYYKL 259
           + N+   +A  F F+ DG++        D +++ I  +Y  +     P V+  +++Y++ 
Sbjct: 293 QYNKMAQIANAFEFKNDGTVDAGGAQTAD-KLKAITDSYIGSAPRVTPTVATLNRDYFES 351

Query: 260 AINSVSSFSDFLKDPKL-------FKMLQLSLFPLNPE--ITAD-----KFLTLMQENDP 305
            I S+++  + + D +L       F +  L++ P   +  +T+D      ++  M +ND 
Sbjct: 352 KIGSITTVEELMSDARLLNYVRTAFDLNDLTIVPATIKNILTSDLSDPNNYIATMGKNDK 411

Query: 306 IVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLP 363
               +K  F  NF  D +  + T  Q  +Q       Y  +     D      +  ++  
Sbjct: 412 RYLALKNAF--NFLPDGTLAAGTTPQTTTQTATTTSGYMTHYNDADDAADAKALSLFKSS 469

Query: 364 LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
           + K+ S+++ L       G N+         +AL A  L+   ++   ++ VLTS+  D 
Sbjct: 470 ISKVTSVNDFL-------GTNAV------YTYALRAVGLDPAKVNISDIQRVLTSDLQDK 516

Query: 424 DSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKS 483
            SY    KDDR +KL   FNF  DGS+G   + QS + ++     Y  +K +    ++K 
Sbjct: 517 KSYVYTLKDDRYVKLAELFNFTKDGSVGSPILAQSEIELQTMSADYIKKKSAFGTEKDKE 576

Query: 484 FNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE 543
                             +E  Y++  +  I +  E LAN R+  F +ES GID + V +
Sbjct: 577 ---------------AAQTEAKYFSGEMQKIKTLSEFLANDRLTKFAMESLGIDPKSVTK 621

Query: 544 DFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
           + L +IF S+L D  S+ N   D  ++ ++++FNFD  G+L H+    +Q    + +T D
Sbjct: 622 EQLQKIFTSNLDDKNSYVNKEMDPVFRRLVTAFNFDTEGKLLHEDRSAIQTRRGLYETLD 681

Query: 604 LYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVL 663
            Y  Q +E +  E++  + LALYFKR      ++Y IL D+ +   +     +       
Sbjct: 682 NYLTQTLESQAGEENAGVRLALYFKRMAAGTTSYYSILADTAIQNFIKTTFGIPDELGNA 741

Query: 664 PERKKIRILKKHIKINDFKDSKKVEDFL 691
               ++ ++KK+  I DF+D  KV+  +
Sbjct: 742 NVDTQVAMMKKYFDIKDFQDPDKVKKLI 769



 Score =  132 bits (333), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 115/186 (61%), Gaps = 1/186 (0%)

Query: 12  KDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAE 71
           +D++S + S VS+  +V  + +YY+E I ++ ++DEF+ + +L+SYA+ AFGL +M++A+
Sbjct: 13  RDMKSSI-SRVSQQGLVERQTKYYKENIGNVKSVDEFLGNYQLYSYAMDAFGLGEMTYAK 71

Query: 72  KFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQ 131
            F+KK+LESDL+D  S  N+L   +Y+ FA S++F+   K +Q+D Q   +I  Y  S  
Sbjct: 72  AFMKKVLESDLNDQNSFANKLTDERYREFAASFNFTASTKTVQTDAQLDKMIGLYDTSIT 131

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
           +      EE++Y++  I  + + DQL ++ R   Y+ Q F+I  K  S   +K ++T  +
Sbjct: 132 NLNGSLAEETRYYKAIIGTVTNADQLLRNDRTRAYIFQVFNIDEKTYSYAHIKGLMTSDV 191

Query: 192 ANPKKY 197
            +P  Y
Sbjct: 192 NDPNSY 197



 Score = 91.3 bits (225), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 129/281 (45%), Gaps = 23/281 (8%)

Query: 26  PIVSCEER-YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSD 84
           P V+   R Y+  +I  I+T++E + D RL +Y   AF L+D++     IK IL SDLSD
Sbjct: 339 PTVATLNRDYFESKIGSITTVEELMSDARLLNYVRTAFDLNDLTIVPATIKNILTSDLSD 398

Query: 85  PKSLVNQL--NSLKYQYFARSYDFSPPPKVIQSDIQHKTI---------IQDYKQSHQHK 133
           P + +  +  N  +Y     +++F P   +        T          +  Y  +    
Sbjct: 399 PNNYIATMGKNDKRYLALKNAFNFLPDGTLAAGTTPQTTTQTATTTSGYMTHYNDADDAA 458

Query: 134 EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLAN 193
           +  AL     F+ +I K+ SV+       +  Y L++  + P  +++  ++ VLT  L +
Sbjct: 459 DAKALS---LFKSSISKVTSVNDFLGTNAVYTYALRAVGLDPAKVNISDIQRVLTSDLQD 515

Query: 194 PKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY------FNNTIDC 247
            K Y    +D+R+  +AE F F  DGS+       ++++++ + ++Y      F    D 
Sbjct: 516 KKSYVYTLKDDRYVKLAELFNFTKDGSVGSPILAQSEIELQTMSADYIKKKSAFGTEKDK 575

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKL--FKMLQLSLFP 286
               ++  Y+   +  + + S+FL + +L  F M  L + P
Sbjct: 576 EAAQTEAKYFSGEMQKIKTLSEFLANDRLTKFAMESLGIDP 616



 Score = 72.0 bits (175), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 112/560 (20%), Positives = 227/560 (40%), Gaps = 76/560 (13%)

Query: 112 VIQSDIQHKTIIQDYKQSHQHKEEVALEE--SKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ + + +  I +D K S     +  L E  +KY+++NI  + SVD+   + +L  Y + 
Sbjct: 1   MVSTFLSYDLINRDMKSSISRVSQQGLVERQTKYYKENIGNVKSVDEFLGNYQLYSYAMD 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +F +     +  F+K VL   L +   +  +  D R+R  A +F F      +    + T
Sbjct: 61  AFGLGEMTYAKAFMKKVLESDLNDQNSFANKLTDERYREFAASFNFT-----ASTKTVQT 115

Query: 230 DMQIEKIVSNYFNNTIDC-VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN 288
           D Q++K++  Y  +  +    +  +  YYK  I +V++                      
Sbjct: 116 DAQLDKMIGLYDTSITNLNGSLAEETRYYKAIIGTVTN---------------------- 153

Query: 289 PEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQIL 348
               AD+ L     ND   + +   F I+    + +  K    S +        +N    
Sbjct: 154 ----ADQLL----RNDRTRAYIFQVFNIDEKTYSYAHIKGLMTSDVNDPNSYINQNYGAA 205

Query: 349 HDDKMQSLIKDYQLPL-----GKIKSIDNLLSG-KCQLEGPNSAEEPIITLQFALDAYNL 402
           ++D ++ L     + L      +I +ID  L+G     E     E   +T Q  L    L
Sbjct: 206 YNDAVEKLTMKGNIELHAQVTARITAIDTDLAGTGLTAEERTKLEAEKVTRQNQLT--QL 263

Query: 403 NMQDLDRDQLRNVLTSNPSDPDSYANK-SKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
                 +DQ    L +  ++  + +N  ++ +++ ++ +AF F  DG            T
Sbjct: 264 EAVLPPKDQWDAKLAAIKAEQTTLSNAVTQYNKMAQIANAFEFKNDG------------T 311

Query: 462 IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINS-EVDYYTLNINTIHSFEEL 520
           +       A++ ++I D+          I +  R+   + +   DY+   I +I + EEL
Sbjct: 312 VDAGGAQTADKLKAITDS---------YIGSAPRVTPTVATLNRDYFESKIGSITTVEEL 362

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK--DNRYKEIISSFNF 578
           +++ R+LN++  +  ++   +    +  I  SDL DP ++  T    D RY  + ++FNF
Sbjct: 363 MSDARLLNYVRTAFDLNDLTIVPATIKNILTSDLSDPNNYIATMGKNDKRYLALKNAFNF 422

Query: 579 DIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHY 638
              G L+     +         +  +  +   +   + K    AL+L FK +I  + +  
Sbjct: 423 LPDGTLAAGTTPQTTTQTATTTSGYMTHYNDADDAADAK----ALSL-FKSSISKVTSVN 477

Query: 639 EILGDSKLFKVVSKKLKLSP 658
           + LG + ++    + + L P
Sbjct: 478 DFLGTNAVYTYALRAVGLDP 497



 Score = 49.7 bits (117), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 74/169 (43%), Gaps = 17/169 (10%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
           F T         E +Y+   ++ I T+ EF+ + RL  +A+++ G+   S  ++ ++KI 
Sbjct: 569 FGTEKDKEAAQTEAKYFSGEMQKIKTLSEFLANDRLTKFAMESLGIDPKSVTKEQLQKIF 628

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYK----------- 127
            S+L D  S VN+     ++    +++F    K++  D   ++ IQ  +           
Sbjct: 629 TSNLDDKNSYVNKEMDPVFRRLVTAFNFDTEGKLLHED---RSAIQTRRGLYETLDNYLT 685

Query: 128 ---QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
              +S   +E   +  + YF++      S   +  D  + +++  +F I
Sbjct: 686 QTLESQAGEENAGVRLALYFKRMAAGTTSYYSILADTAIQNFIKTTFGI 734


>gi|325292035|ref|YP_004277899.1| hypothetical protein AGROH133_04160 [Agrobacterium sp. H13-3]
 gi|325059888|gb|ADY63579.1| hypothetical protein AGROH133_04160 [Agrobacterium sp. H13-3]
          Length = 812

 Score =  172 bits (435), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 160/655 (24%), Positives = 303/655 (46%), Gaps = 59/655 (9%)

Query: 12  KDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAE 71
           +D+++ + S VS+  IV  + +YY+E I ++ ++DEF+ + +L+SYA+ AFGL +M++A+
Sbjct: 13  RDMKASI-SRVSQQGIVERQTKYYKENIGNVKSVDEFLNNYQLYSYAMDAFGLGEMTYAK 71

Query: 72  KFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQ 131
            F+KK+LESDL+D  S  N+L   +Y+ FA S++F+     +Q++ Q   +I  Y  S  
Sbjct: 72  AFMKKVLESDLNDQNSFANKLTDERYREFAASFNFTQSTTTVQTEAQLDKMIGLYDTSIT 131

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
           + ++   EE++Y++  I  + +VDQL ++ R   Y+ + FSI  K  S   +K ++T  +
Sbjct: 132 NLDDSLSEETRYYKAIIGTVTNVDQLLQNDRTRAYIFEVFSIDEKTYSYSHIKGLMTSDI 191

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV 251
            +P  Y  +     + A  E  +    G++     + TD +I  I +   + T+      
Sbjct: 192 DDPNSYLNQKFGAAYSAAVE--KLTTKGNIELHGDV-TD-RITAIDTALADTTLTAEQRT 247

Query: 252 SDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVK 311
           + +       + ++     L     +     S+     +++     T+ Q N   ++Q+ 
Sbjct: 248 ALETEKTTRQDQLTQLEAVLPPKDQWAATLASITAEQTQLSN----TVSQYN--TMAQMA 301

Query: 312 YFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY-QLPLGKIKSI 370
             F+  F  D + +    Q +   K+L              + +L +DY +  +G IK++
Sbjct: 302 QAFE--FANDGTVAAGQAQTADNVKILTQAYVGSAPRVTPTVATLNRDYFESKIGSIKTV 359

Query: 371 DNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANK- 429
           D L++            +P + + +   A++LN   +    + N+LTS+ SDP++Y  K 
Sbjct: 360 DELMA------------DPRL-VNYIKVAFDLNDLTIVNATIENILTSDLSDPNNYIAKF 406

Query: 430 -SKDDRLIKLNHAFNFNADGSI--GPIPMMQSRLTIRDN--VKHYANRKRSIHDAENKSF 484
            + D R I L  AFNF ADG++  G  P   ++     N  + HY ++  +  +   K F
Sbjct: 407 GNGDKRYIALREAFNFKADGTLPDGTAPQTTTQTVTTTNGYMNHYNDKDEAADENALKLF 466

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            S                       +I  + S  + L +  +  + L++ G+D  KV   
Sbjct: 467 KS-----------------------DIANVKSVADFLESSAVYTYALKAVGLDPTKVNIA 503

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD-TCD 603
            +     SDL D KS+    KD+RY ++   FNF   G      +   Q    I   + D
Sbjct: 504 DVRRALTSDLLDKKSYVYALKDDRYVKLAELFNFKSDGSPGSPVLA--QSELEIQSMSVD 561

Query: 604 LYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
             K +     ++EK+     A +F+  +  ++   + LG+ +L K   + L + P
Sbjct: 562 YIKKKSAFGTDQEKEAAKKEAEFFRSELQKVKTLSDFLGNDRLTKFAMESLGIDP 616



 Score =  160 bits (404), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 159/689 (23%), Positives = 290/689 (42%), Gaps = 75/689 (10%)

Query: 25  DPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSD 84
           D  +S E RYY+  I  ++ +D+ +++ R  +Y  + F + + +++   IK ++ SD+ D
Sbjct: 134 DDSLSEETRYYKAIIGTVTNVDQLLQNDRTRAYIFEVFSIDEKTYSYSHIKGLMTSDIDD 193

Query: 85  PKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQ-HKTIIQDYKQSHQHKEEVALEESKY 143
           P S +NQ        F  +Y  +      + +I+ H  +            +  L   + 
Sbjct: 194 PNSYLNQ-------KFGAAYSAAVEKLTTKGNIELHGDVTDRITAIDTALADTTLTAEQR 246

Query: 144 FRKNIHKINSVDQLFKDRRLL----DYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
                 K    DQL +   +L     +     SIT +   L                   
Sbjct: 247 TALETEKTTRQDQLTQLEAVLPPKDQWAATLASITAEQTQLSN----------------T 290

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS--DQNYY 257
            S+ N    MA+ F F  DG+++       D  ++ +   Y  +     P V+  +++Y+
Sbjct: 291 VSQYNTMAQMAQAFEFANDGTVAAGQAQTAD-NVKILTQAYVGSAPRVTPTVATLNRDYF 349

Query: 258 KLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP----EITADKFLT--LMQENDPIV---- 307
           +  I S+ +  + + DP+L   ++++ F LN       T +  LT  L   N+ I     
Sbjct: 350 ESKIGSIKTVDELMADPRLVNYIKVA-FDLNDLTIVNATIENILTSDLSDPNNYIAKFGN 408

Query: 308 SQVKYFF---QINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL 362
              +Y       NF  D +    T  Q  +Q     + Y  +     +   ++ +K ++ 
Sbjct: 409 GDKRYIALREAFNFKADGTLPDGTAPQTTTQTVTTTNGYMNHYNDKDEAADENALKLFKS 468

Query: 363 PLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSD 422
            +  +KS+ + L             E      +AL A  L+   ++   +R  LTS+  D
Sbjct: 469 DIANVKSVADFL-------------ESSAVYTYALKAVGLDPTKVNIADVRRALTSDLLD 515

Query: 423 PDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENK 482
             SY    KDDR +KL   FNF +DGS G   + QS L I+     Y  +K         
Sbjct: 516 KKSYVYALKDDRYVKLAELFNFKSDGSPGSPVLAQSELEIQSMSVDYIKKK--------S 567

Query: 483 SFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVR 542
           +F + ++    K+      SE       +  + +  + L N R+  F +ES GID  KV 
Sbjct: 568 AFGTDQEKEAAKKEAEFFRSE-------LQKVKTLSDFLGNDRLTKFAMESLGIDPTKVT 620

Query: 543 EDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTC 602
           +D L ++F S+L D  S+ N   D  ++ ++++FNFD  G +  +    +Q    + +T 
Sbjct: 621 KDQLQKMFTSNLDDKDSYLNKEMDPAFRRLVTAFNFDTDGNILREDRSSIQTRRGLYETL 680

Query: 603 DLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAV 662
           D Y  Q +E +  E++  + LALYFKR      ++Y IL D+ +   ++    +      
Sbjct: 681 DNYLTQTLETQAGEENAGVRLALYFKRMAAGTTSYYSILADTAIQNFITTTFGIPDELGN 740

Query: 663 LPERKKIRILKKHIKINDFKDSKKVEDFL 691
                ++ ++KK+  I DF+D  KV+  +
Sbjct: 741 AGVDTQVAMMKKYFDIEDFQDPDKVKKLI 769


>gi|218461856|ref|ZP_03501947.1| hypothetical protein RetlK5_21288 [Rhizobium etli Kim 5]
          Length = 256

 Score =  171 bits (433), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 140/223 (62%), Gaps = 2/223 (0%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  ++++D+F+ D +L+SYA+
Sbjct: 23  MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAM 81

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 82  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNAPEKDVQTDAQE 141

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ +  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 142 DELIGLYKQSFVDADKASAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYAS 201

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLS 222
             FL+ VLT  L++P         ++++A+A  F F  DG+++
Sbjct: 202 KDFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTVT 244



 Score = 85.5 bits (210), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 108/222 (48%), Gaps = 38/222 (17%)

Query: 364 LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
           + K+ S+D+ L G  +L              +A+ AY L      +  ++ VL S+ +DP
Sbjct: 61  INKVTSVDDFL-GDYKL------------YSYAMKAYGLEDMTYAKAFMKKVLESDLTDP 107

Query: 424 DSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKS 483
           +SYANK  D R  +   AFNFNA     P   +Q+     + +  Y   K+S  DA+  S
Sbjct: 108 NSYANKLSDARYREFAAAFNFNA-----PEKDVQTDAQEDELIGLY---KQSFVDADKAS 159

Query: 484 FNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE 543
                             +E  YY+ NI+++ + ++L+ N R+  ++L++  ID     +
Sbjct: 160 -----------------AAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYASK 202

Query: 544 DFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELS 585
           DFL ++  SDL DP S  NT   ++YK + + F+F+  G ++
Sbjct: 203 DFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTVT 244



 Score = 69.3 bits (168), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 92/177 (51%), Gaps = 15/177 (8%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           +S+ ++++Q      +  +  YY  +IN + S ++ L + ++ ++ +++ G++     + 
Sbjct: 39  SSLNKVASQA----TVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMKAYGLEDMTYAKA 94

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +SDL DP S+AN   D RY+E  ++FNF+   +        VQ +   D+   L
Sbjct: 95  FMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNAPEK-------DVQTDAQEDELIGL 147

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
           YK   ++  +     + A + Y+   I +++   +++ +++L   V K  K+ P +A
Sbjct: 148 YKQSFVDADK----ASAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYA 200



 Score = 55.5 bits (132), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 102/228 (44%), Gaps = 27/228 (11%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           + K +++  N       +  D  YY   IN V+S  DFL D KL+    +  + L     
Sbjct: 33  LSKDMTSSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYS-YAMKAYGLEDMTY 91

Query: 293 ADKFLTLMQENDPI--------VSQVKYF-FQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           A  F+  + E+D          +S  +Y  F   F+  N+    +Q D+Q  +++ LYK+
Sbjct: 92  AKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNF-NAPEKDVQTDAQEDELIGLYKQ 150

Query: 344 NCQILHDDKMQSLIKDYQL-PLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNL 402
           +   +  DK  +    Y    +  ++++D+L++   +L              + L  + +
Sbjct: 151 S--FVDADKASAAESTYYSNNIDSVQTVDDLVNN-TRLR------------TYVLKTFKI 195

Query: 403 NMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI 450
           +     +D LR VLTS+ SDP S  N    D+   L   F+FNADG++
Sbjct: 196 DPTYASKDFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTV 243


>gi|319781688|ref|YP_004141164.1| hypothetical protein Mesci_1961 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167576|gb|ADV11114.1| protein of unknown function DUF1217 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 603

 Score =  166 bits (421), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 150/601 (24%), Positives = 250/601 (41%), Gaps = 78/601 (12%)

Query: 119 HKTIIQDYKQSHQHKEE--VALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
           ++ I +D  +S    E+  V   ++KY+  NI K+ S+D   K+ RL  Y ++++ +   
Sbjct: 8   YQLITRDISKSIDRIEQQPVVDRDTKYYLDNITKVKSIDDFVKNDRLFKYAMKAYGLEDM 67

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKI 236
             +  F+   L  G+++P  +  +  D R+      F F  +G+       + +   + +
Sbjct: 68  AYAKAFMVKALKEGVSDPNSFANKLTDKRYAEFVRAFNFAANGT----STTVYNKAQQLV 123

Query: 237 VSNY-----FNNTIDCVPIV-SDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
            SNY        +   +P   S+  YY   I  V S  D + D +L     ++ F L+  
Sbjct: 124 TSNYALQVQIGASQKGLPYYQSETAYYVTNIAKVKSVDDLMGDSRLLT-YAMAAFGLDAA 182

Query: 291 ITADKFLTLMQEND-----------PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLD 339
                 +  M E             P  S  K+    +F +    +T ++ D Q Q +  
Sbjct: 183 TEPAATVKAMLEGGVSDPDSPANKLPDKSYAKFVAAFDFAQYGDQTT-MRDDVQ-QAVPK 240

Query: 340 LYKKNCQILHDDKMQSLIKD----YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQF 395
            Y     +   +     IK     Y   + K+ SIDNL++ K               L F
Sbjct: 241 GYMAGAGLTLVEPSAQYIKGEADYYAANISKVTSIDNLMADKR-------------LLTF 287

Query: 396 ALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPM 455
           A+ +Y L+       Q+R +L    SDP+S ANK  D R      AFNF   G       
Sbjct: 288 AMASYGLDASTETPQQIRTMLEGGVSDPESPANKLTDKRYANFVTAFNFAQYGD------ 341

Query: 456 MQSRLTIRDNV-----KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLN 510
              + T RD V     K Y         A N  +               I SE  YY  N
Sbjct: 342 ---QTTSRDEVQKDTPKIYTTESALGLIAPNADY---------------IKSETAYYLAN 383

Query: 511 INTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYK 570
           +  + S ++L+AN R+ N++L + G+D     +D +  +    ++D  S AN   +  Y 
Sbjct: 384 VTNVKSVDDLMANSRLYNYVLSAYGLDPATESKDLIRNVLAGGIRDADSVANKMTNKAYA 443

Query: 571 EIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRT 630
            + ++FNF+ +GE +   I   Q       T D Y  Q +E+   + +  + LALYF R 
Sbjct: 444 GLAAAFNFEQYGE-AATTINPAQ-----QPTVDKYMRQTLEEDAGQTNQGVRLALYFDRK 497

Query: 631 IPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDF 690
            P I + Y++L D+ L  VV   L L   FA     K+ ++ ++ + I+DF D +K+  F
Sbjct: 498 APTITSWYDVLADTALASVVRTVLGLPDSFATADVDKQAQLFEQKLDISDFSDPEKLGKF 557

Query: 691 L 691
           L
Sbjct: 558 L 558



 Score =  130 bits (327), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 121/469 (25%), Positives = 202/469 (43%), Gaps = 56/469 (11%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++DI SK    + + P+V  + +YY + I  + +ID+F+K+ RLF YA+KA+GL DM++A
Sbjct: 12  TRDI-SKSIDRIEQQPVVDRDTKYYLDNITKVKSIDDFVKNDRLFKYAMKAYGLEDMAYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVI------QSDIQHKTIIQ 124
           + F+ K L+  +SDP S  N+L   +Y  F R+++F+            Q  +     +Q
Sbjct: 71  KAFMVKALKEGVSDPNSFANKLTDKRYAEFVRAFNFAANGTSTTVYNKAQQLVTSNYALQ 130

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
               + Q        E+ Y+  NI K+ SVD L  D RLL Y + +F +         +K
Sbjct: 131 VQIGASQKGLPYYQSETAYYVTNIAKVKSVDDLMGDSRLLTYAMAAFGLDAATEPAATVK 190

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG-SLSKRDKILTDMQIEKIVSNYFNN 243
            +L  G+++P     +  D  +      F F   G   + RD    D+Q + +   Y   
Sbjct: 191 AMLEGGVSDPDSPANKLPDKSYAKFVAAFDFAQYGDQTTMRD----DVQ-QAVPKGYMAG 245

Query: 244 T-IDCVP-----IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
             +  V      I  + +YY   I+ V+S  + + D +L      S + L+      + +
Sbjct: 246 AGLTLVEPSAQYIKGEADYYAANISKVTSIDNLMADKRLLTFAMAS-YGLDASTETPQQI 304

Query: 298 TLMQEN---DP-----------IVSQVKYFFQINFHRDNSSSTKIQQDS----QIQKMLD 339
             M E    DP             + V  F    +    +S  ++Q+D+      +  L 
Sbjct: 305 RTMLEGGVSDPESPANKLTDKRYANFVTAFNFAQYGDQTTSRDEVQKDTPKIYTTESALG 364

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
           L   N      D ++S    Y   +  +KS+D+L++   +L              + L A
Sbjct: 365 LIAPNA-----DYIKSETAYYLANVTNVKSVDDLMA-NSRL------------YNYVLSA 406

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
           Y L+     +D +RNVL     D DS ANK  +     L  AFNF   G
Sbjct: 407 YGLDPATESKDLIRNVLAGGIRDADSVANKMTNKAYAGLAAAFNFEQYG 455


>gi|255601155|ref|XP_002537616.1| conserved hypothetical protein [Ricinus communis]
 gi|223515719|gb|EEF24767.1| conserved hypothetical protein [Ricinus communis]
          Length = 386

 Score =  165 bits (418), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/343 (28%), Positives = 172/343 (50%), Gaps = 16/343 (4%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
           + +Y+  +  +K+I +  +         +   P +  Q AL AY +   ++ + +L  +L
Sbjct: 16  VNNYKNRIASVKTIKDFFASNTSDSSAANDSAPEL-YQMALRAYGIGENEVTKSRLTKIL 74

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI-GPIPMMQSRLTIRDNVKHYANRKRS 475
            S+P DP SY N  KD R   L  AFNF++ G++  P+  + S+  I   +  Y++R  +
Sbjct: 75  ESDPYDPKSYVNSLKDSRFTALAKAFNFDSKGNLKAPVQSL-SQTQINSYISEYSSRTTA 133

Query: 476 -IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
            +  AE              +   +  +   Y+  NI  + S  +LLA+ ++ NF+L + 
Sbjct: 134 GLSGAE------------LTKATSDAKTAGTYFATNIVKVTSVTDLLADSKLTNFILTAN 181

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
            ID + V    L + F SD  D KSF NT    ++K I+ +FNF   G L+  K+G  Q+
Sbjct: 182 SIDPKTVDTATLKKAFASDPSDSKSFINTTDGAKFKSIVEAFNFGTDGNLTDSKLGTAQN 241

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
              +  T DL+ HQ +E ++ E +P + LALYF+R   +I + Y+I+GDS L++V++   
Sbjct: 242 QGALAATNDLFLHQTLEDQQGETNPGVRLALYFQRKASDINSIYDIMGDSALYEVITTTY 301

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
            L    + +    +  +L K + ++D +D  KV   L    AM
Sbjct: 302 NLPSSISNMDVDTQASMLSKFVNVSDLQDPDKVNQLLQRFSAM 344



 Score = 84.0 bits (206), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 104/230 (45%), Gaps = 33/230 (14%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDK------------RLFSYALKAFGLSDM 67
           ST++ D +       Y+ RI  + TI +F                 L+  AL+A+G+ + 
Sbjct: 9   STLTTDAV-----NNYKNRIASVKTIKDFFASNTSDSSAANDSAPELYQMALRAYGIGEN 63

Query: 68  SHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH--KTIIQD 125
              +  + KILESD  DPKS VN L   ++   A++++F      +++ +Q   +T I  
Sbjct: 64  EVTKSRLTKILESDPYDPKSYVNSLKDSRFTALAKAFNFDSKGN-LKAPVQSLSQTQINS 122

Query: 126 YKQSHQHKEEVALEESK-------------YFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
           Y   +  +    L  ++             YF  NI K+ SV  L  D +L +++L + S
Sbjct: 123 YISEYSSRTTAGLSGAELTKATSDAKTAGTYFATNIVKVTSVTDLLADSKLTNFILTANS 182

Query: 173 ITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLS 222
           I PK +    LK       ++ K +   +   +F+++ E F F  DG+L+
Sbjct: 183 IDPKTVDTATLKKAFASDPSDSKSFINTTDGAKFKSIVEAFNFGTDGNLT 232


>gi|163761036|ref|ZP_02168114.1| hypothetical protein HPDFL43_03334 [Hoeflea phototrophica DFL-43]
 gi|162281817|gb|EDQ32110.1| hypothetical protein HPDFL43_03334 [Hoeflea phototrophica DFL-43]
          Length = 961

 Score =  164 bits (414), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 94/294 (31%), Positives = 162/294 (55%), Gaps = 13/294 (4%)

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
           FA+ A  L+  ++ +  +R VLTS+  DP+SY    KD+R +K  + FNF+++G +   P
Sbjct: 632 FAMQAAELDPNEIPQRIMRKVLTSDLQDPNSYVYTLKDERYVKFANLFNFDSEG-VATAP 690

Query: 455 MM-QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
           +  Q +  + D  + Y  +K          F + E+ +T +    +  +E  YY   ++ 
Sbjct: 691 LTAQDQARMDDISRDYIVQK--------TRFLTGEEAATARS---DAEAEASYYQRTVSN 739

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEII 573
           I + ++LL N+R+++F L +KGID + V  D L  +F+SDL DP S+ANT  D R  E++
Sbjct: 740 IETLDQLLGNRRLIDFALTAKGIDPETVSNDELQLLFRSDLDDPDSYANTVSDFRLTEVV 799

Query: 574 SSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPN 633
           +SFNFD  G+L  +   ++     + +T +LY  Q IE +  E+D  + LALYF+R  P 
Sbjct: 800 TSFNFDEAGKLMQRDAAEISSRGDLYETMNLYLRQTIELERGEEDNGVRLALYFERMAPT 859

Query: 634 IRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKV 687
           I + Y+ILGD+ L++V      L    + +    +  +L+  + + D  D +K+
Sbjct: 860 ITSVYDILGDTALYEVFKTIFSLPDEISGMSVDSQAALLEDRMDMADLADPEKL 913



 Score =  121 bits (304), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 133/557 (23%), Positives = 245/557 (43%), Gaps = 86/557 (15%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++D+++++ + VS+   VS E  Y++E I  + + +EF+ D RL+SYA+KA GL DM +A
Sbjct: 12  AQDLKAEM-NRVSQQTQVSRETAYFKENIGKVRSAEEFVGDYRLYSYAMKAHGLEDMIYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSH 130
           E F+ K+LESDLSD  S  N+L   +Y+ FA ++ F    KV  S  Q    I  Y ++ 
Sbjct: 71  EAFMLKVLESDLSDSDSYANRLTDSRYRDFAAAFQFEDGSKVPMSVNQIDEAIGLYDETV 130

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
              ++    E  Y+      + +VDQ   D RL D++ QS+ I    +   FL+ +L   
Sbjct: 131 ASLDDKISGEVNYYNAMAGLVENVDQFLADPRLFDFITQSYGIDGSTVDRTFLRGILASD 190

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQI------EKIVSNYFNNT 244
             +P  Y   +       +  N R   + +LS    IL D+        +K     +   
Sbjct: 191 PDDPNSYLNTN-------LIAN-RTSSETTLSTAQPILNDIAARQSEVDDKATMVAYGEG 242

Query: 245 IDCVPIVSDQNYYKLA-----INSVSSFSDFLKD---PKLFKMLQLSLFPLNPEITADKF 296
           I  +    D+   + +     + S+ +  D L D         ++L++     E +A   
Sbjct: 243 IVSIQAAIDEALVRQSEPGADVASIQTEIDVLTDGLHTTYRNFIELAMIDFREEESA--L 300

Query: 297 LTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQ---------QDSQIQKMLDLYKKNCQI 347
           +    EN P ++ ++    + +  D  +   I          + S+ Q+  DL     QI
Sbjct: 301 IADGLENSPEMTALRNKIDV-WTADTDARWTISTSLNEIVELEASKTQEGADLAAIQSQI 359

Query: 348 LHDDKMQSLIKDYQLPLGKIKS-IDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
              D ++  I   +  L    S ID+ ++ K                  A+ AY  ++ +
Sbjct: 360 ---DALRVTITGAEANLTLTTSDIDDAVAAK----------------DVAIAAYT-DLPE 399

Query: 407 L--DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
           L  D +QL   L ++ +   +Y N +  D+ + L +A+NFN DG++ P    Q+   +  
Sbjct: 400 LGDDTNQLAAQLNTDVAAARNYINAT--DKYLALAYAYNFNDDGTV-PAGGFQTEAELEA 456

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE---INSEVDYYTLNINTIHSFEELL 521
             + Y                    +++Q R+ L    +N   DY+   I +  + EE++
Sbjct: 457 TTELY--------------------VTSQDRLTLTGAMLND--DYFRETIGSFTTAEEMM 494

Query: 522 ANKRILNFLLESKGIDS 538
            ++RI+++L  +  +D+
Sbjct: 495 EDERIVSYLKSAFNLDT 511



 Score = 85.1 bits (209), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 146/322 (45%), Gaps = 31/322 (9%)

Query: 2   IPSHVAPFPSKD---IQSKLFSTVSKDPIVSCEERYYRERIKHI------STIDEFIKDK 52
           +P  + P  +++   + S+ FS        + +E   R +I  +      +T+++     
Sbjct: 568 LPDGLQPVDAENQSVLSSRYFSGYDDADEAADQEAIRRMQIDLVGLNTEGATVEDLFNSS 627

Query: 53  RLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-----S 107
            ++S+A++A  L      ++ ++K+L SDL DP S V  L   +Y  FA  ++F     +
Sbjct: 628 AVYSFAMQAAELDPNEIPQRIMRKVLTSDLQDPNSYVYTLKDERYVKFANLFNFDSEGVA 687

Query: 108 PPPKVIQSDIQHKTIIQDY---KQSHQHKEEVALE------ESKYFRKNIHKINSVDQLF 158
             P   Q   +   I +DY   K      EE A        E+ Y+++ +  I ++DQL 
Sbjct: 688 TAPLTAQDQARMDDISRDYIVQKTRFLTGEEAATARSDAEAEASYYQRTVSNIETLDQLL 747

Query: 159 KDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPD 218
            +RRL+D+ L +  I P+ +S   L+ +    L +P  Y     D R   +  +F F   
Sbjct: 748 GNRRLIDFALTAKGIDPETVSNDELQLLFRSDLDDPDSYANTVSDFRLTEVVTSFNFDEA 807

Query: 219 GSLSKRD--KILTDMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFL 271
           G L +RD  +I +   + + ++ Y   TI+      D       Y++    +++S  D L
Sbjct: 808 GKLMQRDAAEISSRGDLYETMNLYLRQTIELERGEEDNGVRLALYFERMAPTITSVYDIL 867

Query: 272 KDPKLFKMLQLSLFPLNPEITA 293
            D  L+++ + ++F L  EI+ 
Sbjct: 868 GDTALYEVFK-TIFSLPDEISG 888



 Score = 67.8 bits (164), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 117/271 (43%), Gaps = 56/271 (20%)

Query: 412 LRNVLTSNPSDPDS----------YANKSKDDRLIKLNHAFNFNADGSI--GPIPMMQSR 459
           L N +TS  +D D           +  K   D L+ L+ AFNF  DG++  G  P+    
Sbjct: 520 LENAITSPATDADLEDETNYLVAFHKGKPYFDDLVALSRAFNFEEDGTLPDGLQPV---- 575

Query: 460 LTIRDNVKHYANRKRSIHDAENKS---------FNSMEQISTQKRINLEINSEVDYYTLN 510
                             DAEN+S         ++  ++ + Q+ I      ++D   LN
Sbjct: 576 ------------------DAENQSVLSSRYFSGYDDADEAADQEAIR---RMQIDLVGLN 614

Query: 511 INTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYK 570
                + E+L  +  + +F +++  +D  ++ +  + ++  SDL+DP S+  T KD RY 
Sbjct: 615 TEG-ATVEDLFNSSAVYSFAMQAAELDPNEIPQRIMRKVLTSDLQDPNSYVYTLKDERYV 673

Query: 571 EIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMI-----EKKEEEKDPNIALAL 625
           +  + FNFD  G  +       QD   +DD    Y  Q       E+    +    A A 
Sbjct: 674 KFANLFNFDSEGVATAPL--TAQDQARMDDISRDYIVQKTRFLTGEEAATARSDAEAEAS 731

Query: 626 YFKRTIPNIRNHYEILGDSKL--FKVVSKKL 654
           Y++RT+ NI    ++LG+ +L  F + +K +
Sbjct: 732 YYQRTVSNIETLDQLLGNRRLIDFALTAKGI 762



 Score = 65.5 bits (158), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 68/149 (45%), Gaps = 25/149 (16%)

Query: 415 VLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKR 474
           VL S+ SD DSYAN+  D R      AF F  DGS  P+ + Q    I + +  Y     
Sbjct: 77  VLESDLSDSDSYANRLTDSRYRDFAAAFQFE-DGSKVPMSVNQ----IDEAIGLYDETVA 131

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S+ D                    +I+ EV+YY      + + ++ LA+ R+ +F+ +S 
Sbjct: 132 SLDD--------------------KISGEVNYYNAMAGLVENVDQFLADPRLFDFITQSY 171

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANT 563
           GID   V   FL  I  SD  DP S+ NT
Sbjct: 172 GIDGSTVDRTFLRGILASDPDDPNSYLNT 200



 Score = 57.4 bits (137), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 54/93 (58%), Gaps = 4/93 (4%)

Query: 487 MEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL 546
           M ++S Q     +++ E  Y+  NI  + S EE + + R+ ++ +++ G++     E F+
Sbjct: 19  MNRVSQQT----QVSRETAYFKENIGKVRSAEEFVGDYRLYSYAMKAHGLEDMIYAEAFM 74

Query: 547 CEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
            ++ +SDL D  S+AN   D+RY++  ++F F+
Sbjct: 75  LKVLESDLSDSDSYANRLTDSRYRDFAAAFQFE 107



 Score = 55.8 bits (133), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/186 (23%), Positives = 83/186 (44%), Gaps = 20/186 (10%)

Query: 30  CEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLV 89
            E  YY+  + +I T+D+ + ++RL  +AL A G+   + +   ++ +  SDL DP S  
Sbjct: 728 AEASYYQRTVSNIETLDQLLGNRRLIDFALTAKGIDPETVSNDELQLLFRSDLDDPDSYA 787

Query: 90  NQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQS-----------HQHKEEVAL 138
           N ++  +      S++F    K++Q D    +   D  ++            + +E+  +
Sbjct: 788 NTVSDFRLTEVVTSFNFDEAGKLMQRDAAEISSRGDLYETMNLYLRQTIELERGEEDNGV 847

Query: 139 EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS-------LPFLKDVLTLG- 190
             + YF +    I SV  +  D  L +     FS+ P  IS          L+D + +  
Sbjct: 848 RLALYFERMAPTITSVYDILGDTALYEVFKTIFSL-PDEISGMSVDSQAALLEDRMDMAD 906

Query: 191 LANPKK 196
           LA+P+K
Sbjct: 907 LADPEK 912



 Score = 55.1 bits (131), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 86/416 (20%), Positives = 168/416 (40%), Gaps = 59/416 (14%)

Query: 78  LESDLSDPKSLVNQLNSLKYQYFARSYDF----SPPPKVIQSDIQHKTIIQDYKQSHQHK 133
           L +D++  ++ +N  +  KY   A +Y+F    + P    Q++ + +   + Y  S    
Sbjct: 411 LNTDVAAARNYINATD--KYLALAYAYNFNDDGTVPAGGFQTEAELEATTELYVTSQDRL 468

Query: 134 E-EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI-TPKYISLPFLKDVLT--- 188
               A+    YFR+ I    + +++ +D R++ Y+  +F++ T   +    L++ +T   
Sbjct: 469 TLTGAMLNDDYFRETIGSFTTAEEMMEDERIVSYLKSAFNLDTYLTVVTSTLENAITSPA 528

Query: 189 --LGLANPKKYFIESRDNR-----FRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF 241
               L +   Y +     +       A++  F F+ DG+L    + +       + S YF
Sbjct: 529 TDADLEDETNYLVAFHKGKPYFDDLVALSRAFNFEEDGTLPDGLQPVDAENQSVLSSRYF 588

Query: 242 NNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN---------PEIT 292
           +   D       +   ++ I+ V   ++      LF    +  F +          P+  
Sbjct: 589 SGYDDADEAADQEAIRRMQIDLVGLNTEGATVEDLFNSSAVYSFAMQAAELDPNEIPQRI 648

Query: 293 ADKFLT--LMQENDPIVS-----QVKYFFQINFHRDNSSST-----------KIQQDSQI 334
             K LT  L   N  + +      VK+    NF  +  ++             I +D  +
Sbjct: 649 MRKVLTSDLQDPNSYVYTLKDERYVKFANLFNFDSEGVATAPLTAQDQARMDDISRDYIV 708

Query: 335 QKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQ 394
           QK   L  +       D  ++    YQ  +  I+++D LL G  +L            + 
Sbjct: 709 QKTRFLTGEEAATARSDA-EAEASYYQRTVSNIETLDQLL-GNRRL------------ID 754

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI 450
           FAL A  ++ + +  D+L+ +  S+  DPDSYAN   D RL ++  +FNF+  G +
Sbjct: 755 FALTAKGIDPETVSNDELQLLFRSDLDDPDSYANTVSDFRLTEVVTSFNFDEAGKL 810



 Score = 52.8 bits (125), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 137/305 (44%), Gaps = 38/305 (12%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS---LVN 90
           Y+RE I   +T +E ++D+R+ SY   AF L         +   LE+ ++ P +   L +
Sbjct: 479 YFRETIGSFTTAEEMMEDERIVSYLKSAFNLDTYL---TVVTSTLENAITSPATDADLED 535

Query: 91  QLNSL-----KYQYF------ARSYDF----SPPPKVIQSDIQHKTIIQD-YKQSHQHKE 134
           + N L        YF      +R+++F    + P  +   D ++++++   Y   +   +
Sbjct: 536 ETNYLVAFHKGKPYFDDLVALSRAFNFEEDGTLPDGLQPVDAENQSVLSSRYFSGYDDAD 595

Query: 135 EVALEES-KYFRKNIHKIN----SVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
           E A +E+ +  + ++  +N    +V+ LF    +  + +Q+  + P  I    ++ VLT 
Sbjct: 596 EAADQEAIRRMQIDLVGLNTEGATVEDLFNSSAVYSFAMQAAELDPNEIPQRIMRKVLTS 655

Query: 190 GLANPKKYFIESRDNRFRAMAENFRFQPDGS----LSKRDKI-LTDMQIEKIVS-NYFNN 243
            L +P  Y    +D R+   A  F F  +G     L+ +D+  + D+  + IV    F  
Sbjct: 656 DLQDPNSYVYTLKDERYVKFANLFNFDSEGVATAPLTAQDQARMDDISRDYIVQKTRFLT 715

Query: 244 TIDCVPIVSD----QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
             +     SD     +YY+  ++++ +    L + +L     L+   ++PE  ++  L L
Sbjct: 716 GEEAATARSDAEAEASYYQRTVSNIETLDQLLGNRRLID-FALTAKGIDPETVSNDELQL 774

Query: 300 MQEND 304
           +  +D
Sbjct: 775 LFRSD 779


>gi|90423974|ref|YP_532344.1| hypothetical protein RPC_2474 [Rhodopseudomonas palustris BisB18]
 gi|90105988|gb|ABD88025.1| protein of unknown function DUF1217 [Rhodopseudomonas palustris
           BisB18]
          Length = 801

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 130/509 (25%), Positives = 233/509 (45%), Gaps = 57/509 (11%)

Query: 209 MAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS--DQNYYKLAINSVSS 266
           +A  F F PDG+L+      TD   +     +  +     P  +  ++ +++  I    +
Sbjct: 279 LAGAFEFSPDGTLAAGVSAQTDASRKTTNERFITSQPRTSPSTALLEKQFFQQKIAGART 338

Query: 267 FSDFLKDP----------KLFKMLQLSLFPLNPEITADK--------FLTLMQENDPIVS 308
               L  P            F +  L L  +   +T+D+          +   + D    
Sbjct: 339 VDQLLAAPDAARVASFIGTAFGLGTLPLSTIKSILTSDRDPNNPNSYVNSAGSKKDAYTR 398

Query: 309 QVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS----LIKDYQL 362
            +K F   NF++D +  +    Q ++Q    +  Y     + ++D  ++     I+ ++ 
Sbjct: 399 LMKAF---NFNQDGTLDAGVDAQSETQTATTVGYY----MVAYNDADEASDKLAIQRFRN 451

Query: 363 PLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSD 422
            +  I SI+  +S             P +   FAL +  L+   +    ++  L S+ S+
Sbjct: 452 GVYSITSIEKFVS------------TPAV-YNFALKSVGLDPDSVSAITVKAALESDLSN 498

Query: 423 PDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENK 482
           P SY    KD+R ++L  +FNF++ G +    + Q    + +  K Y   K     A +K
Sbjct: 499 PRSYVYTLKDERYVQLARSFNFDSKGHLTTPLVAQDTAEVGNIAKDYVIAKTKFATAADK 558

Query: 483 SFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVR 542
           +       + QK      N  V+Y +  I  + S  ELL++K+++NF+L +KG+D +KV 
Sbjct: 559 A-------TLQKTAE---NDAVEYRS-KIAGVDSVAELLSDKKLVNFILVAKGLDPKKVT 607

Query: 543 EDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTC 602
            D L +I  SDL DPKSFANT  D R+ E+ +SFNFD  G+++   +   Q+   + +T 
Sbjct: 608 PDTLKKILSSDLSDPKSFANTASDTRFAELAASFNFDKTGKVARFVVAGPQNREQLLETQ 667

Query: 603 DLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAV 662
             Y  Q +E ++   +P + LALYF+R  P+I + Y+IL D  L +VV     L    A 
Sbjct: 668 TKYLQQSLEAQQGGANPGVRLALYFQRKAPDITSAYDILADKALSEVVRTTYNLPDSMAN 727

Query: 663 LPERKKIRILKKHIKINDFKDSKKVEDFL 691
            P  ++ +I++K++K+ D  D  ++   L
Sbjct: 728 APIEQQAKIVEKYLKLKDLSDPAQLAKIL 756



 Score =  126 bits (316), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 103/177 (58%), Gaps = 1/177 (0%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           V+K   V+ E  YY++ I  + T+D+ +K+ RL+ YA+KA+GL DM+ A+ F++K+LESD
Sbjct: 22  VAKQTDVTREAAYYKDNIGKVKTVDDLLKNDRLYRYAMKAYGLEDMTFAKAFMRKVLESD 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFS-PPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           LSD KS  N+L   +Y+ FA ++ F+       QS  Q   ++  Y  + Q + +   E+
Sbjct: 82  LSDTKSFANKLTDKRYREFASAFSFTGGTTAAAQSSYQTDEMVGLYTATLQRQADAVGED 141

Query: 141 SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY 197
           ++Y+   I  + +VDQL  D RL  YV  +F I   + S   L+ VL+   ++P  Y
Sbjct: 142 TRYYNAKIGSVTTVDQLLNDDRLRGYVFSAFGIDEDHWSRDTLRKVLSSDSSDPNSY 198



 Score = 92.4 bits (228), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 106/203 (52%), Gaps = 14/203 (6%)

Query: 35  YRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNS 94
           +R  +  I++I++F+    ++++ALK+ GL   S +   +K  LESDLS+P+S V  L  
Sbjct: 449 FRNGVYSITSIEKFVSTPAVYNFALKSVGLDPDSVSAITVKAALESDLSNPRSYVYTLKD 508

Query: 95  LKYQYFARSYDFS-----PPPKVIQSDIQHKTIIQDY---------KQSHQHKEEVALEE 140
            +Y   ARS++F        P V Q   +   I +DY                ++ A  +
Sbjct: 509 ERYVQLARSFNFDSKGHLTTPLVAQDTAEVGNIAKDYVIAKTKFATAADKATLQKTAEND 568

Query: 141 SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
           +  +R  I  ++SV +L  D++L++++L +  + PK ++   LK +L+  L++PK +   
Sbjct: 569 AVEYRSKIAGVDSVAELLSDKKLVNFILVAKGLDPKKVTPDTLKKILSSDLSDPKSFANT 628

Query: 201 SRDNRFRAMAENFRFQPDGSLSK 223
           + D RF  +A +F F   G +++
Sbjct: 629 ASDTRFAELAASFNFDKTGKVAR 651



 Score = 68.2 bits (165), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 71/148 (47%), Gaps = 10/148 (6%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  E  YY  NI  + + ++LL N R+  + +++ G++     + F+ ++ +SDL D K
Sbjct: 27  DVTREAAYYKDNIGKVKTVDDLLKNDRLYRYAMKAYGLEDMTFAKAFMRKVLESDLSDTK 86

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           SFAN   D RY+E  S+F+F      +       Q ++  D+   LY   +    + + D
Sbjct: 87  SFANKLTDKRYREFASAFSF------TGGTTAAAQSSYQTDEMVGLYTATL----QRQAD 136

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKL 646
                  Y+   I ++    ++L D +L
Sbjct: 137 AVGEDTRYYNAKIGSVTTVDQLLNDDRL 164



 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 83/203 (40%), Gaps = 37/203 (18%)

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +GK+K++D+LL                   ++A+ AY L      +  +R VL S+
Sbjct: 35  YKDNIGKVKTVDDLLKNDR-------------LYRYAMKAYGLEDMTFAKAFMRKVLESD 81

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            SD  S+ANK  D R  +   AF+F      G     QS     + V  Y          
Sbjct: 82  LSDTKSFANKLTDKRYREFASAFSFTG----GTTAAAQSSYQTDEMVGLY---------- 127

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
                      +T +R    +  +  YY   I ++ + ++LL + R+  ++  + GID  
Sbjct: 128 ----------TATLQRQADAVGEDTRYYNAKIGSVTTVDQLLNDDRLRGYVFSAFGIDED 177

Query: 540 KVREDFLCEIFKSDLKDPKSFAN 562
               D L ++  SD  DP S+ N
Sbjct: 178 HWSRDTLRKVLSSDSSDPNSYVN 200



 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 83/405 (20%), Positives = 172/405 (42%), Gaps = 41/405 (10%)

Query: 78  LESDLSDPKSLVNQLNSLKYQY-FARSYDFSPPPKVI-----QSDIQHKTIIQDYKQSH- 130
           L    +D  S    + ++ + +  A +++FSP   +      Q+D   KT  + +  S  
Sbjct: 256 LGKTAADISSYTGSITAISHYFDLAGAFEFSPDGTLAAGVSAQTDASRKTTNERFITSQP 315

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKD---RRLLDYVLQSFSITPKYISLPFLKDVL 187
           +     AL E ++F++ I    +VDQL       R+  ++  +F +    + L  +K +L
Sbjct: 316 RTSPSTALLEKQFFQQKIAGARTVDQLLAAPDAARVASFIGTAFGLGT--LPLSTIKSIL 373

Query: 188 TLGL--ANPKKYF--IESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY--- 240
           T      NP  Y     S+ + +  + + F F  DG+L       ++ Q    V  Y   
Sbjct: 374 TSDRDPNNPNSYVNSAGSKKDAYTRLMKAFNFNQDGTLDAGVDAQSETQTATTVGYYMVA 433

Query: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM 300
           +N+  +    ++ Q + +  + S++S   F+  P ++    L    L+P+  +   +   
Sbjct: 434 YNDADEASDKLAIQRF-RNGVYSITSIEKFVSTPAVYN-FALKSVGLDPDSVSAITVKAA 491

Query: 301 QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY 360
            E+D + +   Y + +   R    +     DS+      L  ++       ++ ++ KDY
Sbjct: 492 LESD-LSNPRSYVYTLKDERYVQLARSFNFDSKGHLTTPLVAQDTA-----EVGNIAKDY 545

Query: 361 QLPLGKIKSI-----------DNLLSGKCQLEGPNSAEEPII---TLQFALDAYNLNMQD 406
            +   K  +            ++ +  + ++ G +S  E +     + F L A  L+ + 
Sbjct: 546 VIAKTKFATAADKATLQKTAENDAVEYRSKIAGVDSVAELLSDKKLVNFILVAKGLDPKK 605

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIG 451
           +  D L+ +L+S+ SDP S+AN + D R  +L  +FNF+  G + 
Sbjct: 606 VTPDTLKKILSSDLSDPKSFANTASDTRFAELAASFNFDKTGKVA 650



 Score = 60.1 bits (144), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 78/167 (46%), Gaps = 5/167 (2%)

Query: 112 VIQSDIQHKTIIQDYKQS--HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ + + +  + ++ KQS     K+     E+ Y++ NI K+ +VD L K+ RL  Y ++
Sbjct: 1   MVSTYLSYDLVARNLKQSLTRVAKQTDVTREAAYYKDNIGKVKTVDDLLKNDRLYRYAMK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           ++ +     +  F++ VL   L++ K +  +  D R+R  A  F F    + + +    T
Sbjct: 61  AYGLEDMTFAKAFMRKVLESDLSDTKSFANKLTDKRYREFASAFSFTGGTTAAAQSSYQT 120

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKL 276
           D ++  + +       D V    D  YY   I SV++    L D +L
Sbjct: 121 D-EMVGLYTATLQRQADAVG--EDTRYYNAKIGSVTTVDQLLNDDRL 164



 Score = 58.2 bits (139), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 73/159 (45%), Gaps = 11/159 (6%)

Query: 35  YRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNS 94
           YR +I  + ++ E + DK+L ++ L A GL         +KKIL SDLSDPKS  N  + 
Sbjct: 572 YRSKIAGVDSVAELLSDKKLVNFILVAKGLDPKKVTPDTLKKILSSDLSDPKSFANTASD 631

Query: 95  LKYQYFARSYDFSPPPKV---IQSDIQHKT--------IIQDYKQSHQHKEEVALEESKY 143
            ++   A S++F    KV   + +  Q++          +Q   ++ Q      +  + Y
Sbjct: 632 TRFAELAASFNFDKTGKVARFVVAGPQNREQLLETQTKYLQQSLEAQQGGANPGVRLALY 691

Query: 144 FRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
           F++    I S   +  D+ L + V  ++++     + P 
Sbjct: 692 FQRKAPDITSAYDILADKALSEVVRTTYNLPDSMANAPI 730



 Score = 55.5 bits (132), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 38/65 (58%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           V  + RYY  +I  ++T+D+ + D RL  Y   AFG+ +   +   ++K+L SD SDP S
Sbjct: 138 VGEDTRYYNAKIGSVTTVDQLLNDDRLRGYVFSAFGIDEDHWSRDTLRKVLSSDSSDPNS 197

Query: 88  LVNQL 92
            VN +
Sbjct: 198 YVNAV 202


>gi|218459363|ref|ZP_03499454.1| hypothetical protein RetlK5_07677 [Rhizobium etli Kim 5]
          Length = 332

 Score =  158 bits (400), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/302 (29%), Positives = 156/302 (51%), Gaps = 10/302 (3%)

Query: 396 ALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPM 455
           AL A+ L  QD+ R  +R +LTS+  DPD Y    KD+R+  L  AFNF  DG       
Sbjct: 21  ALQAFGLTDQDVPRSMMRKILTSDAYDPDGYIASLKDERITNLARAFNFGPDGKAASPFQ 80

Query: 456 MQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIH 515
                T+      Y      +          ++    + + + +  +EVDY+   +  + 
Sbjct: 81  ALPDATLAKYATDYKAHMTML----------LKAGPVKDKASKDATAEVDYFAKGMAKVK 130

Query: 516 SFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISS 575
           S ++ L + R+ + +L++  +D +   +  L +IF SD  D KS+ N+  D R+++I+++
Sbjct: 131 SLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNSKADARFQDIVAA 190

Query: 576 FNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIR 635
           FNFD  G L+  KIG +Q+    ++T +LY  Q +E ++ E +  + LALYF R  P+I 
Sbjct: 191 FNFDKDGNLTRAKIGTIQNKAAEENTQELYVRQTLEAQQGETNDGVRLALYFSRKAPSIT 250

Query: 636 NHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAK 695
           + Y ILGD  L++V++    L    + +   K+  ++ + +K+ D +D KKV+  L    
Sbjct: 251 SIYSILGDKALYQVITTAYSLPAQISSMDVTKQADLINRFVKLEDLQDPKKVDKLLRRFT 310

Query: 696 AM 697
           AM
Sbjct: 311 AM 312



 Score = 75.5 bits (184), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 85/190 (44%), Gaps = 16/190 (8%)

Query: 55  FSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ 114
           +  AL+AFGL+D       ++KIL SD  DP   +  L   +    AR+++F P  K   
Sbjct: 18  YHVALQAFGLTDQDVPRSMMRKILTSDAYDPDGYIASLKDERITNLARAFNFGPDGKAAS 77

Query: 115 S-----DIQHKTIIQDYK-------QSHQHKEEV---ALEESKYFRKNIHKINSVDQLFK 159
                 D        DYK       ++   K++    A  E  YF K + K+ S+D    
Sbjct: 78  PFQALPDATLAKYATDYKAHMTMLLKAGPVKDKASKDATAEVDYFAKGMAKVKSLDDFLD 137

Query: 160 DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG 219
           D RL D VL++ ++ PK      LK + T    + K Y     D RF+ +   F F  DG
Sbjct: 138 DSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNSKADARFQDIVAAFNFDKDG 197

Query: 220 SLSKRDKILT 229
           +L+ R KI T
Sbjct: 198 NLT-RAKIGT 206



 Score = 47.8 bits (112), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 89/206 (43%), Gaps = 22/206 (10%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
            SKD   + E  Y+ + +  + ++D+F+ D RL    LKA  L    + +  +KKI  SD
Sbjct: 111 ASKD--ATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSD 168

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS---DIQHKTI--------IQDYKQSH 130
             D KS +N     ++Q    +++F     + ++    IQ+K          ++   ++ 
Sbjct: 169 PDDKKSYLNSKADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEENTQELYVRQTLEAQ 228

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
           Q +    +  + YF +    I S+  +  D+ L   +  ++S+  +  S+   K    + 
Sbjct: 229 QGETNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVTKQADLIN 288

Query: 191 -------LANPKKYFIESRDNRFRAM 209
                  L +PKK  ++    RF AM
Sbjct: 289 RFVKLEDLQDPKK--VDKLLRRFTAM 312



 Score = 43.5 bits (101), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 85/204 (41%), Gaps = 38/204 (18%)

Query: 364 LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
           + K+KS+D+ L            ++  +T    L A NL+ +D D+  L+ + TS+P D 
Sbjct: 126 MAKVKSLDDFL------------DDSRLT-DLVLKANNLDPKDYDKATLKKIFTSDPDDK 172

Query: 424 DSYANKSKDDRLIKLNHAFNFNADGSI--GPIPMMQSRLTIRDNVKHYANRKRSIHDAEN 481
            SY N   D R   +  AFNF+ DG++    I  +Q++    +  + Y  +       E 
Sbjct: 173 KSYLNSKADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEENTQELYVRQTLEAQQGE- 231

Query: 482 KSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ-- 539
                     T   + L +     Y++    +I S   +L +K +   +  +  + +Q  
Sbjct: 232 ----------TNDGVRLAL-----YFSRKAPSITSIYSILGDKALYQVITTAYSLPAQIS 276

Query: 540 ----KVREDFLCEIFK-SDLKDPK 558
                 + D +    K  DL+DPK
Sbjct: 277 SMDVTKQADLINRFVKLEDLQDPK 300


>gi|218680748|ref|ZP_03528645.1| hypothetical protein RetlC8_18559 [Rhizobium etli CIAT 894]
          Length = 262

 Score =  154 bits (389), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 143/241 (59%), Gaps = 4/241 (1%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ ++V+    ++++ + L S V+    VS +  YY+E I  ++T+DEF+ D +L+SYA+
Sbjct: 1   MVSTYVSYLAVARNLNTSL-SNVASQATVSRDSAYYKENIDKVTTVDEFMGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ FS   K  QSD+Q 
Sbjct: 60  KAYGLDDMTYAKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGETKTAQSDVQR 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             ++  Y+ S   + E   +E+ YF +NI  I SVD      RL +Y L +F ++ +Y S
Sbjct: 120 DNLLDAYETSFDTEAENIADETDYFEENISSITSVDDFLSSSRLKNYALTAFGLSTEYTS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLK VLT  L +P  +  +  D+ + ++A+ F F  DGS      ++++ QI  + S 
Sbjct: 180 SSFLKQVLTSDLDDPDSFVNQLGDDVYVSLAKAFNFNEDGSTDG--DVMSEDQISLVTSG 237

Query: 240 Y 240
           Y
Sbjct: 238 Y 238



 Score = 68.6 bits (166), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 97/209 (46%), Gaps = 30/209 (14%)

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
           +A+ AY L+     +  ++ VL S+ SD  S+AN   D R  +   AF F+     G   
Sbjct: 57  YAMKAYGLDDMTYAKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFS-----GETK 111

Query: 455 MMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTI 514
             QS +  RDN          + DA   SF++  +          I  E DY+  NI++I
Sbjct: 112 TAQSDVQ-RDN----------LLDAYETSFDTEAE---------NIADETDYFEENISSI 151

Query: 515 HSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
            S ++ L++ R+ N+ L + G+ ++     FL ++  SDL DP SF N   D+ Y  +  
Sbjct: 152 TSVDDFLSSSRLKNYALTAFGLSTEYTSSSFLKQVLTSDLDDPDSFVNQLGDDVYVSLAK 211

Query: 575 SFNFDIHGE-----LSHKKIGKVQDNFHI 598
           +FNF+  G      +S  +I  V   + +
Sbjct: 212 AFNFNEDGSTDGDVMSEDQISLVTSGYAV 240



 Score = 58.2 bits (139), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 111/244 (45%), Gaps = 31/244 (12%)

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
           + + + ++   +N      +  D  YYK  I+ V++  +F+ D KL+    +  + L+  
Sbjct: 9   LAVARNLNTSLSNVASQATVSRDSAYYKENIDKVTTVDEFMGDYKLYS-YAMKAYGLDDM 67

Query: 291 ITADKFLTLMQENDPI--------VSQVKYF-FQINFHRDNSSSTKIQQDSQIQKMLDLY 341
             A  F+  + E+D          +S  +Y  F   F     + T  Q D Q   +LD Y
Sbjct: 68  TYAKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGETKTA-QSDVQRDNLLDAY 126

Query: 342 KKNCQILHDDKMQSLIKD---YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
           + +     D + +++  +   ++  +  I S+D+ LS   +L+             +AL 
Sbjct: 127 ETS----FDTEAENIADETDYFEENISSITSVDDFLS-SSRLK------------NYALT 169

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQS 458
           A+ L+ +      L+ VLTS+  DPDS+ N+  DD  + L  AFNFN DGS     M + 
Sbjct: 170 AFGLSTEYTSSSFLKQVLTSDLDDPDSFVNQLGDDVYVSLAKAFNFNEDGSTDGDVMSED 229

Query: 459 RLTI 462
           ++++
Sbjct: 230 QISL 233



 Score = 45.1 bits (105), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 69/141 (48%), Gaps = 11/141 (7%)

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK 565
           YY  NI+ + + +E + + ++ ++ +++ G+D     + F+ ++ +SDL D  SFAN+  
Sbjct: 34  YYKENIDKVTTVDEFMGDYKLYSYAMKAYGLDDMTYAKAFMKKVLESDLSDSSSFANSLS 93

Query: 566 DNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALAL 625
           D+RY E  ++F F   GE         Q +   D+  D Y+     + E   D       
Sbjct: 94  DSRYAEFAAAFKF--SGETK-----TAQSDVQRDNLLDAYETSFDTEAENIADETD---- 142

Query: 626 YFKRTIPNIRNHYEILGDSKL 646
           YF+  I +I +  + L  S+L
Sbjct: 143 YFEENISSITSVDDFLSSSRL 163


>gi|260466626|ref|ZP_05812814.1| protein of unknown function DUF1217 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029632|gb|EEW30920.1| protein of unknown function DUF1217 [Mesorhizobium opportunistum
           WSM2075]
          Length = 373

 Score =  132 bits (333), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 142/299 (47%), Gaps = 25/299 (8%)

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGP 452
            ++A+ AY L   D  +  +   L    +DPDS+ANK  D R  +   AFNF A+G+   
Sbjct: 55  FKYAMKAYGLEDMDYAKAFMVKALKEGVTDPDSFANKLTDKRYAQFVSAFNFAANGADAT 114

Query: 453 IPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNIN 512
           I     +L +    K+YA + +      N  +               +  E  YY  NI 
Sbjct: 115 IYNKAQQLVM----KNYATQAQIAGLDPNSDY---------------VKGETTYYLANIT 155

Query: 513 TIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEI 572
            + S ++L++N R+  + L + G+DS    +D + ++ +S + DP S AN   +  Y  +
Sbjct: 156 KVKSVDDLMSNSRLYTYALAAYGLDSATEDKDLIKQVLQSKVSDPDSVANKQTNPAYAGL 215

Query: 573 ISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIP 632
             +FNF+ +GE +   I   Q       T D Y  Q +E+   + +  + LALYF+R  P
Sbjct: 216 ALAFNFEANGE-NATTISPAQ-----QPTVDKYLRQTLEEDAGQTNQGVRLALYFQRKAP 269

Query: 633 NIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
           +I + Y++L D+ L  VV   L L   FA     K+ ++ ++ + + DF D  K+  FL
Sbjct: 270 DITSWYDVLADTALASVVRTALGLPDSFATANIDKQAQLFEQKLDLTDFTDPAKLTKFL 328



 Score =  103 bits (258), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 138/286 (48%), Gaps = 18/286 (6%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++DI SK    + K P V  + +YY   I  + +ID+F+K+ RLF YA+KA+GL DM +A
Sbjct: 12  TRDI-SKSIDRIEKQPTVDRDTQYYLANITKVKSIDDFVKNDRLFKYAMKAYGLEDMDYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP--PPKVIQSDIQHKTIIQDYKQ 128
           + F+ K L+  ++DP S  N+L   +Y  F  +++F+       I +  Q   ++++Y  
Sbjct: 71  KAFMVKALKEGVTDPDSFANKLTDKRYAQFVSAFNFAANGADATIYNKAQQ-LVMKNYAT 129

Query: 129 SHQ-----HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
             Q        +    E+ Y+  NI K+ SVD L  + RL  Y L ++ +         +
Sbjct: 130 QAQIAGLDPNSDYVKGETTYYLANITKVKSVDDLMSNSRLYTYALAAYGLDSATEDKDLI 189

Query: 184 KDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNN 243
           K VL   +++P     +  +  +  +A  F F+ +G   +    ++  Q +  V  Y   
Sbjct: 190 KQVLQSKVSDPDSVANKQTNPAYAGLALAFNFEANG---ENATTISPAQ-QPTVDKYLRQ 245

Query: 244 TIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           T++     ++Q      Y++     ++S+ D L D  L  +++ +L
Sbjct: 246 TLEEDAGQTNQGVRLALYFQRKAPDITSWYDVLADTALASVVRTAL 291



 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 46/83 (55%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           ++ +  YY  NI  + S ++ + N R+  + +++ G++     + F+ +  K  + DP S
Sbjct: 28  VDRDTQYYLANITKVKSIDDFVKNDRLFKYAMKAYGLEDMDYAKAFMVKALKEGVTDPDS 87

Query: 560 FANTYKDNRYKEIISSFNFDIHG 582
           FAN   D RY + +S+FNF  +G
Sbjct: 88  FANKLTDKRYAQFVSAFNFAANG 110


>gi|12214188|emb|CAC21603.1| unnamed protein product [Sinorhizobium meliloti]
          Length = 315

 Score =  112 bits (281), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 104/206 (50%), Gaps = 10/206 (4%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           S+E++S Q     ++  E +YY   I +I + ++  A+ R+ N+ +++ G++     + F
Sbjct: 74  SLERVSAQP----DVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAF 129

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++    +    +FAN   D RYK ++ S NF  HGE +     + Q         + Y
Sbjct: 130 MRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGE-AATAFERAQKG-----VAEKY 183

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
             Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV   L+L   FA    
Sbjct: 184 TRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLPAEFAAADV 243

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFL 691
            ++    +  I   DF+D +K+ +FL
Sbjct: 244 DRQAEAYEAAIDFKDFQDPQKIAEFL 269



 Score = 72.4 bits (176), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 72/135 (53%), Gaps = 3/135 (2%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           +K    VS  P V+ E  YY  +I  I T+D+F  D RL++YA+KA GL DM++A+ F++
Sbjct: 72  TKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAFMR 131

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQHKTIIQDYKQSHQHKE 134
           K+L   +    +  N+L   +Y+    S +F+   +   + +   K + + Y  + Q  E
Sbjct: 132 KVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQKGVAEKY--TRQTLE 189

Query: 135 EVALEESKYFRKNIH 149
           + A EE+   R  ++
Sbjct: 190 QKAGEENTGVRLALY 204



 Score = 42.7 bits (99), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 56/116 (48%), Gaps = 4/116 (3%)

Query: 110 PKVIQSDIQHKTIIQDYKQSHQH---KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDY 166
           P V  +   ++ I  D  +S +    + +VA  E++Y+   I  I ++D  F D RL +Y
Sbjct: 55  PIVTTTYTSYRLITADLTKSLERVSAQPDVA-RETEYYLSKIGSIKTLDDFFADSRLYNY 113

Query: 167 VLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLS 222
            +++  +     +  F++ VL  G+ +   +  +  D R++A+ E+  F   G  +
Sbjct: 114 AMKAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAA 169


>gi|115523169|ref|YP_780080.1| hypothetical protein RPE_1148 [Rhodopseudomonas palustris BisA53]
 gi|115517116|gb|ABJ05100.1| protein of unknown function DUF1217 [Rhodopseudomonas palustris
           BisA53]
          Length = 257

 Score =  112 bits (279), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 98/193 (50%), Gaps = 6/193 (3%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           +++ E  YY  +I+ + S E+ + + R+ ++ +++ G+      + FL ++    + DP 
Sbjct: 27  DVSHETTYYLAHIHNVTSVEQFVGDFRLFSYAMKAYGLADMTYAKAFLRKVLTEGVADPS 86

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           SFAN   D RY+E  ++FNF   GE + +             T + Y  Q +E+   E D
Sbjct: 87  SFANKLVDTRYREFAAAFNFASLGEQATRTTAAT------SGTVERYVRQSLEQDAGETD 140

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKI 678
             + LALYF+R  P ++  Y+IL D  L +V    L +SP  ++    ++  +L K I  
Sbjct: 141 QGVQLALYFERKAPTLKTAYQILADKALLQVAQTTLGISPLTSMASIDRQAAMLAKKIDF 200

Query: 679 NDFKDSKKVEDFL 691
           +DF+   K+  FL
Sbjct: 201 SDFQHPTKLRAFL 213



 Score = 95.9 bits (237), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 99/172 (57%), Gaps = 6/172 (3%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
           F ++++   L  T SK P VS E  YY   I +++++++F+ D RLFSYA+KA+GL+DM+
Sbjct: 10  FITQNLARSLAQTASK-PDVSHETTYYLAHIHNVTSVEQFVGDFRLFSYAMKAYGLADMT 68

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQDY- 126
           +A+ F++K+L   ++DP S  N+L   +Y+ FA +++F S   +  ++       ++ Y 
Sbjct: 69  YAKAFLRKVLTEGVADPSSFANKLVDTRYREFAAAFNFASLGEQATRTTAATSGTVERYV 128

Query: 127 KQSHQH---KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           +QS +    + +  ++ + YF +    + +  Q+  D+ LL     +  I+P
Sbjct: 129 RQSLEQDAGETDQGVQLALYFERKAPTLKTAYQILADKALLQVAQTTLGISP 180



 Score = 63.9 bits (154), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 75/163 (46%), Gaps = 11/163 (6%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           E+ Y+  +IH + SV+Q   D RL  Y ++++ +     +  FL+ VLT G+A+P  +  
Sbjct: 31  ETTYYLAHIHNVTSVEQFVGDFRLFSYAMKAYGLADMTYAKAFLRKVLTEGVADPSSFAN 90

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN---- 255
           +  D R+R  A  F F   G  + R    T   +E+    Y   +++     +DQ     
Sbjct: 91  KLVDTRYREFAAAFNFASLGEQATRTTAATSGTVER----YVRQSLEQDAGETDQGVQLA 146

Query: 256 -YYKLAINSVSSFSDFLKDPKLFKMLQ--LSLFPLNPEITADK 295
            Y++    ++ +    L D  L ++ Q  L + PL    + D+
Sbjct: 147 LYFERKAPTLKTAYQILADKALLQVAQTTLGISPLTSMASIDR 189



 Score = 42.7 bits (99), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 29/54 (53%)

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
           +A+ AY L      +  LR VLT   +DP S+ANK  D R  +   AFNF + G
Sbjct: 57  YAMKAYGLADMTYAKAFLRKVLTEGVADPSSFANKLVDTRYREFAAAFNFASLG 110


>gi|15964408|ref|NP_384761.1| hypothetical protein SMc03023 [Sinorhizobium meliloti 1021]
 gi|307318905|ref|ZP_07598336.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
 gi|15073585|emb|CAC45227.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306895319|gb|EFN26074.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
          Length = 259

 Score =  112 bits (279), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 104/206 (50%), Gaps = 10/206 (4%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           S+E++S Q     ++  E +YY   I +I + ++  A+ R+ N+ +++ G++     + F
Sbjct: 18  SLERVSAQP----DVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAF 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++    +    +FAN   D RYK ++ S NF  HGE +     + Q         + Y
Sbjct: 74  MRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGE-AATAFERAQKG-----VAEKY 127

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
             Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV   L+L   FA    
Sbjct: 128 TRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLPAEFAAADV 187

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFL 691
            ++    +  I   DF+D +K+ +FL
Sbjct: 188 DRQADAYEAAIDFKDFQDPQKIAEFL 213



 Score = 72.8 bits (177), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 72/135 (53%), Gaps = 3/135 (2%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           +K    VS  P V+ E  YY  +I  I T+D+F  D RL++YA+KA GL DM++A+ F++
Sbjct: 16  TKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAFMR 75

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQHKTIIQDYKQSHQHKE 134
           K+L   +    +  N+L   +Y+    S +F+   +   + +   K + + Y  + Q  E
Sbjct: 76  KVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQKGVAEKY--TRQTLE 133

Query: 135 EVALEESKYFRKNIH 149
           + A EE+   R  ++
Sbjct: 134 QKAGEENTGVRLALY 148



 Score = 43.1 bits (100), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           E++Y+   I  I ++D  F D RL +Y +++  +     +  F++ VL  G+ +   +  
Sbjct: 31  ETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAFMRKVLAEGIDSDDAFAN 90

Query: 200 ESRDNRFRAMAENFRFQPDG 219
           +  D R++A+ E+  F   G
Sbjct: 91  KLADGRYKALVESLNFARHG 110


>gi|307311550|ref|ZP_07591191.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
 gi|306899567|gb|EFN30196.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
          Length = 259

 Score =  111 bits (278), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 104/206 (50%), Gaps = 10/206 (4%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           S+E++S Q     ++  E +YY   I +I + ++  A+ R+ N+ +++ G++     + F
Sbjct: 18  SLERVSAQP----DVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAF 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++    +    +FAN   D RYK ++ S NF  HGE +     + Q         + Y
Sbjct: 74  MRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGE-AATAFERAQKG-----VAEKY 127

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
             Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV   L+L   FA    
Sbjct: 128 TRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLPAEFAAADV 187

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFL 691
            ++    +  I   DF+D +K+ +FL
Sbjct: 188 DRQADAYEAAIDFKDFQDPQKIAEFL 213



 Score = 72.8 bits (177), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 72/135 (53%), Gaps = 3/135 (2%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           +K    VS  P V+ E  YY  +I  I T+D+F  D RL++YA+KA GL DM++A+ F++
Sbjct: 16  TKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAFMR 75

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQHKTIIQDYKQSHQHKE 134
           K+L   +    +  N+L   +Y+    S +F+   +   + +   K + + Y  + Q  E
Sbjct: 76  KVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQKGVAEKY--TRQTLE 133

Query: 135 EVALEESKYFRKNIH 149
           + A EE+   R  ++
Sbjct: 134 QKAGEENTGVRLALY 148



 Score = 42.7 bits (99), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 41/80 (51%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           E++Y+   I  I ++D  F D RL +Y +++  +     +  F++ VL  G+ +   +  
Sbjct: 31  ETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAFMRKVLAEGIDSDDAFAN 90

Query: 200 ESRDNRFRAMAENFRFQPDG 219
           +  D R++A+ E+  F   G
Sbjct: 91  KLADGRYKALVESLNFARHG 110


>gi|218661874|ref|ZP_03517804.1| hypothetical protein RetlI_21473 [Rhizobium etli IE4771]
          Length = 133

 Score =  110 bits (276), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 54/130 (41%), Positives = 89/130 (68%), Gaps = 2/130 (1%)

Query: 1   MIPSHVA-PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  ++++D+F+ D +L+SYA+
Sbjct: 1   MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQS 129
             +I  YKQS
Sbjct: 120 DELIGLYKQS 129



 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 68/127 (53%), Gaps = 11/127 (8%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           +S+ ++++Q  +      +  YY  +IN + S ++ L + ++ ++ +++ G++     + 
Sbjct: 17  SSLNKVASQATVK----KDAQYYADHINKVTSVDDFLGDYKLYSYAMKAYGLEDMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +SDL DP S+AN   D RY+E  ++FNF+   +        VQ +   D+   L
Sbjct: 73  FMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNAPEK-------DVQTDAQEDELIGL 125

Query: 605 YKHQMIE 611
           YK   ++
Sbjct: 126 YKQSFVD 132



 Score = 49.3 bits (116), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 54/109 (49%), Gaps = 5/109 (4%)

Query: 139 EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYF 198
           ++++Y+  +I+K+ SVD    D +L  Y ++++ +     +  F+K VL   L +P  Y 
Sbjct: 30  KDAQYYADHINKVTSVDDFLGDYKLYSYAMKAYGLEDMTYAKAFMKKVLESDLTDPNSYA 89

Query: 199 IESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDC 247
            +  D R+R  A  F F      +    + TD Q ++++  Y  + +D 
Sbjct: 90  NKLSDARYREFAAAFNFN-----APEKDVQTDAQEDELIGLYKQSFVDA 133



 Score = 42.7 bits (99), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 13/83 (15%)

Query: 364 LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
           + K+ S+D+ L G  +L              +A+ AY L      +  ++ VL S+ +DP
Sbjct: 39  INKVTSVDDFL-GDYKL------------YSYAMKAYGLEDMTYAKAFMKKVLESDLTDP 85

Query: 424 DSYANKSKDDRLIKLNHAFNFNA 446
           +SYANK  D R  +   AFNFNA
Sbjct: 86  NSYANKLSDARYREFAAAFNFNA 108


>gi|150395478|ref|YP_001325945.1| hypothetical protein Smed_0251 [Sinorhizobium medicae WSM419]
 gi|150026993|gb|ABR59110.1| protein of unknown function DUF1217 [Sinorhizobium medicae WSM419]
          Length = 259

 Score =  110 bits (274), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 104/206 (50%), Gaps = 10/206 (4%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           S+E++S Q     ++  E +YY   I +I + +E  A+ R+ ++ +++ G++     + F
Sbjct: 18  SLERVSEQP----DVARETEYYLSKIGSIKTLDEFFADSRLYDYAMKAHGLEDMAYAKAF 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++    +    +FAN   D RYK ++ S NF  HGE +     + Q         + Y
Sbjct: 74  MRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGE-AATSFERAQKG-----VAEKY 127

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
             Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV   L+L   FA    
Sbjct: 128 TRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLPEEFAATDV 187

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFL 691
            ++    +  + + DF+D  KV +FL
Sbjct: 188 DRQAAAYESAVDLKDFQDPHKVAEFL 213



 Score = 74.3 bits (181), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 72/135 (53%), Gaps = 3/135 (2%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           +K    VS+ P V+ E  YY  +I  I T+DEF  D RL+ YA+KA GL DM++A+ F++
Sbjct: 16  TKSLERVSEQPDVARETEYYLSKIGSIKTLDEFFADSRLYDYAMKAHGLEDMAYAKAFMR 75

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQHKTIIQDYKQSHQHKE 134
           K+L   +    +  N+L   +Y+    S +F+   +   S +   K + + Y  + Q  E
Sbjct: 76  KVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGEAATSFERAQKGVAEKY--TRQTLE 133

Query: 135 EVALEESKYFRKNIH 149
           + A EE+   R  ++
Sbjct: 134 QKAGEENTGVRLALY 148



 Score = 44.7 bits (104), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 52/104 (50%), Gaps = 4/104 (3%)

Query: 119 HKTIIQDYKQSHQHKEE---VALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           +K I  D  +S +   E   VA  E++Y+   I  I ++D+ F D RL DY +++  +  
Sbjct: 8   YKLITADLTKSLERVSEQPDVA-RETEYYLSKIGSIKTLDEFFADSRLYDYAMKAHGLED 66

Query: 176 KYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG 219
              +  F++ VL  G+ +   +  +  D R++++ E+  F   G
Sbjct: 67  MAYAKAFMRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHG 110


>gi|323139683|ref|ZP_08074724.1| protein of unknown function DUF1217 [Methylocystis sp. ATCC 49242]
 gi|322395062|gb|EFX97622.1| protein of unknown function DUF1217 [Methylocystis sp. ATCC 49242]
          Length = 266

 Score =  108 bits (270), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 93/162 (57%), Gaps = 6/162 (3%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
           S  +K P V+ E +Y++E I   ++I+ F+KD+RLF+YA+KAFGL D + A   ++K++E
Sbjct: 19  SITAKAPDVALETKYFKENIGKATSIEAFLKDRRLFNYAMKAFGLGDRTFAIGLMRKVME 78

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFSP-----PPKVIQSDIQHKTIIQDYKQSHQHKE 134
             + DPK+L   LN+     FA+++DFS      P   +  D+  +  ++   Q+ Q K 
Sbjct: 79  QGVDDPKALARTLNNPNILAFAKAFDFSAKGAGVPSATLIQDVTAR-FVEQAMQAEQGKR 137

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
              +E + YFR+    + S+  +  D++L+  V  +  I+P+
Sbjct: 138 NPGVELALYFREKAPGLTSIYGVLADKKLVQVVQTALDISPR 179



 Score = 92.8 bits (229), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 94/199 (47%), Gaps = 7/199 (3%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  E  Y+  NI    S E  L ++R+ N+ +++ G+  +      + ++ +  + DPK
Sbjct: 26  DVALETKYFKENIGKATSIEAFLKDRRLFNYAMKAFGLGDRTFAIGLMRKVMEQGVDDPK 85

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + A T  +        +F+F   G         V     I D    +  Q ++ ++ +++
Sbjct: 86  ALARTLNNPNILAFAKAFDFSAKGA-------GVPSATLIQDVTARFVEQAMQAEQGKRN 138

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKI 678
           P + LALYF+   P + + Y +L D KL +VV   L +SP  +      + R+LK  + +
Sbjct: 139 PGVELALYFREKAPGLTSIYGVLADKKLVQVVQTALDISPRTSAQNIDTQARLLKAKVNV 198

Query: 679 NDFKDSKKVEDFLYAAKAM 697
            DFKD KK+  F+    AM
Sbjct: 199 EDFKDPKKLTAFIARFSAM 217



 Score = 59.3 bits (142), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 82/173 (47%), Gaps = 12/173 (6%)

Query: 126 YKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
           ++       +VALE +KYF++NI K  S++   KDRRL +Y +++F +  +  ++  ++ 
Sbjct: 17  WRSITAKAPDVALE-TKYFKENIGKATSIEAFLKDRRLFNYAMKAFGLGDRTFAIGLMRK 75

Query: 186 VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI 245
           V+  G+ +PK       +    A A+ F F   G+      + +   I+ + + +    +
Sbjct: 76  VMEQGVDDPKALARTLNNPNILAFAKAFDFSAKGA-----GVPSATLIQDVTARFVEQAM 130

Query: 246 DCV-----PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITA 293
                   P V    Y++     ++S    L D KL +++Q +L  ++P  +A
Sbjct: 131 QAEQGKRNPGVELALYFREKAPGLTSIYGVLADKKLVQVVQTAL-DISPRTSA 182


>gi|161620213|ref|YP_001594099.1| hypothetical protein BCAN_B0131 [Brucella canis ATCC 23365]
 gi|254702555|ref|ZP_05164383.1| hypothetical protein Bsuib36_01112 [Brucella suis bv. 3 str. 686]
 gi|261753133|ref|ZP_05996842.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161337024|gb|ABX63328.1| protein of unknown function DUF1217 [Brucella canis ATCC 23365]
 gi|261742886|gb|EEY30812.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 262

 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 90/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++KIL   
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEG 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 82  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 141

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  V  +F 
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFG 177



 Score = 89.4 bits (220), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 76/151 (50%), Gaps = 6/151 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    + D  +
Sbjct: 28  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDA 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 88  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 141

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            + LALYF+R  P++ N YEILGD  L  +V
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMV 172



 Score = 54.7 bits (130), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 87/190 (45%), Gaps = 11/190 (5%)

Query: 112 VIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ +   ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +F +     +  F++ +LT G+ +      +  D R++  A  F F   G+ + +    T
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---T 117

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             Q + ++  Y   T++      ++      Y++    S+++  + L D  L  M+Q + 
Sbjct: 118 AAQ-QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTF 176

Query: 285 FPLNPEITAD 294
             L+    AD
Sbjct: 177 GWLSTMSNAD 186


>gi|23499890|ref|NP_699330.1| hypothetical protein BRA0127 [Brucella suis 1330]
 gi|23463465|gb|AAN33335.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 258

 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 90/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++KIL   
Sbjct: 18  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEG 77

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 78  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 137

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  V  +F 
Sbjct: 138 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFG 173



 Score = 89.4 bits (220), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 76/151 (50%), Gaps = 6/151 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    + D  +
Sbjct: 24  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDA 83

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 84  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 137

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            + LALYF+R  P++ N YEILGD  L  +V
Sbjct: 138 GVRLALYFERKAPSLTNAYEILGDKALLTMV 168



 Score = 54.7 bits (130), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 84/183 (45%), Gaps = 11/183 (6%)

Query: 119 HKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
           ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y +++F +   
Sbjct: 4   YRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDM 63

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKI 236
             +  F++ +LT G+ +      +  D R++  A  F F   G+ + +    T  Q + +
Sbjct: 64  AYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---TAAQ-QGV 119

Query: 237 VSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEI 291
           +  Y   T++      ++      Y++    S+++  + L D  L  M+Q +   L+   
Sbjct: 120 IDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMS 179

Query: 292 TAD 294
            AD
Sbjct: 180 NAD 182


>gi|254711992|ref|ZP_05173803.1| hypothetical protein BcetM6_01082 [Brucella ceti M644/93/1]
 gi|254715062|ref|ZP_05176873.1| hypothetical protein BcetM_01092 [Brucella ceti M13/05/1]
 gi|261216769|ref|ZP_05931050.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261319636|ref|ZP_05958833.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260921858|gb|EEX88426.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292326|gb|EEX95822.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 262

 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 90/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++KIL   
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEG 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 82  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 141

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  V  +F 
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFG 177



 Score = 90.5 bits (223), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 90/198 (45%), Gaps = 6/198 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    + D  +
Sbjct: 28  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDA 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 88  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 141

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
            + LALYF+R  P++ N YEILGD  L  +V          +     K+ +++   I  +
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNADIDKQAKMIADKIDFS 201

Query: 680 DFKDSKKVEDFLYAAKAM 697
              D   V  F+    AM
Sbjct: 202 KMSDPDYVSKFISRITAM 219



 Score = 53.1 bits (126), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 83/180 (46%), Gaps = 11/180 (6%)

Query: 112 VIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ +   ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +F +     +  F++ +LT G+ +      +  D R++  A  F F   G+ + +    T
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---T 117

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             Q + ++  Y   T++      ++      Y++    S+++  + L D  L  M+Q + 
Sbjct: 118 AAQ-QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTF 176


>gi|163844322|ref|YP_001621977.1| hypothetical protein BSUIS_B0133 [Brucella suis ATCC 23445]
 gi|163675045|gb|ABY39155.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 262

 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 90/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++KIL   
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEG 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 82  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 141

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  V  +F 
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFG 177



 Score = 89.4 bits (220), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 76/151 (50%), Gaps = 6/151 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    + D  +
Sbjct: 28  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDA 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 88  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 141

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            + LALYF+R  P++ N YEILGD  L  +V
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMV 172



 Score = 54.7 bits (130), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 87/190 (45%), Gaps = 11/190 (5%)

Query: 112 VIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ +   ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +F +     +  F++ +LT G+ +      +  D R++  A  F F   G+ + +    T
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---T 117

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             Q + ++  Y   T++      ++      Y++    S+++  + L D  L  M+Q + 
Sbjct: 118 AAQ-QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTF 176

Query: 285 FPLNPEITAD 294
             L+    AD
Sbjct: 177 GWLSTMSNAD 186


>gi|306841068|ref|ZP_07473791.1| flagellar basal-body rod protein FLGF [Brucella sp. BO2]
 gi|306288906|gb|EFM60209.1| flagellar basal-body rod protein FLGF [Brucella sp. BO2]
          Length = 262

 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 90/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++KIL   
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEG 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 82  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 141

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  V  +F 
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFG 177



 Score = 89.7 bits (221), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 90/198 (45%), Gaps = 6/198 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    + D  +
Sbjct: 28  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDA 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 88  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 141

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
            + LALYF+R  P++ N YEILGD  L  +V          +     K+ +++   I  +
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNADIDKQAKMIADKIDFS 201

Query: 680 DFKDSKKVEDFLYAAKAM 697
              D   V  F+    AM
Sbjct: 202 KMSDPDYVSKFISRFTAM 219



 Score = 52.8 bits (125), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 83/180 (46%), Gaps = 11/180 (6%)

Query: 112 VIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ +   ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +F +     +  F++ +LT G+ +      +  D R++  A  F F   G+ + +    T
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---T 117

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             Q + ++  Y   T++      ++      Y++    S+++  + L D  L  M+Q + 
Sbjct: 118 AAQ-QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTF 176


>gi|17989453|ref|NP_542086.1| flagellar basal-body rod protein FLGF [Brucella melitensis bv. 1
           str. 16M]
 gi|148558502|ref|YP_001257193.1| hypothetical protein BOV_A0118 [Brucella ovis ATCC 25840]
 gi|225628602|ref|ZP_03786636.1| flagellar basal-body rod protein FLGF [Brucella ceti str. Cudo]
 gi|225685988|ref|YP_002733960.1| hypothetical protein BMEA_B0130 [Brucella melitensis ATCC 23457]
 gi|254699438|ref|ZP_05161266.1| hypothetical protein Bsuib55_01044 [Brucella suis bv. 5 str. 513]
 gi|254706315|ref|ZP_05168143.1| hypothetical protein BpinM_04810 [Brucella pinnipedialis
           M163/99/10]
 gi|254711393|ref|ZP_05173204.1| hypothetical protein BpinB_14282 [Brucella pinnipedialis B2/94]
 gi|254720630|ref|ZP_05182441.1| hypothetical protein Bru83_14188 [Brucella sp. 83/13]
 gi|256029977|ref|ZP_05443591.1| hypothetical protein BpinM2_04885 [Brucella pinnipedialis
           M292/94/1]
 gi|256043050|ref|ZP_05445995.1| hypothetical protein Bmelb1R_01137 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059630|ref|ZP_05449827.1| hypothetical protein Bneo5_04665 [Brucella neotomae 5K33]
 gi|256111964|ref|ZP_05452915.1| hypothetical protein Bmelb3E_04760 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158142|ref|ZP_05456058.1| hypothetical protein BcetM4_04805 [Brucella ceti M490/95/1]
 gi|256252907|ref|ZP_05458443.1| hypothetical protein BcetB_01052 [Brucella ceti B1/94]
 gi|256262886|ref|ZP_05465418.1| flagellar basal-body rod protein FLGF [Brucella melitensis bv. 2
           str. 63/9]
 gi|260564282|ref|ZP_05834767.1| flagellar basal body rod protein FlgF [Brucella melitensis bv. 1
           str. 16M]
 gi|261219996|ref|ZP_05934277.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313762|ref|ZP_05952959.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318999|ref|ZP_05958196.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261323600|ref|ZP_05962797.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261749889|ref|ZP_05993598.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|265985674|ref|ZP_06098409.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265986998|ref|ZP_06099555.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265989488|ref|ZP_06102045.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993413|ref|ZP_06105970.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996659|ref|ZP_06109216.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294853151|ref|ZP_06793823.1| hypothetical protein BAZG_02096 [Brucella sp. NVSL 07-0026]
 gi|306837354|ref|ZP_07470233.1| flagellar basal-body rod protein FLGF [Brucella sp. NF 2653]
 gi|306846299|ref|ZP_07478860.1| flagellar basal-body rod protein FLGF [Brucella sp. BO1]
 gi|17985332|gb|AAL54350.1| flagellar basal-body rod protein flgf [Brucella melitensis bv. 1
           str. 16M]
 gi|148369787|gb|ABQ62659.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|225616448|gb|EEH13496.1| flagellar basal-body rod protein FLGF [Brucella ceti str. Cudo]
 gi|225642093|gb|ACO02006.1| protein of unknown function DUF1217 [Brucella melitensis ATCC
           23457]
 gi|260151925|gb|EEW87018.1| flagellar basal body rod protein FlgF [Brucella melitensis bv. 1
           str. 16M]
 gi|260918580|gb|EEX85233.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261298222|gb|EEY01719.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261299580|gb|EEY03077.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261302788|gb|EEY06285.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739642|gb|EEY27568.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262550956|gb|EEZ07117.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262764283|gb|EEZ10315.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000157|gb|EEZ12847.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092723|gb|EEZ16932.1| flagellar basal-body rod protein FLGF [Brucella melitensis bv. 2
           str. 63/9]
 gi|264659195|gb|EEZ29456.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264664266|gb|EEZ34527.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294818806|gb|EFG35806.1| hypothetical protein BAZG_02096 [Brucella sp. NVSL 07-0026]
 gi|306273294|gb|EFM55163.1| flagellar basal-body rod protein FLGF [Brucella sp. BO1]
 gi|306407546|gb|EFM63746.1| flagellar basal-body rod protein FLGF [Brucella sp. NF 2653]
 gi|326410314|gb|ADZ67378.1| flagellar basal-body rod protein FLGF [Brucella melitensis M28]
 gi|326553607|gb|ADZ88246.1| flagellar basal-body rod protein FLGF [Brucella melitensis M5-90]
          Length = 262

 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 90/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++KIL   
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEG 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 82  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 141

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  V  +F 
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFG 177



 Score = 89.7 bits (221), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 90/198 (45%), Gaps = 6/198 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    + D  +
Sbjct: 28  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDA 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 88  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 141

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
            + LALYF+R  P++ N YEILGD  L  +V          +     K+ +++   I  +
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNADIDKQAKMIADKIDFS 201

Query: 680 DFKDSKKVEDFLYAAKAM 697
              D   V  F+    AM
Sbjct: 202 KMSDPDYVSKFISRFTAM 219



 Score = 52.8 bits (125), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 83/180 (46%), Gaps = 11/180 (6%)

Query: 112 VIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ +   ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +F +     +  F++ +LT G+ +      +  D R++  A  F F   G+ + +    T
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---T 117

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             Q + ++  Y   T++      ++      Y++    S+++  + L D  L  M+Q + 
Sbjct: 118 AAQ-QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTF 176


>gi|256014917|ref|YP_003104926.1| hypothetical protein BMI_II127 [Brucella microti CCM 4915]
 gi|255997577|gb|ACU49264.1| hypothetical protein BMI_II127 [Brucella microti CCM 4915]
          Length = 258

 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 90/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++KIL   
Sbjct: 18  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEG 77

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 78  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 137

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  V  +F 
Sbjct: 138 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFG 173



 Score = 89.7 bits (221), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 90/198 (45%), Gaps = 6/198 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    + D  +
Sbjct: 24  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDA 83

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 84  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 137

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
            + LALYF+R  P++ N YEILGD  L  +V          +     K+ +++   I  +
Sbjct: 138 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNADIDKQAKMIADKIDFS 197

Query: 680 DFKDSKKVEDFLYAAKAM 697
              D   V  F+    AM
Sbjct: 198 KMSDPDYVSKFISRFTAM 215



 Score = 52.8 bits (125), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 80/173 (46%), Gaps = 11/173 (6%)

Query: 119 HKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
           ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y +++F +   
Sbjct: 4   YRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDM 63

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKI 236
             +  F++ +LT G+ +      +  D R++  A  F F   G+ + +    T  Q + +
Sbjct: 64  AYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---TAAQ-QGV 119

Query: 237 VSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           +  Y   T++      ++      Y++    S+++  + L D  L  M+Q + 
Sbjct: 120 IDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTF 172


>gi|227820851|ref|YP_002824821.1| hypothetical protein NGR_c02700 [Sinorhizobium fredii NGR234]
 gi|227339850|gb|ACP24068.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 301

 Score =  104 bits (260), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 104/207 (50%), Gaps = 10/207 (4%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            S+E++S Q      +  E +YY   I +I S +E  A+ R+ ++ +++ G++     + 
Sbjct: 59  GSLERVSEQP----VVARETEYYLSRIGSIKSLDEFFADSRLYDYAMKAHGLEDMAYAKA 114

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++    +    +FAN   D+RYK ++ S NF  HG+ +     + Q         D 
Sbjct: 115 FMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGD-TATSFERAQKG-----VVDK 168

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +E+   E++  + LALYF+R  P I + YEI+ D  L +VV   L+L   FA   
Sbjct: 169 YARQTLEQNAGEENGGVRLALYFERMAPLITSGYEIIADEALAQVVRAALQLPEEFAAAD 228

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFL 691
             ++    ++ I + DF+D  K+  F+
Sbjct: 229 VDRQAEAYEEAIDLKDFQDPVKLAAFI 255



 Score = 78.6 bits (192), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 86/176 (48%), Gaps = 10/176 (5%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           + DI   L   VS+ P+V+ E  YY  RI  I ++DEF  D RL+ YA+KA GL DM++A
Sbjct: 54  TADITGSL-ERVSEQPVVARETEYYLSRIGSIKSLDEFFADSRLYDYAMKAHGLEDMAYA 112

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQHKTIIQDYKQS 129
           + F++K+L   +    +  N+L   +Y+    S +F+       S +   K ++  Y  +
Sbjct: 113 KAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGDTATSFERAQKGVVDKY--A 170

Query: 130 HQHKEEVALEESK------YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
            Q  E+ A EE+       YF +    I S  ++  D  L   V  +  +  ++ +
Sbjct: 171 RQTLEQNAGEENGGVRLALYFERMAPLITSGYEIIADEALAQVVRAALQLPEEFAA 226



 Score = 53.5 bits (127), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 2/112 (1%)

Query: 110 PKVIQSDIQHKTIIQDYKQSHQHKEE--VALEESKYFRKNIHKINSVDQLFKDRRLLDYV 167
           P V  +   +K I  D   S +   E  V   E++Y+   I  I S+D+ F D RL DY 
Sbjct: 41  PIVTTTYTSYKLITADITGSLERVSEQPVVARETEYYLSRIGSIKSLDEFFADSRLYDYA 100

Query: 168 LQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG 219
           +++  +     +  F++ VLT G+ +   +  +  D+R++A+ E+  F   G
Sbjct: 101 MKAHGLEDMAYAKAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHG 152


>gi|260568537|ref|ZP_05839006.1| flagellar basal-body rod protein FlgF [Brucella suis bv. 4 str. 40]
 gi|260155202|gb|EEW90283.1| flagellar basal-body rod protein FlgF [Brucella suis bv. 4 str. 40]
          Length = 262

 Score =  104 bits (259), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 89/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F +KIL   
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFARKILTEG 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 82  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 141

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  V  +F 
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFG 177



 Score = 88.6 bits (218), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 75/151 (49%), Gaps = 6/151 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F  +I    + D  +
Sbjct: 28  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFARKILTEGVTDEDA 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 88  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 141

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            + LALYF+R  P++ N YEILGD  L  +V
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMV 172



 Score = 53.9 bits (128), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/190 (21%), Positives = 86/190 (45%), Gaps = 11/190 (5%)

Query: 112 VIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ +   ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +F +     +  F + +LT G+ +      +  D R++  A  F F   G+ + +    T
Sbjct: 61  AFGLEDMAYAKAFARKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---T 117

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             Q + ++  Y   T++      ++      Y++    S+++  + L D  L  M+Q + 
Sbjct: 118 AAQ-QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTF 176

Query: 285 FPLNPEITAD 294
             L+    AD
Sbjct: 177 GWLSTMSNAD 186


>gi|62317079|ref|YP_222932.1| hypothetical protein BruAb2_0125 [Brucella abortus bv. 1 str.
           9-941]
 gi|189022346|ref|YP_001932087.1| Flagellar basal-body rod protein FLGF [Brucella abortus S19]
 gi|237816641|ref|ZP_04595633.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254691432|ref|ZP_05154686.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 6 str.
           870]
 gi|254695269|ref|ZP_05157097.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698368|ref|ZP_05160196.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731813|ref|ZP_05190391.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 4 str.
           292]
 gi|256256618|ref|ZP_05462154.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 9 str.
           C68]
 gi|260544320|ref|ZP_05820141.1| flagellar basal-body rod protein FLGF [Brucella abortus NCTC 8038]
 gi|260757050|ref|ZP_05869398.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759579|ref|ZP_05871927.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762823|ref|ZP_05875155.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882860|ref|ZP_05894474.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261215635|ref|ZP_05929916.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297249975|ref|ZP_06933676.1| hypothetical protein BAYG_02750 [Brucella abortus bv. 5 str. B3196]
 gi|62197272|gb|AAX75571.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|189020920|gb|ACD73641.1| Flagellar basal-body rod protein FLGF [Brucella abortus S19]
 gi|237787454|gb|EEP61670.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260097591|gb|EEW81465.1| flagellar basal-body rod protein FLGF [Brucella abortus NCTC 8038]
 gi|260669897|gb|EEX56837.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673244|gb|EEX60065.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677158|gb|EEX63979.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872388|gb|EEX79457.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917242|gb|EEX84103.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297173844|gb|EFH33208.1| hypothetical protein BAYG_02750 [Brucella abortus bv. 5 str. B3196]
          Length = 262

 Score =  104 bits (259), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 90/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++KIL   
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEG 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 82  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 141

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  +  +F 
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFG 177



 Score = 88.6 bits (218), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 90/198 (45%), Gaps = 6/198 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    + D  +
Sbjct: 28  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDA 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 88  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 141

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
            + LALYF+R  P++ N YEILGD  L  ++          +     K+ +++   I  +
Sbjct: 142 GVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNADIDKQAKMIADKIDFS 201

Query: 680 DFKDSKKVEDFLYAAKAM 697
              D   V  F+    AM
Sbjct: 202 KMSDPDYVSKFISRFTAM 219



 Score = 54.3 bits (129), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 83/180 (46%), Gaps = 11/180 (6%)

Query: 112 VIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ +   ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +F +     +  F++ +LT G+ +      +  D R++  A  F F   G+ + +    T
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---T 117

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             Q + ++  Y   T++      ++      Y++    S+++  + L D  L  MLQ + 
Sbjct: 118 AAQ-QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTF 176


>gi|83269072|ref|YP_418363.1| flagellar basal-body rod protein FlgF [Brucella melitensis biovar
           Abortus 2308]
 gi|82939346|emb|CAJ12293.1| flagellar basal-body rod protein FlgF [Brucella melitensis biovar
           Abortus 2308]
          Length = 258

 Score =  104 bits (259), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 90/156 (57%), Gaps = 5/156 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++KIL   
Sbjct: 18  VSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEG 77

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
           ++D  ++ N+L   +Y+ FA  +DF+    +  QS    + +I  Y +    KE  +  E
Sbjct: 78  VTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQNE 137

Query: 141 ----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
               + YF +    + +  ++  D+ LL  +  +F 
Sbjct: 138 GVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFG 173



 Score = 88.6 bits (218), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 90/198 (45%), Gaps = 6/198 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    + D  +
Sbjct: 24  VERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILTEGVTDEDA 83

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +EK+   ++ 
Sbjct: 84  MANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ------GVIDKYVRQTLEKEAGSQNE 137

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
            + LALYF+R  P++ N YEILGD  L  ++          +     K+ +++   I  +
Sbjct: 138 GVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNADIDKQAKMIADKIDFS 197

Query: 680 DFKDSKKVEDFLYAAKAM 697
              D   V  F+    AM
Sbjct: 198 KMSDPDYVSKFISRFTAM 215



 Score = 53.9 bits (128), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 80/173 (46%), Gaps = 11/173 (6%)

Query: 119 HKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
           ++ I  +  +S Q   KE +   E+ Y+++NI  + SVD    D RL +Y +++F +   
Sbjct: 4   YRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDM 63

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKI 236
             +  F++ +LT G+ +      +  D R++  A  F F   G+ + +    T  Q + +
Sbjct: 64  AYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQS---TAAQ-QGV 119

Query: 237 VSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           +  Y   T++      ++      Y++    S+++  + L D  L  MLQ + 
Sbjct: 120 IDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTF 172


>gi|182679721|ref|YP_001833867.1| hypothetical protein Bind_2809 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635604|gb|ACB96378.1| protein of unknown function DUF1217 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 259

 Score =  103 bits (258), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 90/163 (55%), Gaps = 5/163 (3%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           +K  +T + +P VS E +YY + I  ++TID F+ + RLF+YA+KAFGL DM +A+  ++
Sbjct: 16  TKTLATTASEPSVSRESKYYLDNISKVTTIDGFLNNNRLFTYAMKAFGLGDMVYAKGMVR 75

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYK----QSH 130
           +IL+   SDP++L N LN  +Y+  A+++DF+        +    + ++  Y     + +
Sbjct: 76  QILQQGTSDPRALANTLNDSRYKALAQTFDFANLGANATSTTTAGQNVVDKYVEMQLEDN 135

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
             K     E + Y ++    I S   +  D+ LL  V  +F++
Sbjct: 136 VGKNSPGAEMALYLKRVAPTITSAYSILADKTLLQIVQTTFNL 178



 Score = 89.4 bits (220), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 88/192 (45%), Gaps = 6/192 (3%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
            ++ E  YY  NI+ + + +  L N R+  + +++ G+      +  + +I +    DP+
Sbjct: 27  SVSRESKYYLDNISKVTTIDGFLNNNRLFTYAMKAFGLGDMVYAKGMVRQILQQGTSDPR 86

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + ANT  D+RYK +  +F+F   G  +       Q      +  D Y    +E    +  
Sbjct: 87  ALANTLNDSRYKALAQTFDFANLGANATSTTTAGQ------NVVDKYVEMQLEDNVGKNS 140

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKI 678
           P   +ALY KR  P I + Y IL D  L ++V     L    + L    + +++   +KI
Sbjct: 141 PGAEMALYLKRVAPTITSAYSILADKTLLQIVQTTFNLPSSMSALDIDVQAKMINSKMKI 200

Query: 679 NDFKDSKKVEDF 690
           +D +D  K++ F
Sbjct: 201 SDLQDPTKLQTF 212


>gi|163758008|ref|ZP_02165096.1| hypothetical protein HPDFL43_00245 [Hoeflea phototrophica DFL-43]
 gi|162284297|gb|EDQ34580.1| hypothetical protein HPDFL43_00245 [Hoeflea phototrophica DFL-43]
          Length = 260

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 103/206 (50%), Gaps = 10/206 (4%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           S+E+I++Q     ++  E + Y   I+ I S +E +A+ R+ N+ +++ G++     + F
Sbjct: 18  SIERIASQP----QVARESENYLSRISEIKSIDEFMADTRVFNYAMKAHGLEDMSYAKAF 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++      D  +FAN   D RY++   +FNF  HGE +       Q       T D Y
Sbjct: 74  MRKVLTEGTDDDNAFANQLADTRYRDFAEAFNFARHGETATIFTSAQQ------GTVDKY 127

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
               +E++    +  + LALYF+R  P + + YEIL D+ L  VV   L L    A    
Sbjct: 128 HRLTLEEEAGADNTGVRLALYFERNAPELTSAYEILADNALADVVRTALGLPSELAATDI 187

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFL 691
            K+  ++   I + DFKD +K++ FL
Sbjct: 188 DKQADLINSRIDLEDFKDPEKLDKFL 213



 Score = 87.4 bits (215), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 82/157 (52%), Gaps = 5/157 (3%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           ++  P V+ E   Y  RI  I +IDEF+ D R+F+YA+KA GL DMS+A+ F++K+L   
Sbjct: 22  IASQPQVARESENYLSRISEIKSIDEFMADTRVFNYAMKAHGLEDMSYAKAFMRKVLTEG 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQHKTIIQDYK---QSHQHKEEV 136
             D  +  NQL   +Y+ FA +++F+       I +  Q  T+ + ++   +     +  
Sbjct: 82  TDDDNAFANQLADTRYRDFAEAFNFARHGETATIFTSAQQGTVDKYHRLTLEEEAGADNT 141

Query: 137 ALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
            +  + YF +N  ++ S  ++  D  L D V  +  +
Sbjct: 142 GVRLALYFERNAPELTSAYEILADNALADVVRTALGL 178



 Score = 45.4 bits (106), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 112 VIQSDIQHKTIIQDYKQSHQH---KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVL 168
           +I +   ++ I QD  +S +    + +VA E   Y  + I +I S+D+   D R+ +Y +
Sbjct: 1   MISTYTSYRLIAQDIPKSIERIASQPQVARESENYLSR-ISEIKSIDEFMADTRVFNYAM 59

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG 219
           ++  +     +  F++ VLT G  +   +  +  D R+R  AE F F   G
Sbjct: 60  KAHGLEDMSYAKAFMRKVLTEGTDDDNAFANQLADTRYRDFAEAFNFARHG 110


>gi|217977818|ref|YP_002361965.1| protein of unknown function DUF1217 [Methylocella silvestris BL2]
 gi|217503194|gb|ACK50603.1| protein of unknown function DUF1217 [Methylocella silvestris BL2]
          Length = 259

 Score =  102 bits (254), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 93/165 (56%), Gaps = 5/165 (3%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           SK  +T + D +   E  YY   I  + ++D+ +K++RL++Y LKA+GLSDM++A+  I+
Sbjct: 16  SKSLATAASDTVAKRETAYYEANIGKVKSVDDLMKNQRLYAYVLKAYGLSDMAYAKGLIR 75

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKV--IQSDIQHKT---IIQDYKQSH 130
           K+L SD++D  SL N L+  +Y+  A +Y+FS    V  I ++ Q  T    ++   +++
Sbjct: 76  KVLTSDVTDGASLANTLSGGRYKALAAAYNFSAKGAVGTISAEAQKTTKDNYVEQTLEAN 135

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             K+    + + YF++    + S   +  D+ LL  V  +F ++ 
Sbjct: 136 VGKQNDGAKMALYFKRIAPTVKSAYGILADKTLLGVVQTAFGLSA 180



 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 89/189 (47%), Gaps = 6/189 (3%)

Query: 503 EVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFAN 562
           E  YY  NI  + S ++L+ N+R+  ++L++ G+      +  + ++  SD+ D  S AN
Sbjct: 31  ETAYYEANIGKVKSVDDLMKNQRLYAYVLKAYGLSDMAYAKGLIRKVLTSDVTDGASLAN 90

Query: 563 TYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIA 622
           T    RYK + +++NF   G      +G +        T D Y  Q +E    +++    
Sbjct: 91  TLSGGRYKALAAAYNFSAKGA-----VGTISAEAQ-KTTKDNYVEQTLEANVGKQNDGAK 144

Query: 623 LALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFK 682
           +ALYFKR  P +++ Y IL D  L  VV     LS   +      + + +    KI D +
Sbjct: 145 MALYFKRIAPTVKSAYGILADKTLLGVVQTAFGLSASMSQQNIDVQAKTINALFKIGDLQ 204

Query: 683 DSKKVEDFL 691
           +  K++  +
Sbjct: 205 NPAKLQKLI 213



 Score = 58.5 bits (140), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 88/190 (46%), Gaps = 16/190 (8%)

Query: 112 VIQSDIQHKTIIQDYKQS--HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           ++ S + +  + +D+ +S      + VA  E+ Y+  NI K+ SVD L K++RL  YVL+
Sbjct: 1   MLNSTLYYTMLTRDFSKSLATAASDTVAKRETAYYEANIGKVKSVDDLMKNQRLYAYVLK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           ++ ++    +   ++ VLT  + +           R++A+A  + F   G++     I  
Sbjct: 61  AYGLSDMAYAKGLIRKVLTSDVTDGASLANTLSGGRYKALAAAYNFSAKGAVG---TISA 117

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQN-------YYKLAINSVSSFSDFLKDPKLFKMLQL 282
           + Q +    NY   T++    V  QN       Y+K    +V S    L D  L  ++Q 
Sbjct: 118 EAQ-KTTKDNYVEQTLEAN--VGKQNDGAKMALYFKRIAPTVKSAYGILADKTLLGVVQ- 173

Query: 283 SLFPLNPEIT 292
           + F L+  ++
Sbjct: 174 TAFGLSASMS 183



 Score = 50.4 bits (119), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 53/106 (50%), Gaps = 14/106 (13%)

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +GK+KS+D+L+  +                 + L AY L+     +  +R VLTS+
Sbjct: 35  YEANIGKVKSVDDLMKNQR-------------LYAYVLKAYGLSDMAYAKGLIRKVLTSD 81

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
            +D  S AN     R   L  A+NF+A G++G I   +++ T +DN
Sbjct: 82  VTDGASLANTLSGGRYKALAAAYNFSAKGAVGTIS-AEAQKTTKDN 126


>gi|296444947|ref|ZP_06886909.1| protein of unknown function DUF1217 [Methylosinus trichosporium
           OB3b]
 gi|296257615|gb|EFH04680.1| protein of unknown function DUF1217 [Methylosinus trichosporium
           OB3b]
          Length = 266

 Score = 99.8 bits (247), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 94/170 (55%), Gaps = 5/170 (2%)

Query: 15  QSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFI 74
           QS   S  +K P V+ + +Y+ + I  + ++D+F+K+ RLF+YA+ AFGL DM++A+  +
Sbjct: 14  QSLWQSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTAFGLGDMTYAKGMM 73

Query: 75  KKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQS---- 129
           +K+LE  +SD  +L N LN+   + FA ++DF+        S      ++  Y +     
Sbjct: 74  QKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTTSSSTLVDNVVSRYAEQSLED 133

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           +Q ++   ++ + YF++N   I SV  +  D ++L  V  +  I+ +  S
Sbjct: 134 NQGQQNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTALGISTQTTS 183



 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/199 (24%), Positives = 97/199 (48%), Gaps = 6/199 (3%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++ ++  Y+  NI  + S ++ + N R+ N+ + + G+      +  + ++ +  + D  
Sbjct: 26  DVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTAFGLGDMTYAKGMMQKVLEQGVSDNS 85

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + ANT  +   K   ++F+F  +G  +         +  +D+    Y  Q +E  + +++
Sbjct: 86  ALANTLNNANIKAFATAFDFADNGASTTSS------STLVDNVVSRYAEQSLEDNQGQQN 139

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKI 678
           P + LALYF+R  P+I + Y IL DSK+  VV   L +S          +  +L   + I
Sbjct: 140 PGVQLALYFQRNAPSITSVYGILADSKILSVVQTALGISTQTTSQSIDSQAAMLTSKLDI 199

Query: 679 NDFKDSKKVEDFLYAAKAM 697
            DF+D KK++ F+    AM
Sbjct: 200 TDFQDPKKLQQFISRFAAM 218



 Score = 54.3 bits (129), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 73/166 (43%), Gaps = 9/166 (5%)

Query: 124 QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
           Q   QS   K+     +++YF  NI K+ SVD   K+ RL +Y + +F +     +   +
Sbjct: 14  QSLWQSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTAFGLGDMTYAKGMM 73

Query: 184 KDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNN 243
           + VL  G+++         +   +A A  F F  +G+ +     L D     +VS Y   
Sbjct: 74  QKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTTSSSTLVD----NVVSRYAEQ 129

Query: 244 TID-----CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           +++       P V    Y++    S++S    L D K+  ++Q +L
Sbjct: 130 SLEDNQGQQNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTAL 175


>gi|118589944|ref|ZP_01547348.1| flagellar basal-body rod protein flgf [Stappia aggregata IAM 12614]
 gi|118437441|gb|EAV44078.1| flagellar basal-body rod protein flgf [Stappia aggregata IAM 12614]
          Length = 262

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 86/163 (52%), Gaps = 15/163 (9%)

Query: 21  TVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILES 80
           TV+ DP+V  +  YYRE I+ I TIDEF+ D R+F+YA+ A GL DM +A+ FI+K+LE 
Sbjct: 21  TVAADPMVERQTEYYRENIRDIKTIDEFLGDDRIFNYAMTAMGLEDMIYAKAFIRKVLEE 80

Query: 81  DLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQ-HKTIIQDYKQSHQHKEEVALE 139
              D  +  NQL   KY+ FA +++F    +   S  +  + I+Q Y     H++ + + 
Sbjct: 81  GTDDRGAFANQLADTKYKNFAETFNFKRYGETTTSFARTQEAIVQKY-----HRQTLEVR 135

Query: 140 ESK---------YFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
           E +         YF +    I +   +  DR L + V  S  +
Sbjct: 136 EGEQNQGVRLALYFERRAPDITNAYDVLADRALAEAVYTSLGL 178



 Score = 97.1 bits (240), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 95/192 (49%), Gaps = 6/192 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  + +YY  NI  I + +E L + RI N+ + + G++     + F+ ++ +    D  +
Sbjct: 28  VERQTEYYRENIRDIKTIDEFLGDDRIFNYAMTAMGLEDMIYAKAFIRKVLEEGTDDRGA 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
           FAN   D +YK    +FNF  +GE +     + Q+          Y  Q +E +E E++ 
Sbjct: 88  FANQLADTKYKNFAETFNFKRYGE-TTTSFARTQEAI-----VQKYHRQTLEVREGEQNQ 141

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
            + LALYF+R  P+I N Y++L D  L + V   L L   FA+    K+   L++ +  +
Sbjct: 142 GVRLALYFERRAPDITNAYDVLADRALAEAVYTSLGLPQEFAMTDIDKQAAYLEERLDFS 201

Query: 680 DFKDSKKVEDFL 691
            F D+  +  FL
Sbjct: 202 KFGDADYLAKFL 213


>gi|328545468|ref|YP_004305577.1| flagellar basal-body rod protein flgf [polymorphum gilvum
           SL003B-26A1]
 gi|326415209|gb|ADZ72272.1| Flagellar basal-body rod protein flgf [Polymorphum gilvum
           SL003B-26A1]
          Length = 261

 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 94/192 (48%), Gaps = 6/192 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E +YY  NI    S ++ L + R+  + +++ G+      + F+ ++ +    D  S
Sbjct: 28  VRRESEYYLANIGKAKSIDDFLGDDRLFKYAMKAFGLQDMDYAKAFMRKVLEEGTDDRNS 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
           FAN   D+RY++   +FNF  +G+ +     + Q         D Y  Q +E +  E + 
Sbjct: 88  FANKLADDRYRQFAETFNFTRYGD-AATAFTRAQQG-----VVDAYVRQSLEIQNGESNE 141

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
            + LALYF R    I + Y+IL D  L +VV   L L   FA+    K+   ++K + + 
Sbjct: 142 GVRLALYFSRKAETIDSAYDILADRALAQVVYAALGLPDEFAMADVDKQAAFIEKRLDLE 201

Query: 680 DFKDSKKVEDFL 691
           DFKD + VE FL
Sbjct: 202 DFKDPQAVEAFL 213



 Score = 86.3 bits (212), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 90/189 (47%), Gaps = 19/189 (10%)

Query: 21  TVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILES 80
           TV+ +P V  E  YY   I    +ID+F+ D RLF YA+KAFGL DM +A+ F++K+LE 
Sbjct: 21  TVASEPTVRRESEYYLANIGKAKSIDDFLGDDRLFKYAMKAFGLQDMDYAKAFMRKVLEE 80

Query: 81  DLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYK-------QSHQHK 133
              D  S  N+L   +Y+ FA +++F+       +  + +  + D         Q+ +  
Sbjct: 81  GTDDRNSFANKLADDRYRQFAETFNFTRYGDAATAFTRAQQGVVDAYVRQSLEIQNGESN 140

Query: 134 EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLAN 193
           E V L  + YF +    I+S   +  DR L   V  +       + LP   D   +   +
Sbjct: 141 EGVRL--ALYFSRKAETIDSAYDILADRALAQVVYAA-------LGLP---DEFAMADVD 188

Query: 194 PKKYFIESR 202
            +  FIE R
Sbjct: 189 KQAAFIEKR 197



 Score = 48.1 bits (113), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 67/150 (44%), Gaps = 9/150 (6%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           ES+Y+  NI K  S+D    D RL  Y +++F +     +  F++ VL  G  +   +  
Sbjct: 31  ESEYYLANIGKAKSIDDFLGDDRLFKYAMKAFGLQDMDYAKAFMRKVLEEGTDDRNSFAN 90

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN---- 255
           +  D+R+R  AE F F   G  +      T  Q + +V  Y   +++     S++     
Sbjct: 91  KLADDRYRQFAETFNFTRYGDAA---TAFTRAQ-QGVVDAYVRQSLEIQNGESNEGVRLA 146

Query: 256 -YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
            Y+     ++ S  D L D  L +++  +L
Sbjct: 147 LYFSRKAETIDSAYDILADRALAQVVYAAL 176



 Score = 43.1 bits (100), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 73/177 (41%), Gaps = 33/177 (18%)

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y   +GK KSID+ L G  +L             ++A+ A+ L   D  +  +R VL   
Sbjct: 35  YLANIGKAKSIDDFL-GDDRL------------FKYAMKAFGLQDMDYAKAFMRKVLEEG 81

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
             D +S+ANK  DDR  +    FNF   G               D    +   ++ + DA
Sbjct: 82  TDDRNSFANKLADDRYRQFAETFNFTRYG---------------DAATAFTRAQQGVVDA 126

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI 536
             +    ++   + + + L +     Y++    TI S  ++LA++ +   +  + G+
Sbjct: 127 YVRQSLEIQNGESNEGVRLAL-----YFSRKAETIDSAYDILADRALAQVVYAALGL 178


>gi|110632663|ref|YP_672871.1| hypothetical protein Meso_0302 [Mesorhizobium sp. BNC1]
 gi|110283647|gb|ABG61706.1| protein of unknown function DUF1217 [Chelativorans sp. BNC1]
          Length = 258

 Score = 97.8 bits (242), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 98/194 (50%), Gaps = 10/194 (5%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           ++ E  YY  NI  + S EE +A+ R+  + +++ G++     +  + +  +  + D  S
Sbjct: 28  VSRETAYYQENIGKVKSIEEFVADDRLFRYAMKAHGLEDMAYAKALMVKALEGGIDDEDS 87

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH--IDDTCDLYKHQMIEKKEEEK 617
           F N   D RYK+ + +FNF  +GE +          FH     T + Y  Q +E+    +
Sbjct: 88  FVNKLTDKRYKDFVDTFNFARYGEKTT--------TFHSSTTGTVEKYLRQTLEEDAGNQ 139

Query: 618 DPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK 677
           +  + LALYF+R   +++++YEIL D  L +VV   L      A     K+  ++K+ + 
Sbjct: 140 NEGVRLALYFQRKAGSLKSYYEILADPALSQVVRTALGFPDALAQADIDKQAEMIKERLD 199

Query: 678 INDFKDSKKVEDFL 691
           + +  D +K+E+FL
Sbjct: 200 LEELNDPEKLEEFL 213



 Score = 79.0 bits (193), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 56/86 (65%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           V + P+VS E  YY+E I  + +I+EF+ D RLF YA+KA GL DM++A+  + K LE  
Sbjct: 22  VEQQPMVSRETAYYQENIGKVKSIEEFVADDRLFRYAMKAHGLEDMAYAKALMVKALEGG 81

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFS 107
           + D  S VN+L   +Y+ F  +++F+
Sbjct: 82  IDDEDSFVNKLTDKRYKDFVDTFNFA 107



 Score = 46.2 bits (108), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 85/185 (45%), Gaps = 16/185 (8%)

Query: 112 VIQSDIQHKTIIQDYKQSHQHKEEVAL--EESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           +I +   ++ I++D ++S    E+  +   E+ Y+++NI K+ S+++   D RL  Y ++
Sbjct: 1   MINTYTSYQLIVRDIERSIDRVEQQPMVSRETAYYQENIGKVKSIEEFVADDRLFRYAMK 60

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +  +     +   +   L  G+ +   +  +  D R++   + F F   G  +      T
Sbjct: 61  AHGLEDMAYAKALMVKALEGGIDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTTFHSST 120

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQN-------YYKLAINSVSSFSDFLKDPKLFKMLQL 282
              +EK    Y   T++      +QN       Y++    S+ S+ + L DP L ++++ 
Sbjct: 121 TGTVEK----YLRQTLE--EDAGNQNEGVRLALYFQRKAGSLKSYYEILADPALSQVVRT 174

Query: 283 SL-FP 286
           +L FP
Sbjct: 175 ALGFP 179


>gi|312115256|ref|YP_004012852.1| hypothetical protein Rvan_2538 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220385|gb|ADP71753.1| protein of unknown function DUF1217 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 264

 Score = 96.7 bits (239), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 109/221 (49%), Gaps = 12/221 (5%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           + S+ +YY  NI  I S +EL+ + ++ ++ L + G+   +V    L +   S+  D  S
Sbjct: 28  VASQTEYYKANIGNITSADELVGDYKLFSYALTAYGL-GDEVYAKALYKKVLSEGTDKGS 86

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            ++        E+  +FNF+ +G  S      VQ+     D  DLY  Q +E+K+ E + 
Sbjct: 87  LSSKLGKLGVTELAKTFNFEENGT-STTTSDAVQN-----DVVDLYLAQTLEEKQGETNE 140

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
              +ALYF R    I + Y+IL D  L K V   L LS Y A +   K+  +L K + +N
Sbjct: 141 GAQMALYFYRNASKIDSVYDILADKTLLKTVYTALGLSEYTAAMNIDKQASLLSKALDLN 200

Query: 680 DFKDSKKVEDFLYAAKAM-----DHQSIDYKKALFSSPNQN 715
           DFKD +K+  F+     +     ++ + DY  ALF + + N
Sbjct: 201 DFKDPQKLTSFIAKFSTLYDSENNNTASDYVSALFGTSSSN 241



 Score = 85.5 bits (210), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 87/165 (52%), Gaps = 8/165 (4%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           SK     + +P V+ +  YY+  I +I++ DE + D +LFSYAL A+GL D  +A+   K
Sbjct: 16  SKWTEITAAEPSVASQTEYYKANIGNITSADELVGDYKLFSYALTAYGLGDEVYAKALYK 75

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDF------SPPPKVIQSDIQHKTIIQDYKQS 129
           K+L S+ +D  SL ++L  L     A++++F      +     +Q+D+    + Q  ++ 
Sbjct: 76  KVL-SEGTDKGSLSSKLGKLGVTELAKTFNFEENGTSTTTSDAVQNDVVDLYLAQTLEEK 134

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
                E A + + YF +N  KI+SV  +  D+ LL  V  +  ++
Sbjct: 135 QGETNEGA-QMALYFYRNASKIDSVYDILADKTLLKTVYTALGLS 178



 Score = 40.0 bits (92), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 6/95 (6%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           +++Y++ NI  I S D+L  D +L  Y L ++ +  +  +    K VL+ G     K  +
Sbjct: 31  QTEYYKANIGNITSADELVGDYKLFSYALTAYGLGDEVYAKALYKKVLSEG---TDKGSL 87

Query: 200 ESRDNRFRA--MAENFRFQPDG-SLSKRDKILTDM 231
            S+  +     +A+ F F+ +G S +  D +  D+
Sbjct: 88  SSKLGKLGVTELAKTFNFEENGTSTTTSDAVQNDV 122


>gi|153011531|ref|YP_001372745.1| hypothetical protein Oant_4216 [Ochrobactrum anthropi ATCC 49188]
 gi|151563419|gb|ABS16916.1| protein of unknown function DUF1217 [Ochrobactrum anthropi ATCC
           49188]
          Length = 264

 Score = 95.5 bits (236), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 90/165 (54%), Gaps = 10/165 (6%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I  + +ID+F+ D RL++YA+KAFGL DM+ A+ F++KIL   
Sbjct: 24  VSKEPMVERETAYYKENIGKVKSIDDFMADSRLYNYAMKAFGLEDMAFAKAFVRKILTEG 83

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDY------KQSHQHKE 134
           ++   ++ N+L   +Y+ FA  +DF+    +  +S    + ++  Y       ++    E
Sbjct: 84  ITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTAAQQGVVDKYLRQTLETEAGSQNE 143

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
            V L  + YF +    I +  ++  D+ L+  +  +F   P  IS
Sbjct: 144 GVRL--ALYFARKAPTITNAYEILGDKALVSMIQTTFGW-PSSIS 185



 Score = 84.0 bits (206), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 72/151 (47%), Gaps = 6/151 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + F+ +I    +    +
Sbjct: 30  VERETAYYKENIGKVKSIDDFMADSRLYNYAMKAFGLEDMAFAKAFVRKILTEGITSDDA 89

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F   G  + +     Q         D Y  Q +E +   ++ 
Sbjct: 90  MANKLTDKRYKEFATVFDFAGKGAEATESTAAQQ------GVVDKYLRQTLETEAGSQNE 143

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            + LALYF R  P I N YEILGD  L  ++
Sbjct: 144 GVRLALYFARKAPTITNAYEILGDKALVSMI 174



 Score = 57.8 bits (138), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 83/181 (45%), Gaps = 11/181 (6%)

Query: 111 KVIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVL 168
           +++ +   ++ I  D  +S Q   KE +   E+ Y+++NI K+ S+D    D RL +Y +
Sbjct: 2   RMVDTMTSYRLIASDMARSLQRVSKEPMVERETAYYKENIGKVKSIDDFMADSRLYNYAM 61

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKIL 228
           ++F +     +  F++ +LT G+ +      +  D R++  A  F F   G+ +      
Sbjct: 62  KAFGLEDMAFAKAFVRKILTEGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATES--- 118

Query: 229 TDMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLS 283
           T  Q + +V  Y   T++      ++      Y+     ++++  + L D  L  M+Q +
Sbjct: 119 TAAQ-QGVVDKYLRQTLETEAGSQNEGVRLALYFARKAPTITNAYEILGDKALVSMIQTT 177

Query: 284 L 284
            
Sbjct: 178 F 178


>gi|239834449|ref|ZP_04682777.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239822512|gb|EEQ94081.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 264

 Score = 95.1 bits (235), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 89/165 (53%), Gaps = 10/165 (6%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           VSK+P+V  E  YY+E I  + ++D+F+ D RL++YALKAFGL DM+ A+ F++KIL   
Sbjct: 24  VSKEPMVERETAYYKENIGKVKSVDDFMADSRLYNYALKAFGLEDMAFAKAFVRKILTEG 83

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQDY------KQSHQHKE 134
           +    ++ N+L   +Y+ FA  +DF     +  QS    + ++  Y       ++    E
Sbjct: 84  IKSDDAMANKLTDKRYKEFATVFDFEGKGAEATQSTAAQQGVVDKYLRQTLETEAGSQNE 143

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
            V L  + YF++    + +  ++  D+ L+  +  +F   P  IS
Sbjct: 144 GVRL--ALYFQRKAPTLTNAYEILGDKALVSMIQTTFGW-PSTIS 185



 Score = 87.0 bits (214), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 75/151 (49%), Gaps = 6/151 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  NI  + S ++ +A+ R+ N+ L++ G++     + F+ +I    +K   +
Sbjct: 30  VERETAYYKENIGKVKSVDDFMADSRLYNYALKAFGLEDMAFAKAFVRKILTEGIKSDDA 89

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D RYKE  + F+F+  G  + +     Q         D Y  Q +E +   ++ 
Sbjct: 90  MANKLTDKRYKEFATVFDFEGKGAEATQSTAAQQ------GVVDKYLRQTLETEAGSQNE 143

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            + LALYF+R  P + N YEILGD  L  ++
Sbjct: 144 GVRLALYFQRKAPTLTNAYEILGDKALVSMI 174



 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 86/181 (47%), Gaps = 11/181 (6%)

Query: 111 KVIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVL 168
           +++ +   ++ I  D  +S Q   KE +   E+ Y+++NI K+ SVD    D RL +Y L
Sbjct: 2   RMVDTMTSYRLIASDMARSLQRVSKEPMVERETAYYKENIGKVKSVDDFMADSRLYNYAL 61

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKIL 228
           ++F +     +  F++ +LT G+ +      +  D R++  A  F F+  G+ + +    
Sbjct: 62  KAFGLEDMAFAKAFVRKILTEGIKSDDAMANKLTDKRYKEFATVFDFEGKGAEATQS--- 118

Query: 229 TDMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLS 283
           T  Q + +V  Y   T++      ++      Y++    ++++  + L D  L  M+Q +
Sbjct: 119 TAAQ-QGVVDKYLRQTLETEAGSQNEGVRLALYFQRKAPTLTNAYEILGDKALVSMIQTT 177

Query: 284 L 284
            
Sbjct: 178 F 178


>gi|126730141|ref|ZP_01745953.1| flagellar protein, putative [Sagittula stellata E-37]
 gi|126709521|gb|EBA08575.1| flagellar protein, putative [Sagittula stellata E-37]
          Length = 397

 Score = 91.7 bits (226), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/309 (26%), Positives = 135/309 (43%), Gaps = 44/309 (14%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y++E+I  +++ D+ + D+RL S AL AFGLSD   +   IK++L     +  +L N+L 
Sbjct: 36  YFKEKIGGVTSGDDLVNDRRLLSVALAAFGLSDQIDSAYLIKRVLNEGAENDDALANKLK 95

Query: 94  SLKYQYFARSYDFSPPP------------------KVIQSDIQHKTIIQDYKQSHQHKEE 135
             +Y   AR++ F                      K I+SD+       +Y  +    E 
Sbjct: 96  DGRYVALARAFSFEETTNFPFQEEGFAGDILASYDKRIRSDLADLLEEPEYANNPIAAET 155

Query: 136 V------ALEESK-YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           +       LE +K YFR+ I  + SVD L KD  LL   L +F +  +  S   LK V  
Sbjct: 156 LEATVLDGLETTKTYFRETIGSVTSVDDLMKDNDLLKVALTAFGVEERTNSKTLLKRVFE 215

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY----FNNT 244
            G  NP        D    AM + F F  + + + R +   D    KI+ NY    F + 
Sbjct: 216 EGATNPGALANVLGDKGLIAMTKAFGFDTEPTTAIRTEEFAD----KIIDNYQWQAFEDA 271

Query: 245 IDCV-PIVSDQNYYKLAINSVSSFS--------DFLKDPKLFKMLQLSL-FPLN-PEITA 293
           ++ V P +     ++    +++  S        + L D  + ++ Q +L  P +  +I  
Sbjct: 272 VNEVNPTIGTALSFQRGAPALAGLSGSENTKWFNVLGDSTMREVFQTALGLPSSFSQIDI 331

Query: 294 DKFLTLMQE 302
           DK + +M+E
Sbjct: 332 DKQVEMMKE 340



 Score = 77.4 bits (189), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 73/317 (23%), Positives = 124/317 (39%), Gaps = 46/317 (14%)

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFN--------F 444
           L  AL A+ L+ Q      ++ VL     + D+ ANK KD R + L  AF+        F
Sbjct: 57  LSVALAAFGLSDQIDSAYLIKRVLNEGAENDDALANKLKDGRYVALARAFSFEETTNFPF 116

Query: 445 NADGSIGPIPMMQSRLTIRDNVK------HYANRKRSIHDAENKSFNSMEQISTQKRINL 498
             +G  G I     +  IR ++        YAN   +    E    + +E   T      
Sbjct: 117 QEEGFAGDILASYDK-RIRSDLADLLEEPEYANNPIAAETLEATVLDGLETTKT------ 169

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
                  Y+   I ++ S ++L+ +  +L   L + G++ +   +  L  +F+    +P 
Sbjct: 170 -------YFRETIGSVTSVDDLMKDNDLLKVALTAFGVEERTNSKTLLKRVFEEGATNPG 222

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + AN   D     +  +F FD            ++     D   D Y+ Q  E    E +
Sbjct: 223 ALANVLGDKGLIAMTKAFGFDTE------PTTAIRTEEFADKIIDNYQWQAFEDAVNEVN 276

Query: 619 PNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIR 670
           P I  AL F+R  P +           + +LGDS + +V    L L   F+ +   K++ 
Sbjct: 277 PTIGTALSFQRGAPALAGLSGSENTKWFNVLGDSTMREVFQTALGLPSSFSQIDIDKQVE 336

Query: 671 ILKK----HIKINDFKD 683
           ++K+       I  FKD
Sbjct: 337 MMKEKAASRFGITQFKD 353



 Score = 56.2 bits (134), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 74/161 (45%), Gaps = 21/161 (13%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           +++YF++ I  + S D L  DRRLL   L +F ++ +  S   +K VL  G  N      
Sbjct: 33  DTEYFKEKIGGVTSGDDLVNDRRLLSVALAAFGLSDQIDSAYLIKRVLNEGAENDDALAN 92

Query: 200 ESRDNRFRAMAE--------NFRFQPDG----SLSKRDK-ILTDMQIEKIVSNYFNNTID 246
           + +D R+ A+A         NF FQ +G     L+  DK I +D+        Y NN I 
Sbjct: 93  KLKDGRYVALARAFSFEETTNFPFQEEGFAGDILASYDKRIRSDLADLLEEPEYANNPIA 152

Query: 247 CVPIV--------SDQNYYKLAINSVSSFSDFLKDPKLFKM 279
              +         + + Y++  I SV+S  D +KD  L K+
Sbjct: 153 AETLEATVLDGLETTKTYFRETIGSVTSVDDLMKDNDLLKV 193



 Score = 37.7 bits (86), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 35/164 (21%), Positives = 71/164 (43%), Gaps = 18/164 (10%)

Query: 503 EVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFAN 562
           + +Y+   I  + S ++L+ ++R+L+  L + G+  Q      +  +     ++  + AN
Sbjct: 33  DTEYFKEKIGGVTSGDDLVNDRRLLSVALAAFGLSDQIDSAYLIKRVLNEGAENDDALAN 92

Query: 563 TYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD---TCDLYKHQMIEKKEEEKDP 619
             KD RY  +  +F+F+       ++ G   D     D     DL    ++E+ E   +P
Sbjct: 93  KLKDGRYVALARAFSFEETTNFPFQEEGFAGDILASYDKRIRSDL--ADLLEEPEYANNP 150

Query: 620 NIALAL-------------YFKRTIPNIRNHYEILGDSKLFKVV 650
             A  L             YF+ TI ++ +  +++ D+ L KV 
Sbjct: 151 IAAETLEATVLDGLETTKTYFRETIGSVTSVDDLMKDNDLLKVA 194


>gi|260428823|ref|ZP_05782800.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260419446|gb|EEX12699.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 399

 Score = 90.1 bits (222), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 83/309 (26%), Positives = 132/309 (42%), Gaps = 32/309 (10%)

Query: 384 NSAEEPI---ITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
           NSAEE +     L  AL A+ ++ Q   +  +R VL     D D+ ANK  D R   L  
Sbjct: 45  NSAEELVNDRRLLSVALSAFGMDDQIDSKYLIRRVLEEGTKDDDALANKLSDSRFTVLAE 104

Query: 441 AFNFNADGS--------IGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQIST 492
            F+F   G           PI     +  + D     A     + D E  +        T
Sbjct: 105 VFDFEKTGGYRMQEEGFADPIFAAYEKKVLADLEVKLAE-PEYVADPEYAAL-----FET 158

Query: 493 QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKS 552
           Q + N+EI+ E  Y+  NI +I S +ELL +  ++  ++ + GI+ ++  +  L  + + 
Sbjct: 159 QVKRNIEISRE--YFNDNIGSITSPDELLLDFDLMQVVMGAFGIEDRRGSKALLKRVLEE 216

Query: 553 DLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEK 612
              DP + AN   D R   +  +F+FD            +Q +   ++  + Y+ Q  E 
Sbjct: 217 GASDPNALANVLGDKRLIRLAEAFSFD-----KSVPTNALQADSFANNIVEQYRWQRFED 271

Query: 613 KEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLP 664
              E DP I  AL F+R+IP++           Y ILG +    VV   L L   F+ + 
Sbjct: 272 AVGEVDPAIGTALQFQRSIPDLATSDISDSAKWYSILGSTTSRSVVETALSLPKGFSQID 331

Query: 665 ERKKIRILK 673
             K++ ILK
Sbjct: 332 IDKQVEILK 340



 Score = 80.5 bits (197), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 94/213 (44%), Gaps = 25/213 (11%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           ++ +  Y++E+I  I++ +E + D+RL S AL AFG+ D   ++  I+++LE    D  +
Sbjct: 30  ITRDSEYFKEKIGTINSAEELVNDRRLLSVALSAFGMDDQIDSKYLIRRVLEEGTKDDDA 89

Query: 88  LVNQLNSLKYQYFARSYDFSPPPKV-IQSDIQHKTIIQDYKQSHQHKEEVALEE------ 140
           L N+L+  ++   A  +DF       +Q +     I   Y++      EV L E      
Sbjct: 90  LANKLSDSRFTVLAEVFDFEKTGGYRMQEEGFADPIFAAYEKKVLADLEVKLAEPEYVAD 149

Query: 141 ------------------SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
                              +YF  NI  I S D+L  D  L+  V+ +F I  +  S   
Sbjct: 150 PEYAALFETQVKRNIEISREYFNDNIGSITSPDELLLDFDLMQVVMGAFGIEDRRGSKAL 209

Query: 183 LKDVLTLGLANPKKYFIESRDNRFRAMAENFRF 215
           LK VL  G ++P        D R   +AE F F
Sbjct: 210 LKRVLEEGASDPNALANVLGDKRLIRLAEAFSF 242



 Score = 55.5 bits (132), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 56/114 (49%), Gaps = 3/114 (2%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           + LF T  K  I    E Y+ + I  I++ DE + D  L    + AFG+ D   ++  +K
Sbjct: 153 AALFETQVKRNIEISRE-YFNDNIGSITSPDELLLDFDLMQVVMGAFGIEDRRGSKALLK 211

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDF--SPPPKVIQSDIQHKTIIQDYK 127
           ++LE   SDP +L N L   +    A ++ F  S P   +Q+D     I++ Y+
Sbjct: 212 RVLEEGASDPNALANVLGDKRLIRLAEAFSFDKSVPTNALQADSFANNIVEQYR 265



 Score = 49.3 bits (116), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 47/91 (51%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           +S+YF++ I  INS ++L  DRRLL   L +F +  +  S   ++ VL  G  +      
Sbjct: 33  DSEYFKEKIGTINSAEELVNDRRLLSVALSAFGMDDQIDSKYLIRRVLEEGTKDDDALAN 92

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           +  D+RF  +AE F F+  G    +++   D
Sbjct: 93  KLSDSRFTVLAEVFDFEKTGGYRMQEEGFAD 123



 Score = 48.1 bits (113), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 49/92 (53%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           EI  + +Y+   I TI+S EEL+ ++R+L+  L + G+D Q   +  +  + +   KD  
Sbjct: 29  EITRDSEYFKEKIGTINSAEELVNDRRLLSVALSAFGMDDQIDSKYLIRRVLEEGTKDDD 88

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIG 590
           + AN   D+R+  +   F+F+  G    ++ G
Sbjct: 89  ALANKLSDSRFTVLAEVFDFEKTGGYRMQEEG 120


>gi|254500914|ref|ZP_05113065.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436985|gb|EEE43664.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 276

 Score = 89.4 bits (220), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 87/160 (54%), Gaps = 5/160 (3%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
            +TV+ DP+V  +  YYRE I++I ++D+F+ D R++ YA+ A GL DM +A+ F++K+L
Sbjct: 32  LATVAADPVVDRQTEYYRENIRNIKSVDDFMADDRIYRYAMTAMGLEDMIYAKAFMRKVL 91

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQD--YKQSHQHKEEV 136
               +   +  NQL   KY+ FA +++F+   +   S  + +  I D  ++Q+ + KE  
Sbjct: 92  TEGTASRAAFANQLADSKYRNFAETFNFANYGETATSFSRTQEGIVDKFHRQTLEVKEGA 151

Query: 137 ---ALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
               +  + YF +   +I     +  DR L + V  +  +
Sbjct: 152 QNDGVRLALYFERKASEITGPFDILADRALAETVRTALGL 191



 Score = 80.9 bits (198), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 84/177 (47%), Gaps = 6/177 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           ++ + +YY  NI  I S ++ +A+ RI  + + + G++     + F+ ++         +
Sbjct: 41  VDRQTEYYRENIRNIKSVDDFMADDRIYRYAMTAMGLEDMIYAKAFMRKVLTEGTASRAA 100

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
           FAN   D++Y+    +FNF  +GE +     + Q+        D +  Q +E KE  ++ 
Sbjct: 101 FANQLADSKYRNFAETFNFANYGE-TATSFSRTQEGI-----VDKFHRQTLEVKEGAQND 154

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHI 676
            + LALYF+R    I   ++IL D  L + V   L L   FA+    K+     KH+
Sbjct: 155 GVRLALYFERKASEITGPFDILADRALAETVRTALGLPDAFALTDIDKQAEYFDKHL 211



 Score = 48.5 bits (114), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           +++Y+R+NI  I SVD    D R+  Y + +  +     +  F++ VLT G A+   +  
Sbjct: 44  QTEYYRENIRNIKSVDDFMADDRIYRYAMTAMGLEDMIYAKAFMRKVLTEGTASRAAFAN 103

Query: 200 ESRDNRFRAMAENFRFQPDGSLS 222
           +  D+++R  AE F F   G  +
Sbjct: 104 QLADSKYRNFAETFNFANYGETA 126


>gi|27381994|ref|NP_773523.1| hypothetical protein blr6883 [Bradyrhizobium japonicum USDA 110]
 gi|27355164|dbj|BAC52148.1| blr6883 [Bradyrhizobium japonicum USDA 110]
          Length = 270

 Score = 89.0 bits (219), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 101/212 (47%), Gaps = 10/212 (4%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           SM Q++TQ     +++ E DY+  +I  + + ++ L + R+  + +++ G+      + F
Sbjct: 26  SMTQVATQP----DVSRETDYFLSHIGNVKTIDDFLKDYRLYTYAMKAYGLSDMTYAKAF 81

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++    + +  +FAN   D RY+E  ++FNF   G+ + +                 Y
Sbjct: 82  MRKVLTEGVSNKDAFANKLTDARYREFATAFNFAALGDKATQTTAATTGTATQ------Y 135

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
             Q +E+K  +++  + LALYF R    I N Y+IL D  L +VV   +  S   +    
Sbjct: 136 VTQTMEQKAGDQNEGLRLALYFTRKASTITNAYQILADKALTQVVQTAMGWSSTISSSDI 195

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
             + +++   I + DF+D  KV  F+    AM
Sbjct: 196 DAQAKMITDKIDLTDFQDPTKVTKFVQRFAAM 227



 Score = 87.0 bits (214), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 88/163 (53%), Gaps = 8/163 (4%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KD+  K  + V+  P VS E  Y+   I ++ TID+F+KD RL++YA+KA+GLSDM++A
Sbjct: 20  TKDL-GKSMTQVATQPDVSRETDYFLSHIGNVKTIDDFLKDYRLYTYAMKAYGLSDMTYA 78

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP------PPKVIQSDIQHKTIIQ 124
           + F++K+L   +S+  +  N+L   +Y+ FA +++F+             +    + + Q
Sbjct: 79  KAFMRKVLTEGVSNKDAFANKLTDARYREFATAFNFAALGDKATQTTAATTGTATQYVTQ 138

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYV 167
             +Q    + E  L  + YF +    I +  Q+  D+ L   V
Sbjct: 139 TMEQKAGDQNE-GLRLALYFTRKASTITNAYQILADKALTQVV 180



 Score = 49.7 bits (117), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 42/81 (51%)

Query: 139 EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYF 198
            E+ YF  +I  + ++D   KD RL  Y ++++ ++    +  F++ VLT G++N   + 
Sbjct: 38  RETDYFLSHIGNVKTIDDFLKDYRLYTYAMKAYGLSDMTYAKAFMRKVLTEGVSNKDAFA 97

Query: 199 IESRDNRFRAMAENFRFQPDG 219
            +  D R+R  A  F F   G
Sbjct: 98  NKLTDARYREFATAFNFAALG 118



 Score = 39.7 bits (91), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 45/91 (49%), Gaps = 14/91 (15%)

Query: 359 DYQLP-LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
           DY L  +G +K+ID+ L            +  + T  +A+ AY L+     +  +R VLT
Sbjct: 41  DYFLSHIGNVKTIDDFLK-----------DYRLYT--YAMKAYGLSDMTYAKAFMRKVLT 87

Query: 418 SNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
              S+ D++ANK  D R  +   AFNF A G
Sbjct: 88  EGVSNKDAFANKLTDARYREFATAFNFAALG 118


>gi|13472569|ref|NP_104136.1| hypothetical protein mlr2906 [Mesorhizobium loti MAFF303099]
 gi|14023315|dbj|BAB49922.1| mlr2906 [Mesorhizobium loti MAFF303099]
          Length = 210

 Score = 87.8 bits (216), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 52/177 (29%), Positives = 91/177 (51%), Gaps = 6/177 (3%)

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
           ++N R+  + L + G+DS    +  + ++ +  ++DP S AN  K+  Y  + S+FNF+ 
Sbjct: 1   MSNSRLYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQ 60

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
           +GE +   +   Q       T D Y  Q +E+     +  + LALYF+R  P+I + Y++
Sbjct: 61  YGENATTIVPAQQP------TVDKYMRQSLEEDAGNTNAGVRLALYFQRKAPDITSWYDV 114

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           L D+ L  VV   L L   FA     K+ ++ ++ + I+DF D  K+  FL    +M
Sbjct: 115 LADTALASVVRTALGLPDSFATADIDKQAQLFEQKLDISDFTDPVKLGKFLTRFTSM 171



 Score = 43.9 bits (102), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 35/58 (60%)

Query: 49  IKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF 106
           + + RL++YAL A+GL   +  +  IK++L+  + DP S+ N+  +  Y   A +++F
Sbjct: 1   MSNSRLYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNF 58



 Score = 38.5 bits (88), Expect = 4.7,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 28/54 (51%)

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
           +AL AY L+    D+  ++ VL     DP+S ANK K+     L  AFNF   G
Sbjct: 9   YALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQYG 62


>gi|158424043|ref|YP_001525335.1| hypothetical protein AZC_2419 [Azorhizobium caulinodans ORS 571]
 gi|158330932|dbj|BAF88417.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 325

 Score = 87.8 bits (216), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 96/207 (46%), Gaps = 14/207 (6%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           ++EQ +T     LE  +    +  +I +I S ++ + N R+  + +++ G++     + +
Sbjct: 89  ALEQEATTGSTKLETAN----FEKSIGSITSVDDFVNNYRVFTYAMKAYGLEDMAYAKAY 144

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE-LSHKKIGKVQDNFHIDDTCDL 604
           + ++ +SDL D  SFAN+  D R+K    +F    +GE +S   +  V+           
Sbjct: 145 MKKVLESDLTDDSSFANSLSDGRFKAFAQAFQSLTYGEAVSSDTVSTVETK--------- 195

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +E      D  + LALYFKR    + + Y IL D  L+KVV     +    +   
Sbjct: 196 YAQQTMEDNAGASDTGVQLALYFKRNASTVTSAYSILADEALYKVVKATYNIPDEMSNAG 255

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFL 691
              +  ++ KHI I + +D   V+  L
Sbjct: 256 IEAQAALISKHIDIEELQDPDYVDKLL 282



 Score = 84.3 bits (207), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 83/147 (56%), Gaps = 5/147 (3%)

Query: 31  EERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
           E   + + I  I+++D+F+ + R+F+YA+KA+GL DM++A+ ++KK+LESDL+D  S  N
Sbjct: 102 ETANFEKSIGSITSVDDFVNNYRVFTYAMKAYGLEDMAYAKAYMKKVLESDLTDDSSFAN 161

Query: 91  QLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQS----HQHKEEVALEESKYFRK 146
            L+  +++ FA+++      + + SD    T+   Y Q     +    +  ++ + YF++
Sbjct: 162 SLSDGRFKAFAQAFQSLTYGEAVSSDTV-STVETKYAQQTMEDNAGASDTGVQLALYFKR 220

Query: 147 NIHKINSVDQLFKDRRLLDYVLQSFSI 173
           N   + S   +  D  L   V  +++I
Sbjct: 221 NASTVTSAYSILADEALYKVVKATYNI 247



 Score = 48.9 bits (115), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 70/149 (46%), Gaps = 11/149 (7%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           E+  F K+I  I SVD    + R+  Y ++++ +     +  ++K VL   L +   +  
Sbjct: 102 ETANFEKSIGSITSVDDFVNNYRVFTYAMKAYGLEDMAYAKAYMKKVLESDLTDDSSFAN 161

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN---- 255
              D RF+A A+ F+     SL+  + + +D  +  + + Y   T++     SD      
Sbjct: 162 SLSDGRFKAFAQAFQ-----SLTYGEAVSSDT-VSTVETKYAQQTMEDNAGASDTGVQLA 215

Query: 256 -YYKLAINSVSSFSDFLKDPKLFKMLQLS 283
            Y+K   ++V+S    L D  L+K+++ +
Sbjct: 216 LYFKRNASTVTSAYSILADEALYKVVKAT 244


>gi|126031430|pdb|2O8S|A Chain A, X-Ray Crystal Structure Of Protein Agr_c_984 From
           Agrobacterium Tumefaciens. Northeast Structural Genomics
           Consortium Target Atr120.
 gi|126031431|pdb|2O8S|B Chain B, X-Ray Crystal Structure Of Protein Agr_c_984 From
           Agrobacterium Tumefaciens. Northeast Structural Genomics
           Consortium Target Atr120
          Length = 323

 Score = 87.0 bits (214), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 98/210 (46%), Gaps = 18/210 (8%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           S+E++S Q     ++  E +YY   I ++ S ++  A+ R+ N+ L++ G++     + F
Sbjct: 71  SLERVSKQP----DVARETEYYREKIGSVKSIDDFXADTRLYNYALKAHGLEDXAYAKAF 126

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNF----DIHGELSHKKIGKVQDNFHIDDT 601
           + ++      D  +FAN   DNRY E+  S +F             K G + +       
Sbjct: 127 IRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAAATATEAAKSGVIGN------- 179

Query: 602 CDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
              Y  Q +E++  + +  + LALYF+R  P I++  + L D  L +V      L   FA
Sbjct: 180 ---YARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTFNLPDAFA 236

Query: 662 VLPERKKIRILKKHIKINDFKDSKKVEDFL 691
                K+  +++K I I D +D +KV   L
Sbjct: 237 AADVDKQAALIEKSINIKDLQDPEKVGKLL 266



 Score = 84.0 bits (206), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 61/96 (63%), Gaps = 1/96 (1%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           S+DI  K    VSK P V+ E  YYRE+I  + +ID+F  D RL++YALKA GL D ++A
Sbjct: 65  SQDI-GKSLERVSKQPDVARETEYYREKIGSVKSIDDFXADTRLYNYALKAHGLEDXAYA 123

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF 106
           + FI+K+L    SD  +  N+L+  +Y   A+S DF
Sbjct: 124 KAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDF 159



 Score = 49.3 bits (116), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 103/234 (44%), Gaps = 25/234 (10%)

Query: 112 VIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           V  +   ++ I QD  +S +   K+     E++Y+R+ I  + S+D    D RL +Y L+
Sbjct: 54  VTSTYTSYRLISQDIGKSLERVSKQPDVARETEYYREKIGSVKSIDDFXADTRLYNYALK 113

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +  +     +  F++ VLT G ++   +  +  DNR+  +A++  F             T
Sbjct: 114 AHGLEDXAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFA----GLGAAATAT 169

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAI------NSVSSFSDFLKDPKLFKMLQLS 283
           +     ++ NY   T++      D N  +LA+       ++ S  DFL D  L ++ + +
Sbjct: 170 EAAKSGVIGNYARQTLE-QEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFR-T 227

Query: 284 LFPLNPEITA---DKFLTLMQEN-------DP-IVSQVKYFFQINFHRDNSSST 326
            F L     A   DK   L++++       DP  V ++   F I +   N S+T
Sbjct: 228 TFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLLERFTIXWEXQNPSTT 281


>gi|121601650|ref|YP_989406.1| hypothetical protein BARBAKC583_1147 [Bartonella bacilliformis
           KC583]
 gi|120613827|gb|ABM44428.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 264

 Score = 86.3 bits (212), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 99/202 (49%), Gaps = 20/202 (9%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  E DYY  NI ++ S +E LAN ++  + +++ G++     +  + ++    L DP+
Sbjct: 27  QVKRETDYYVRNIASVQSVDEFLANDKLYRYAMQAHGLEDMIYAKGMMRKV----LLDPR 82

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
            +A+   D RY++  ++FNF+++GE +       Q N     T + Y  Q +E +  + +
Sbjct: 83  -YASQLSDQRYQQFAAAFNFNLYGEKA------TQQNSAQTATVNKYMQQTLEVQVGQDN 135

Query: 619 PNIALALYFKRTIPNIRN---------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKI 669
               LALYF RT+  +            Y+ILGD  L  VV   L +     +     + 
Sbjct: 136 EGARLALYFTRTVGGMARDGLLSEKNWAYQILGDKALSAVVFTALDIPENVRLSKIEAQK 195

Query: 670 RILKKHIKINDFKDSKKVEDFL 691
            +L+  + + D KD K++E F+
Sbjct: 196 SLLESRMSLKDLKDPKRLEHFI 217



 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 68/129 (52%), Gaps = 6/129 (4%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   K    + K+P V  E  YY   I  + ++DEF+ + +L+ YA++
Sbjct: 1   MIGTYTSYRSTIDNMKKTLDRLLKEPQVKRETDYYVRNIASVQSVDEFLANDKLYRYAMQ 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A GL DM +A+  ++K+    L DP+   +QL+  +YQ FA +++F+    K  Q +   
Sbjct: 61  AHGLEDMIYAKGMMRKV----LLDPR-YASQLSDQRYQQFAAAFNFNLYGEKATQQNSAQ 115

Query: 120 KTIIQDYKQ 128
              +  Y Q
Sbjct: 116 TATVNKYMQ 124


>gi|114706759|ref|ZP_01439659.1| hypothetical protein FP2506_18124 [Fulvimarina pelagi HTCC2506]
 gi|114537707|gb|EAU40831.1| hypothetical protein FP2506_18124 [Fulvimarina pelagi HTCC2506]
          Length = 260

 Score = 85.5 bits (210), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 95/176 (53%), Gaps = 8/176 (4%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           S+D+ + L  T ++DP V    + Y E I  IS+IDEF+ + R++ YA+KA GL DM++A
Sbjct: 12  SRDLPASLERT-AQDPTVERASQRYLEEIGKISSIDEFLANDRVYRYAMKAMGLEDMTYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKV------IQSDIQHKTIIQ 124
           + F++K++E  + D ++  N+L   +Y+ FA +++F+   +        Q  I  K + Q
Sbjct: 71  KAFMRKVMEEGIDDREAFANKLTDSRYKDFAETFNFNRYGEAALAFERTQQGIVDKYVRQ 130

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
             +++   + E A   + YF +    + S   L  D  +L  +  +FSI  +  +L
Sbjct: 131 TLEENTGTESEGA-RLALYFERKASTVTSYYGLLADPAILKVMQTAFSIPAETGTL 185



 Score = 85.5 bits (210), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 90/186 (48%), Gaps = 7/186 (3%)

Query: 507 YTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKD 566
           Y   I  I S +E LAN R+  + +++ G++     + F+ ++ +  + D ++FAN   D
Sbjct: 35  YLEEIGKISSIDEFLANDRVYRYAMKAMGLEDMTYAKAFMRKVMEEGIDDREAFANKLTD 94

Query: 567 NRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALY 626
           +RYK+   +FNF+ +GE +     + Q         D Y  Q +E+    +     LALY
Sbjct: 95  SRYKDFAETFNFNRYGE-AALAFERTQQGI-----VDKYVRQTLEENTGTESEGARLALY 148

Query: 627 FKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHI-KINDFKDSK 685
           F+R    + ++Y +L D  + KV+     +      L   K+  + +K +  I D KD +
Sbjct: 149 FERKASTVTSYYGLLADPAILKVMQTAFSIPAETGTLDIDKQADLFRKALPNIEDLKDPQ 208

Query: 686 KVEDFL 691
           KV + L
Sbjct: 209 KVSELL 214



 Score = 47.0 bits (110), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 71/148 (47%), Gaps = 9/148 (6%)

Query: 141 SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
           S+ + + I KI+S+D+   + R+  Y +++  +     +  F++ V+  G+ + + +  +
Sbjct: 32  SQRYLEEIGKISSIDEFLANDRVYRYAMKAMGLEDMTYAKAFMRKVMEEGIDDREAFANK 91

Query: 201 SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN----- 255
             D+R++  AE F F   G  +    +  +   + IV  Y   T++       +      
Sbjct: 92  LTDSRYKDFAETFNFNRYGEAA----LAFERTQQGIVDKYVRQTLEENTGTESEGARLAL 147

Query: 256 YYKLAINSVSSFSDFLKDPKLFKMLQLS 283
           Y++   ++V+S+   L DP + K++Q +
Sbjct: 148 YFERKASTVTSYYGLLADPAILKVMQTA 175


>gi|319409193|emb|CBI82837.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 266

 Score = 85.1 bits (209), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 106/224 (47%), Gaps = 20/224 (8%)

Query: 483 SFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVR 542
           + ++M+Q S+Q     ++  E DYY  +I  I S ++ LA+ RI  + +++ G++     
Sbjct: 11  TIDNMKQTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDRIYRYAMKAYGLEDMIYA 70

Query: 543 EDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTC 602
           +  + ++    L DP  +A+   D RY++  ++FNF ++GE +       Q       T 
Sbjct: 71  KGMMRKV----LSDP-DYASQLTDRRYQQFAAAFNFSVYGEEA------TQRESAKTGTV 119

Query: 603 DLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNH---------YEILGDSKLFKVVSKK 653
           + Y  Q +E K  E++    LALYF RTI  +            Y+ILGD  L  VV   
Sbjct: 120 NKYMQQTLEIKVGEENEGTRLALYFTRTIGEMTKSGVLSEKSWAYQILGDKALSAVVFTA 179

Query: 654 LKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           L +           +  +L+  + + D +D KK+E F+    AM
Sbjct: 180 LNIPESVRSSKIEAQKSLLESRMSLGDLEDPKKLEQFIARFSAM 223



 Score = 67.8 bits (164), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 107/231 (46%), Gaps = 30/231 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++++   + D   +  S +  +P V  E  YY   I  I ++D+F+ D R++ YA+K
Sbjct: 1   MISTYMSYRSTIDNMKQTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDRIYRYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM +A+  ++K+    LSDP    +QL   +YQ FA +++FS    +  Q +   
Sbjct: 61  AYGLEDMIYAKGMMRKV----LSDP-DYASQLTDRRYQQFAAAFNFSVYGEEATQRESAK 115

Query: 120 KTIIQDYKQSHQH----KEEVALEESKYFRKNIHKINSVD---------QLFKDRRLLDY 166
              +  Y Q        +E      + YF + I ++             Q+  D+ L   
Sbjct: 116 TGTVNKYMQQTLEIKVGEENEGTRLALYFTRTIGEMTKSGVLSEKSWAYQILGDKALSAV 175

Query: 167 VLQSFSITPKYISL-------PFLKDVLTLG-LANPKKYFIESRDNRFRAM 209
           V  + +I P+ +           L+  ++LG L +PKK  +E    RF AM
Sbjct: 176 VFTALNI-PESVRSSKIEAQKSLLESRMSLGDLEDPKK--LEQFIARFSAM 223


>gi|163850120|ref|YP_001638163.1| hypothetical protein Mext_0680 [Methylobacterium extorquens PA1]
 gi|163661725|gb|ABY29092.1| protein of unknown function DUF1217 [Methylobacterium extorquens
           PA1]
          Length = 417

 Score = 84.3 bits (207), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KD+ + L S  + +P+V+ E  YY   I  + T+D+ + D+RL++YA+KA+GL DM++A
Sbjct: 12  AKDLPASL-SRKAAEPMVARETAYYEAHIGRVKTVDDLLGDQRLYAYAMKAYGLEDMTYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD 116
           + F++K+LE   +   S  N+L   +Y  FA+++ F        +D
Sbjct: 71  KAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGAD 116



 Score = 52.0 bits (123), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 3/90 (3%)

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL-SPYFAVL 663
           Y  Q +E +  + D  + LALYF R    I + Y+ILGD+ L +V +  + L +   A  
Sbjct: 285 YLRQSLESEAGDADTGVRLALYFARKASTIASAYDILGDAALSQVANTVIGLPATSGAAT 344

Query: 664 PE--RKKIRILKKHIKINDFKDSKKVEDFL 691
            E   K+ +++   I I  F+D  K++ F+
Sbjct: 345 SEALAKRAQLIAGKIDIASFRDPAKLDAFV 374



 Score = 50.1 bits (118), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 45/87 (51%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           S +  E +   E+ Y+  +I ++ +VD L  D+RL  Y ++++ +     +  F++ VL 
Sbjct: 20  SRKAAEPMVARETAYYEAHIGRVKTVDDLLGDQRLYAYAMKAYGLEDMTYAKAFMRKVLE 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRF 215
            G A+   +     D+R+ A A+ F F
Sbjct: 80  EGAASAASFANRLADDRYTAFAKAFSF 106



 Score = 46.2 bits (108), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 41/79 (51%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  +I  + + ++LL ++R+  + +++ G++     + F+ ++ +       S
Sbjct: 28  VARETAYYEAHIGRVKTVDDLLGDQRLYAYAMKAYGLEDMTYAKAFMRKVLEEGAASAAS 87

Query: 560 FANTYKDNRYKEIISSFNF 578
           FAN   D+RY     +F+F
Sbjct: 88  FANRLADDRYTAFAKAFSF 106


>gi|325291946|ref|YP_004277810.1| hypothetical protein AGROH133_03954 [Agrobacterium sp. H13-3]
 gi|325059799|gb|ADY63490.1| hypothetical protein AGROH133_03954 [Agrobacterium sp. H13-3]
          Length = 259

 Score = 84.0 bits (206), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 63/97 (64%), Gaps = 1/97 (1%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           S+DI  K    VSK P V+ E  YYR +I  + ++D+F+ D RL++YALKA GL DM++A
Sbjct: 12  SQDI-GKSLERVSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYALKANGLEDMAYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS 107
           + FI+K+L    +D  +  N+L+  +Y   A+S DF+
Sbjct: 71  KAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFA 107



 Score = 80.9 bits (198), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 96/206 (46%), Gaps = 10/206 (4%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           S+E++S Q     ++  E +YY   I ++ S ++ +A+ R+ N+ L++ G++     + F
Sbjct: 18  SLERVSKQP----DVARETEYYRSKIGSVKSVDDFMADTRLYNYALKANGLEDMAYAKAF 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++      D  +FAN   D+RY ++  S +F   G  +       Q           Y
Sbjct: 74  IRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATATE-AAQSGI-----ISKY 127

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
             Q +E++    +  + LALYF+R  P I++  + L D  L +V      L    A    
Sbjct: 128 TRQTLEQEAGGDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTAYNLPDEIAAGSV 187

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFL 691
            K+  +++K I I D ++ +KV   L
Sbjct: 188 EKQAALIEKSINIKDLQNPEKVGKLL 213



 Score = 51.6 bits (122), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 84/183 (45%), Gaps = 14/183 (7%)

Query: 119 HKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
           ++ I QD  +S +   K+     E++Y+R  I  + SVD    D RL +Y L++  +   
Sbjct: 8   YRLISQDIGKSLERVSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYALKANGLEDM 67

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKI 236
             +  F++ VLT G A+   +  +  D+R+  +A++  F    SL          Q   I
Sbjct: 68  AYAKAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDF---ASLGAAATATEAAQ-SGI 123

Query: 237 VSNYFNNTIDCVPIVSDQNYYKLAIN------SVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
           +S Y   T++      D N  +LA+       ++ S  DFL D  L ++ + + + L  E
Sbjct: 124 ISKYTRQTLEQ-EAGGDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTA-YNLPDE 181

Query: 291 ITA 293
           I A
Sbjct: 182 IAA 184


>gi|254559265|ref|YP_003066360.1| hypothetical protein METDI0661 [Methylobacterium extorquens DM4]
 gi|254266543|emb|CAX22307.1| hypothetical protein METDI0661 [Methylobacterium extorquens DM4]
          Length = 417

 Score = 83.2 bits (204), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 65/106 (61%), Gaps = 1/106 (0%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KD+ + L S  + +P+V+ E  YY   I  + T+D+ + D+RL++YA+KA+GL +M++A
Sbjct: 12  AKDLPASL-SRKAAEPMVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMKAYGLEEMTYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD 116
           + F++K+LE   +   S  N+L   +Y  FA+++ F        +D
Sbjct: 71  KAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGAD 116



 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 80/366 (21%), Positives = 134/366 (36%), Gaps = 60/366 (16%)

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +G++K++D+LL G  +L              +A+ AY L      +  +R VL   
Sbjct: 35  YEAHIGQVKTVDDLL-GDQRL------------YAYAMKAYGLEEMTYAKAFMRKVLEEG 81

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            +   S+AN+  DDR      AF+F            Q       +   +  + R+   +
Sbjct: 82  AASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPARFGEQARAASLS 130

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN----------- 528
             K        S +   +  + S +D  T    TI    + LA  R+ N           
Sbjct: 131 APKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAG-RVANPAKVTPAEIAA 189

Query: 529 ------FLLESKGIDSQKVRED---FLCEIFKSDLKDPKSFANT--YKDNRYKEIISSFN 577
                      KG     +  D   F      +DL    ++  T  Y D       S+  
Sbjct: 190 AVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYADTLVNAGGSNRT 249

Query: 578 FDI-HGELSHKKIGKVQDNFHID--------DTCDLYKHQMIEKKEEEKDPNIALALYFK 628
             I +  LS  +   V   F  D             Y  Q +E +  + D  + LALYF 
Sbjct: 250 LTIRNAALSANRT-AVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDADTGVRLALYFA 308

Query: 629 RTIPNIRNHYEILGDSKLFKVVSKKLKL-SPYFAVLPE--RKKIRILKKHIKINDFKDSK 685
           R    + + Y+ILGD+ L +V +  + L +   A   E   K+ +++   I I  F+D  
Sbjct: 309 RKASTLTSAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIAGKIDIASFRDPA 368

Query: 686 KVEDFL 691
           K++ F+
Sbjct: 369 KLDAFV 374



 Score = 50.1 bits (118), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 45/87 (51%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           S +  E +   E+ Y+  +I ++ +VD L  D+RL  Y ++++ +     +  F++ VL 
Sbjct: 20  SRKAAEPMVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMKAYGLEEMTYAKAFMRKVLE 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRF 215
            G A+   +     D+R+ A A+ F F
Sbjct: 80  EGAASAASFANRLADDRYTAFAKAFSF 106



 Score = 46.6 bits (109), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 41/80 (51%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  +I  + + ++LL ++R+  + +++ G++     + F+ ++ +       S
Sbjct: 28  VARETAYYEAHIGQVKTVDDLLGDQRLYAYAMKAYGLEEMTYAKAFMRKVLEEGAASAAS 87

Query: 560 FANTYKDNRYKEIISSFNFD 579
           FAN   D+RY     +F+F 
Sbjct: 88  FANRLADDRYTAFAKAFSFG 107


>gi|23011439|ref|ZP_00051796.1| hypothetical protein Magn03006068 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 325

 Score = 82.8 bits (203), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 56/85 (65%)

Query: 23  SKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDL 82
           + DP+V+ E  YY   I  + ++D+ + D+RL++YA+KA+GL +M++A+ F++K+LE   
Sbjct: 23  AADPVVARETAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEEMTYAKAFMRKVLEEGA 82

Query: 83  SDPKSLVNQLNSLKYQYFARSYDFS 107
           +   S  N+L   +Y  FAR++ F 
Sbjct: 83  ASSASFANRLADDRYTAFARAFTFG 107



 Score = 50.1 bits (118), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 49/99 (49%), Gaps = 2/99 (2%)

Query: 119 HKTIIQDYKQSHQHKEE--VALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
           ++ I +D   S + K    V   E+ Y+  +I ++ SVD L  D+RL  Y ++++ +   
Sbjct: 8   YRLIAKDLTASLKRKAADPVVARETAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEEM 67

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRF 215
             +  F++ VL  G A+   +     D+R+ A A  F F
Sbjct: 68  TYAKAFMRKVLEEGAASSASFANRLADDRYTAFARAFTF 106



 Score = 47.4 bits (111), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 40/79 (50%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  +I  + S ++LL ++R+  + +++ G++     + F+ ++ +       S
Sbjct: 28  VARETAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEEMTYAKAFMRKVLEEGAASSAS 87

Query: 560 FANTYKDNRYKEIISSFNF 578
           FAN   D+RY     +F F
Sbjct: 88  FANRLADDRYTAFARAFTF 106


>gi|288962700|ref|YP_003452994.1| flagellar basal-body rod protein [Azospirillum sp. B510]
 gi|288914966|dbj|BAI76450.1| flagellar basal-body rod protein [Azospirillum sp. B510]
          Length = 263

 Score = 82.8 bits (203), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 96/198 (48%), Gaps = 6/198 (3%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +   + Y+  NI  I S E+ + + ++  F+L++  + SQ      + ++ +  + D  S
Sbjct: 27  VQRAISYFQDNIGKITSTEDFMKDDKLYRFVLDAFDLGSQARSRGLIRKVLEEGVGDKSS 86

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   D++++E+ +   F  +   + KK   VQ         D Y    +E + E+++P
Sbjct: 87  TANRMSDSKFREMATILGFAENQGDNLKKPAVVQA------IIDRYVAVTLEVESEDRNP 140

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
            + L LYF+R   NI N Y+++ D+ L KVV   L L    A+L   K+  +L+K + I 
Sbjct: 141 AVRLGLYFQRRSANISNWYQVMADNALRKVVYTALGLPEQTALLDVDKQKALLEKRMDIA 200

Query: 680 DFKDSKKVEDFLYAAKAM 697
           D K   KV   L    AM
Sbjct: 201 DLKKPDKVAKLLDRFAAM 218



 Score = 56.6 bits (135), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 75/167 (44%), Gaps = 10/167 (5%)

Query: 21  TVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILES 80
            V   P V     Y+++ I  I++ ++F+KD +L+ + L AF L   + +   I+K+LE 
Sbjct: 20  AVRSRPAVQRAISYFQDNIGKITSTEDFMKDDKLYRFVLDAFDLGSQARSRGLIRKVLEE 79

Query: 81  DLSDPKSLVNQLNSLKYQYFARSYDFSP-------PPKVIQSDIQHKTIIQDYKQSHQHK 133
            + D  S  N+++  K++  A    F+         P V+Q+ I     +    +S    
Sbjct: 80  GVGDKSSTANRMSDSKFREMATILGFAENQGDNLKKPAVVQAIIDRYVAVTLEVESEDRN 139

Query: 134 EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
             V L    YF++    I++  Q+  D  L   V  +  + P+  +L
Sbjct: 140 PAVRL--GLYFQRRSANISNWYQVMADNALRKVVYTALGL-PEQTAL 183



 Score = 44.3 bits (103), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 77/173 (44%), Gaps = 12/173 (6%)

Query: 126 YKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
           Y Q+ + +  V    S YF+ NI KI S +   KD +L  +VL +F +  +  S   ++ 
Sbjct: 17  YDQAVRSRPAVQRAIS-YFQDNIGKITSTEDFMKDDKLYRFVLDAFDLGSQARSRGLIRK 75

Query: 186 VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI 245
           VL  G+ +         D++FR MA    F  +    + D +     ++ I+  Y   T+
Sbjct: 76  VLEEGVGDKSSTANRMSDSKFREMATILGFAEN----QGDNLKKPAVVQAIIDRYVAVTL 131

Query: 246 -----DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITA 293
                D  P V    Y++    ++S++   + D  L K++  +L    PE TA
Sbjct: 132 EVESEDRNPAVRLGLYFQRRSANISNWYQVMADNALRKVVYTALGL--PEQTA 182


>gi|218528724|ref|YP_002419540.1| hypothetical protein Mchl_0691 [Methylobacterium chloromethanicum
           CM4]
 gi|218521027|gb|ACK81612.1| protein of unknown function DUF1217 [Methylobacterium
           chloromethanicum CM4]
          Length = 417

 Score = 82.4 bits (202), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KD+ + L S  + +P V+ E  YY   I  + ++D+ + D+RL++YA+KA+GL DM++A
Sbjct: 12  AKDLPASL-SRKAAEPTVARETAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEDMTYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD 116
           + F++K+LE   +   S  N+L   +Y  FA+++ F        +D
Sbjct: 71  KAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGAD 116



 Score = 64.3 bits (155), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 82/366 (22%), Positives = 134/366 (36%), Gaps = 60/366 (16%)

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +G++KS+D+LL G  +L              +A+ AY L      +  +R VL   
Sbjct: 35  YEAHIGQVKSVDDLL-GDQRL------------YAYAMKAYGLEDMTYAKAFMRKVLEEG 81

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            +   S+AN+  DDR      AF+F            Q       +   +  + R+   +
Sbjct: 82  AASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPARFGEQARAASLS 130

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN----------- 528
             K        S +   +  + S +D  T    TI    + LA  R+ N           
Sbjct: 131 APKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAG-RVANPAKVTPAEIAA 189

Query: 529 ------FLLESKGIDSQKVRED---FLCEIFKSDLKDPKSFANT--YKDNRYKEIISSFN 577
                      KG     +  D   F      +DL    ++  T  Y D       S+  
Sbjct: 190 AVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYADTLVNAGGSNRT 249

Query: 578 FDI-HGELSHKKIGKVQDNFHID--------DTCDLYKHQMIEKKEEEKDPNIALALYFK 628
             I +  LS  +   V   F  D             Y  Q +E +  + D  + LALYF 
Sbjct: 250 LTIRNAALSANRT-AVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDADTGVRLALYFA 308

Query: 629 RTIPNIRNHYEILGDSKLFKVVSKKLKL-SPYFAVLPE--RKKIRILKKHIKINDFKDSK 685
           R    I + Y+ILGD+ L +V +  + L +   A   E   K+ +++   I I  F+D  
Sbjct: 309 RKASTIASAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIAGKIDIASFRDPA 368

Query: 686 KVEDFL 691
           K++ F+
Sbjct: 369 KLDAFV 374



 Score = 50.4 bits (119), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           S +  E     E+ Y+  +I ++ SVD L  D+RL  Y ++++ +     +  F++ VL 
Sbjct: 20  SRKAAEPTVARETAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEDMTYAKAFMRKVLE 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRF 215
            G A+   +     D+R+ A A+ F F
Sbjct: 80  EGAASAASFANRLADDRYTAFAKAFSF 106



 Score = 47.0 bits (110), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 41/79 (51%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  +I  + S ++LL ++R+  + +++ G++     + F+ ++ +       S
Sbjct: 28  VARETAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEDMTYAKAFMRKVLEEGAASAAS 87

Query: 560 FANTYKDNRYKEIISSFNF 578
           FAN   D+RY     +F+F
Sbjct: 88  FANRLADDRYTAFAKAFSF 106


>gi|158422870|ref|YP_001524162.1| hypothetical protein AZC_1246 [Azorhizobium caulinodans ORS 571]
 gi|158329759|dbj|BAF87244.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 303

 Score = 81.3 bits (199), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 92/193 (47%), Gaps = 8/193 (4%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           + +++ Y+  NI  + + +E + N R+ NF + + G+      + ++ ++  SDL D  S
Sbjct: 71  VKNDIAYFRANITKVKTVDEFVGNYRLFNFAMNAFGLSEMANAKAYMKKVLNSDLSDSSS 130

Query: 560 FANTYKDNRYKEIISSF-NFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           F N   D+++K    +F N +    L+             DD    Y +Q IE +  + D
Sbjct: 131 FVNKLADDKFKVFARAFSNLNPTNALTTVPA-------TADDVVGYYLNQSIETELGQTD 183

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKI 678
             + LALYFKR    I++ Y ILGD  L+KVV     L      +   ++ RI+   + +
Sbjct: 184 QGVQLALYFKRNAATIKSAYSILGDPALYKVVKTVFNLPDNMGKVDIAQQKRIVDAKLNV 243

Query: 679 NDFKDSKKVEDFL 691
           ND +D  KV   L
Sbjct: 244 NDLQDPTKVNKLL 256



 Score = 77.4 bits (189), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 87/158 (55%), Gaps = 5/158 (3%)

Query: 21  TVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILES 80
           T + +PIV  +  Y+R  I  + T+DEF+ + RLF++A+ AFGLS+M++A+ ++KK+L S
Sbjct: 64  TKAAEPIVKNDIAYFRANITKVKTVDEFVGNYRLFNFAMNAFGLSEMANAKAYMKKVLNS 123

Query: 81  DLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEV---- 136
           DLSD  S VN+L   K++ FAR++    P   + +       +  Y  +   + E+    
Sbjct: 124 DLSDSSSFVNKLADDKFKVFARAFSNLNPTNALTTVPATADDVVGYYLNQSIETELGQTD 183

Query: 137 -ALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
             ++ + YF++N   I S   +  D  L   V   F++
Sbjct: 184 QGVQLALYFKRNAATIKSAYSILGDPALYKVVKTVFNL 221



 Score = 49.7 bits (117), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 73/157 (46%), Gaps = 11/157 (7%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
           +  E +   +  YFR NI K+ +VD+   + RL ++ + +F ++    +  ++K VL   
Sbjct: 65  KAAEPIVKNDIAYFRANITKVKTVDEFVGNYRLFNFAMNAFGLSEMANAKAYMKKVLNSD 124

Query: 191 LANPKKYFIESRDNRFRAMAENF-RFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP 249
           L++   +  +  D++F+  A  F    P  +L+       D     +V  Y N +I+   
Sbjct: 125 LSDSSSFVNKLADDKFKVFARAFSNLNPTNALTTVPATADD-----VVGYYLNQSIETEL 179

Query: 250 IVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQ 281
             +DQ      Y+K    ++ S    L DP L+K+++
Sbjct: 180 GQTDQGVQLALYFKRNAATIKSAYSILGDPALYKVVK 216


>gi|188579922|ref|YP_001923367.1| hypothetical protein Mpop_0654 [Methylobacterium populi BJ001]
 gi|179343420|gb|ACB78832.1| protein of unknown function DUF1217 [Methylobacterium populi BJ001]
          Length = 417

 Score = 81.3 bits (199), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KD+ + L +  + +P V+ E  YY   I  + T+D+ + D+RL++YA+KA+GL +M++A
Sbjct: 12  AKDLPASL-ARKAAEPTVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMKAYGLEEMTYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD 116
           + F++K+LE   +   S  N+L   +Y  FA+++ F        +D
Sbjct: 71  KAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVSATGAD 116



 Score = 68.9 bits (167), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/371 (22%), Positives = 140/371 (37%), Gaps = 70/371 (18%)

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +G++K++D+LL G  +L              +A+ AY L      +  +R VL   
Sbjct: 35  YEAHIGQVKTVDDLL-GDQRL------------YAYAMKAYGLEEMTYAKAFMRKVLEEG 81

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            +   S+AN+  DDR      AF+F            Q       +   +  R R+   +
Sbjct: 82  AASAASFANRLADDRYTAFAKAFSFG-----------QGVSATGADAARFGERARAATLS 130

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
             K        S +   +  + S +D  T    TI    + LA  R+ +    SK +   
Sbjct: 131 APKLLADAYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAG-RVQDL---SK-VTPS 185

Query: 540 KVREDFLCEIFKSDLK---------------DPKSFANTYKDNRYKEIISSFNFDI---- 580
           ++      +I  SDLK               +  +  +   D  Y    S  N D     
Sbjct: 186 EIATAVAAQIEGSDLKGKVQAGLAADGSLFFETTALTDLGADGAYGG--SGLNADTLVSA 243

Query: 581 HGELSHKKIGKV---QDNFHID---------DTCDL-----YKHQMIEKKEEEKDPNIAL 623
            G +    I  V    D   +D         DT  L     Y  Q +E    + D  + L
Sbjct: 244 GGAIRTLAIRNVPLSADRTAVDVGFGTDLGPDTMALTVTQAYLRQSLESDAGDTDTGVRL 303

Query: 624 ALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL-SPYFAVLPE--RKKIRILKKHIKIND 680
           ALYF R  P++ + Y+ILGD+ L +V +  + L +   A   E   K+ +++   I I  
Sbjct: 304 ALYFARKGPSLSSAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIADKIDIAG 363

Query: 681 FKDSKKVEDFL 691
            +D  K++ FL
Sbjct: 364 LRDPAKLDAFL 374



 Score = 49.7 bits (117), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 52/110 (47%), Gaps = 2/110 (1%)

Query: 119 HKTIIQDYKQSHQHK--EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
           ++ I +D   S   K  E     E+ Y+  +I ++ +VD L  D+RL  Y ++++ +   
Sbjct: 8   YRLIAKDLPASLARKAAEPTVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMKAYGLEEM 67

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDK 226
             +  F++ VL  G A+   +     D+R+ A A+ F F    S +  D 
Sbjct: 68  TYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVSATGADA 117



 Score = 46.2 bits (108), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 41/79 (51%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E  YY  +I  + + ++LL ++R+  + +++ G++     + F+ ++ +       S
Sbjct: 28  VARETAYYEAHIGQVKTVDDLLGDQRLYAYAMKAYGLEEMTYAKAFMRKVLEEGAASAAS 87

Query: 560 FANTYKDNRYKEIISSFNF 578
           FAN   D+RY     +F+F
Sbjct: 88  FANRLADDRYTAFAKAFSF 106


>gi|240137254|ref|YP_002961723.1| hypothetical protein MexAM1_META1p0505 [Methylobacterium extorquens
           AM1]
 gi|240007220|gb|ACS38446.1| hypothetical protein MexAM1_META1p0505 [Methylobacterium extorquens
           AM1]
          Length = 417

 Score = 80.5 bits (197), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KD+ + L S  + +P V+ E  YY   I  + ++D+ + D+RL++YA+KA+GL DM++A
Sbjct: 12  AKDLPASL-SRKAAEPTVAREIAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEDMTYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD 116
           + F++K+LE   +   S  N+L   +Y  FA+++ F        +D
Sbjct: 71  KAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGAD 116



 Score = 52.8 bits (125), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 49/90 (54%), Gaps = 3/90 (3%)

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL-SPYFAVL 663
           Y  Q +E +  + D  + LALYF R   +I + Y+ILGD+ L +V +  + L +   A  
Sbjct: 285 YLRQSLESEAGDADTGVRLALYFARKASSIASAYDILGDAALSQVANTVIGLPATSGAAT 344

Query: 664 PE--RKKIRILKKHIKINDFKDSKKVEDFL 691
            E   K+ +++ + I I  F+D  K++ F+
Sbjct: 345 SEALAKRAQLIDRKIDIASFRDPAKLDAFV 374



 Score = 48.5 bits (114), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 43/87 (49%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           S +  E     E  Y+  +I ++ SVD L  D+RL  Y ++++ +     +  F++ VL 
Sbjct: 20  SRKAAEPTVAREIAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEDMTYAKAFMRKVLE 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRF 215
            G A+   +     D+R+ A A+ F F
Sbjct: 80  EGAASAASFANRLADDRYTAFAKAFSF 106



 Score = 48.1 bits (113), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 42/79 (53%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  E+ YY  +I  + S ++LL ++R+  + +++ G++     + F+ ++ +       S
Sbjct: 28  VAREIAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEDMTYAKAFMRKVLEEGAASAAS 87

Query: 560 FANTYKDNRYKEIISSFNF 578
           FAN   D+RY     +F+F
Sbjct: 88  FANRLADDRYTAFAKAFSF 106


>gi|209963548|ref|YP_002296463.1| hypothetical protein RC1_0201 [Rhodospirillum centenum SW]
 gi|209957014|gb|ACI97650.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 508

 Score = 79.3 bits (194), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 55/83 (66%)

Query: 25  DPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSD 84
           DP+   + +Y R ++  + T+DE + D+RL+SY ++AFGL D  +++  ++KIL SDLSD
Sbjct: 39  DPVNKADTQYARAKLASVGTVDELMSDRRLYSYVMRAFGLEDQINSQALVRKILTSDLSD 98

Query: 85  PKSLVNQLNSLKYQYFARSYDFS 107
           P S  N++   +++  A +++F 
Sbjct: 99  PSSAANRIADPRFRELAAAFNFG 121



 Score = 73.9 bits (180), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 78/149 (52%), Gaps = 5/149 (3%)

Query: 502 SEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFA 561
           ++  Y    + ++ + +EL++++R+ ++++ + G++ Q   +  + +I  SDL DP S A
Sbjct: 44  ADTQYARAKLASVGTVDELMSDRRLYSYVMRAFGLEDQINSQALVRKILTSDLSDPSSAA 103

Query: 562 NTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNI 621
           N   D R++E+ ++FNF      +  K         I+   DLY  +  E+    K+ ++
Sbjct: 104 NRIADPRFRELAAAFNFG-----ADSKSKSKTSPSFINQIADLYVRERYEESVSSKNESL 158

Query: 622 ALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            + L F R +P  R+  E++ D  + +VV
Sbjct: 159 GMMLDFTRNLPTKRSWAEVMADEGMAQVV 187



 Score = 55.1 bits (131), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 88/197 (44%), Gaps = 11/197 (5%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++ S+V   T  I T+ S ++LL ++++L  +L++  ++ +   + +L ++ +SD     
Sbjct: 272 DVKSDVAALTKTIPTLDSVDDLLNDRKLLPIVLKAFDLEDKATDKTYLRKVLESDPNSAT 331

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           SFA        K +  +F     G    K+ G       ++D  + Y  Q  E      +
Sbjct: 332 SFAAKAGPEE-KALALAFGMTNSG---AKRRGSPA---FVEDIVNRYTTQSFEVSAGNAN 384

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKI 678
             + L LYF+R    + + Y++L D  L KV    L L    A +   +++ +L   + I
Sbjct: 385 EALRLGLYFQRKAGGLTSWYQVLADQALAKVARLALNLPSQSAQIDLDRQVDMLSSKLDI 444

Query: 679 NDFKD----SKKVEDFL 691
              +D     K +E FL
Sbjct: 445 KKLQDPAEVGKLIEKFL 461



 Score = 55.1 bits (131), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 72/347 (20%), Positives = 152/347 (43%), Gaps = 43/347 (12%)

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
           D +++    + V   +++Y R  +  + +VD+L  DRRL  YV+++F +  +  S   ++
Sbjct: 30  DRQKTVMMSDPVNKADTQYARAKLASVGTVDELMSDRRLYSYVMRAFGLEDQINSQALVR 89

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKI-----LTDMQIEKIVSN 239
            +LT  L++P        D RFR +A  F F  D     +        + D+ + +    
Sbjct: 90  KILTSDLSDPSSAANRIADPRFRELAAAFNFGADSKSKSKTSPSFINQIADLYVRERYEE 149

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF----PLNPEITADK 295
             ++  + + ++ D   +   + +  S+++ + D  + +++++ ++    P+ P   A++
Sbjct: 150 SVSSKNESLGMMLD---FTRNLPTKRSWAEVMADEGMAQVVRI-IYDLPKPIGPVDAAEQ 205

Query: 296 FLTLMQEND----PIVSQVKYFFQINFH---------RDNSSSTKIQQDSQIQKMLDLYK 342
             +L           V+ V+  F+ +F          R +S  +K+Q +  + +  D  K
Sbjct: 206 AKSLEATIKFSVFTTVTSVQSAFRDDFFDVWDANGNPRGSSIPSKVQWE-MLARSYDREK 264

Query: 343 KNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNL 402
                 +D K         +P   + S+D+LL+ +  L        PI+     L A++L
Sbjct: 265 AAFATRYDVKSDVAALTKTIP--TLDSVDDLLNDRKLL--------PIV-----LKAFDL 309

Query: 403 NMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGS 449
             +  D+  LR VL S+P+   S+A K+  +    L  AF     G+
Sbjct: 310 EDKATDKTYLRKVLESDPNSATSFAAKAGPEE-KALALAFGMTNSGA 355



 Score = 43.5 bits (101), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 60/131 (45%), Gaps = 8/131 (6%)

Query: 39  IKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN----- 93
           I  + ++D+ + D++L    LKAF L D +  + +++K+LESD +   S   +       
Sbjct: 284 IPTLDSVDDLLNDRKLLPIVLKAFDLEDKATDKTYLRKVLESDPNSATSFAAKAGPEEKA 343

Query: 94  -SLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKIN 152
            +L +            P  ++ DI ++   Q ++ S  +  E AL    YF++    + 
Sbjct: 344 LALAFGMTNSGAKRRGSPAFVE-DIVNRYTTQSFEVSAGNANE-ALRLGLYFQRKAGGLT 401

Query: 153 SVDQLFKDRRL 163
           S  Q+  D+ L
Sbjct: 402 SWYQVLADQAL 412



 Score = 38.5 bits (88), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 78/195 (40%), Gaps = 30/195 (15%)

Query: 95  LKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSV 154
           ++++  ARSYD        + D+               K +VA        K I  ++SV
Sbjct: 251 VQWEMLARSYDREKAAFATRYDV---------------KSDVA-----ALTKTIPTLDSV 290

Query: 155 DQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
           D L  DR+LL  VL++F +  K     +L+ VL     N    F        +A+A  F 
Sbjct: 291 DDLLNDRKLLPIVLKAFDLEDKATDKTYLRKVLESD-PNSATSFAAKAGPEEKALALAFG 349

Query: 215 FQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSD 269
               G+  +         +E IV+ Y   + +     +++      Y++     ++S+  
Sbjct: 350 MTNSGAKRRGSPAF----VEDIVNRYTTQSFEVSAGNANEALRLGLYFQRKAGGLTSWYQ 405

Query: 270 FLKDPKLFKMLQLSL 284
            L D  L K+ +L+L
Sbjct: 406 VLADQALAKVARLAL 420


>gi|170744540|ref|YP_001773195.1| hypothetical protein M446_6503 [Methylobacterium sp. 4-46]
 gi|168198814|gb|ACA20761.1| protein of unknown function DUF1217 [Methylobacterium sp. 4-46]
          Length = 414

 Score = 77.4 bits (189), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 52/75 (69%)

Query: 23 SKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDL 82
          + DP+V+ +  YY   I  + ++D+ + D+RL++YA+KA+GL DM++A+ F++K+LE  +
Sbjct: 23 AADPVVARDTAYYEANIGKVKSVDDLMADQRLYAYAMKAYGLEDMTYAKAFMRKVLEGGV 82

Query: 83 SDPKSLVNQLNSLKY 97
          +D  S  N+L   +Y
Sbjct: 83 ADASSFANRLADPRY 97



 Score = 64.3 bits (155), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 80/361 (22%), Positives = 139/361 (38%), Gaps = 53/361 (14%)

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +GK+KS+D+L+           A++ +    +A+ AY L      +  +R VL   
Sbjct: 35  YEANIGKVKSVDDLM-----------ADQRL--YAYAMKAYGLEDMTYAKAFMRKVLEGG 81

Query: 420 PSDPDSYANKSKDDRLIKLNHAFN--------------FNADGSIGPIPM-MQSRLTIRD 464
            +D  S+AN+  D R +    AF+               +  G + P P  + +   + D
Sbjct: 82  VADASSFANRLADPRYVAFARAFDFAAGAASASGADGSISESGVVPPQPAQLTAPAALPD 141

Query: 465 NVK-HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
           +     AN  R        +  S    +T + + + +N+     +    T  +  E++A 
Sbjct: 142 STDFSGANEAR-------FTLTSRLDATTTRSVTITLNAATLAGSAADLTRVTGAEIVA- 193

Query: 524 KRILNFLLESKGIDSQKVREDFLCEI-----FKSDLKDPKSFANTYKDNRYKEIISSFNF 578
              +N  + + G D  + R            F++    P  F    +       +S  N 
Sbjct: 194 --AINAQIAASGEDGLEDRVQVGLGARNELYFETTASAPDGFGTAVEAGGTGRTLSVENA 251

Query: 579 DIHGELSHKKIG-----KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPN 633
                   K +G      +  +  +    D Y  Q +E    E+D  + LALYF R  P 
Sbjct: 252 -APSAADRKAVGIGFGTALPPDAQVRTVTDAYLEQTLESDAGEEDTGLRLALYFARMAPT 310

Query: 634 IRNHYEILGDSKLFKVVSKKLKL-SPYFAVLPERKKIRI--LKKHIKINDFKDSKKVEDF 690
           + + Y+ILGD+ L KV +    L +   A   E    R   L   I I  F+D  KV+ F
Sbjct: 311 LTSAYDILGDAALSKVANTVAGLPATSGAATSEALDARAAFLAAKIDIAGFQDPAKVQAF 370

Query: 691 L 691
           +
Sbjct: 371 V 371



 Score = 46.2 bits (108), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 39/70 (55%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           +  +  YY  NI  + S ++L+A++R+  + +++ G++     + F+ ++ +  + D  S
Sbjct: 28  VARDTAYYEANIGKVKSVDDLMADQRLYAYAMKAYGLEDMTYAKAFMRKVLEGGVADASS 87

Query: 560 FANTYKDNRY 569
           FAN   D RY
Sbjct: 88  FANRLADPRY 97



 Score = 46.2 bits (108), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 119 HKTIIQDYKQSHQHK--EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
           ++ + +D  ++ Q K  + V   ++ Y+  NI K+ SVD L  D+RL  Y ++++ +   
Sbjct: 8   YQLVARDLPKALQRKAADPVVARDTAYYEANIGKVKSVDDLMADQRLYAYAMKAYGLEDM 67

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRF 206
             +  F++ VL  G+A+   +     D R+
Sbjct: 68  TYAKAFMRKVLEGGVADASSFANRLADPRY 97


>gi|319406970|emb|CBI80607.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 266

 Score = 76.6 bits (187), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 98/208 (47%), Gaps = 20/208 (9%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  E DYY  +I  + S +E LAN +I N+ +++ G++       F   + +  L DP+
Sbjct: 27  QVKRETDYYVKHIIGVKSVDEFLANDKIYNYAMKAYGLEDM----IFAKGMIRKVLSDPE 82

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
            +A+   D RY++   +FNF  +GE +       Q       T + Y  Q +E +  E +
Sbjct: 83  -YASQLVDKRYQQFAEAFNFSKYGEKA------TQRESAKTVTVNKYMQQTLEVEVGEVN 135

Query: 619 PNIALALYFKRTIPN-IRNH--------YEILGDSKLFKVVSKKLKLSPYFAVLPERKKI 669
               LALYF RTI   ++N+        Y+IL D  L  V+ K   +S      P   + 
Sbjct: 136 EGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAVIFKAFNISENVLTSPIEVQK 195

Query: 670 RILKKHIKINDFKDSKKVEDFLYAAKAM 697
            +L+  + + D +D KK+E  +    AM
Sbjct: 196 SLLESRMSLKDLQDPKKLEHLIAKFSAM 223



 Score = 73.6 bits (179), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 110/230 (47%), Gaps = 28/230 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + + P V  E  YY + I  + ++DEF+ + ++++YA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDEFLANDKIYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM  A+  I+K+    LSDP+   +QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKV----LSDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAK 115

Query: 120 KTIIQDYKQSHQHKEEVALEESK----YFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y Q     E   + E      YF + I  +         N   Q+  D+ L   
Sbjct: 116 TVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLP------FLKDVLTLG-LANPKKYFIESRDNRFRAM 209
           + ++F+I+   ++ P       L+  ++L  L +PKK  +E    +F AM
Sbjct: 176 IFKAFNISENVLTSPIEVQKSLLESRMSLKDLQDPKK--LEHLIAKFSAM 223


>gi|163740770|ref|ZP_02148163.1| hypothetical protein RG210_13056 [Phaeobacter gallaeciensis 2.10]
 gi|161385761|gb|EDQ10137.1| hypothetical protein RG210_13056 [Phaeobacter gallaeciensis 2.10]
          Length = 591

 Score = 75.9 bits (185), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 129/625 (20%), Positives = 236/625 (37%), Gaps = 123/625 (19%)

Query: 144 FRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRD 203
           F + I  I S DQL  D  +L   L +F +     +  F+K VL   L+ P  +     D
Sbjct: 42  FTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKVLDSDLSEPTSFANRLND 101

Query: 204 NRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINS 263
           NR+  +A+ F F  D         L    +EK  +N                        
Sbjct: 102 NRYLGLAQTFGFGNDAG-----PQLPSSSVEKPYAN------------------------ 132

Query: 264 VSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNS 323
           V+S  D L +  L     L  F L      + FL  + E+D                D +
Sbjct: 133 VASPEDLLSNQTLLNQ-ALDDFGLEKYAGNEFFLMRVLESD--------------TTDPA 177

Query: 324 SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGP 383
           S      DS++    + ++ N    +   M++L+       G+  ++++         GP
Sbjct: 178 SFVNRLSDSKLADFANAFQFNQPPEYTSSMEALV-------GEFNAMNDG-------NGP 223

Query: 384 NSAEEPI---ITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
            +A+E +     L+  +D+++L   +     L+ +L SNP DPDS  N+ +D R + ++ 
Sbjct: 224 ANADELLENEGLLKAVVDSFDLEYTNTIF--LKRMLESNPYDPDSPVNQQEDPRYLAMSR 281

Query: 441 AFNFNA---DGSIGPIPMMQSRLTIRDNVKHY------------------ANRKRSIHDA 479
           AF F     +    P  ++     + D ++ +                  ++    ++  
Sbjct: 282 AFGFGISDINSFTSPEELLAQPQLLEDALEQFNLSNPGEQYIRDVLESDLSDPNSFVNQP 341

Query: 480 ENKSFNSM------EQISTQKRINL---EINSEVDYYTLNINTIHSFEELLANKRILNFL 530
            N +F         E  S   R+ +   E+  ++  Y      +  F+   A   + N  
Sbjct: 342 SNLAFYDFAEAFQNEWPSAPSRMQVLADEVGGKLAGYEQPQQFVFDFDAFEAGLDVFN-- 399

Query: 531 LESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIG 590
                I  +++  D + + F+SDL    S+AN ++D   K +  +F F+  G       G
Sbjct: 400 -----ISERELDFDVMIKAFESDLSSEISYANLHRDPNLKAMAHAFAFNPGGSDHTYPAG 454

Query: 591 KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILG 642
             Q      +  DLYK +  E    E DPN+ LAL  +R + +I +         + I+G
Sbjct: 455 FAQ------EIADLYKDRNFEIAIGESDPNMRLALSLERELQSIADAGGSEDAHWFGIIG 508

Query: 643 DSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSI 702
              L  +    L L   F  L   +++  +K+  + + F  +       + A  ++ +++
Sbjct: 509 SPPLKSMFETALGLPASFGQLDVDRQVNEMKERAQTS-FGTT-------HPADLLEPETL 560

Query: 703 D-YKKALFSSPNQNKDPWNNSFDDP 726
           D ++         N D   N F DP
Sbjct: 561 DAFRNRFLLLSGLNSDQAANGFSDP 585



 Score = 72.0 bits (175), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 100/461 (21%), Positives = 183/461 (39%), Gaps = 79/461 (17%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           K PI+    + + ++I+ I + D+ + D  +   AL AFGL +  +   FIKK+L+SDLS
Sbjct: 31  KSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKVLDSDLS 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
           +P S  N+LN  +Y   A+++ F     P++  S ++                       
Sbjct: 91  EPTSFANRLNDNRYLGLAQTFGFGNDAGPQLPSSSVE----------------------- 127

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
               K    + S + L  ++ LL+  L  F +     +  FL  VL     +P  +    
Sbjct: 128 ----KPYANVASPEDLLSNQTLLNQALDDFGLEKYAGNEFFLMRVLESDTTDPASFVNRL 183

Query: 202 RDNRFRAMAENFRF-QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLA 260
            D++    A  F+F QP    S  + ++ +        N  N   +   ++ ++   K  
Sbjct: 184 SDSKLADFANAFQFNQPPEYTSSMEALVGEFN----AMNDGNGPANADELLENEGLLKAV 239

Query: 261 INSVS---SFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQIN 317
           ++S     + + FLK     +ML+ +  P +P+   +      Q+ DP    +   F   
Sbjct: 240 VDSFDLEYTNTIFLK-----RMLESN--PYDPDSPVN------QQEDPRYLAMSRAFGFG 286

Query: 318 FHRDNSSSTKIQQDSQIQKMLD------LYKKNCQILHD--------------------- 350
               NS ++  +  +Q Q + D      L     Q + D                     
Sbjct: 287 ISDINSFTSPEELLAQPQLLEDALEQFNLSNPGEQYIRDVLESDLSDPNSFVNQPSNLAF 346

Query: 351 -DKMQSLIKDYQLPLGKIKSIDNLLSGK-CQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
            D  ++   ++     +++ + + + GK    E P          +  LD +N++ ++LD
Sbjct: 347 YDFAEAFQNEWPSAPSRMQVLADEVGGKLAGYEQPQQFVFDFDAFEAGLDVFNISERELD 406

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGS 449
            D +     S+ S   SYAN  +D  L  + HAF FN  GS
Sbjct: 407 FDVMIKAFESDLSSEISYANLHRDPNLKAMAHAFAFNPGGS 447



 Score = 48.1 bits (113), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           ++  V  +T  I  I S ++LL +  +L   L + G+D       F+ ++  SDL +P S
Sbjct: 35  LDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKVLDSDLSEPTS 94

Query: 560 FANTYKDNRYKEIISSFNF 578
           FAN   DNRY  +  +F F
Sbjct: 95  FANRLNDNRYLGLAQTFGF 113


>gi|163737657|ref|ZP_02145074.1| hypothetical protein RGBS107_19038 [Phaeobacter gallaeciensis
           BS107]
 gi|161389183|gb|EDQ13535.1| hypothetical protein RGBS107_19038 [Phaeobacter gallaeciensis
           BS107]
          Length = 591

 Score = 75.9 bits (185), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 129/625 (20%), Positives = 236/625 (37%), Gaps = 123/625 (19%)

Query: 144 FRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRD 203
           F + I  I S DQL  D  +L   L +F +     +  F+K VL   L+ P  +     D
Sbjct: 42  FTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKVLDSDLSEPTSFANRLND 101

Query: 204 NRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINS 263
           NR+  +A+ F F  D         L    +EK  +N                        
Sbjct: 102 NRYLGLAQTFGFGNDAG-----PQLPSSSVEKPYAN------------------------ 132

Query: 264 VSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNS 323
           V+S  D L +  L     L  F L      + FL  + E+D                D +
Sbjct: 133 VASPEDLLSNQTLLNQ-ALDDFGLKKYAGNEFFLMRVLESD--------------TTDPA 177

Query: 324 SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGP 383
           S      DS++    + ++ N    +   M++L+       G+  ++++         GP
Sbjct: 178 SFVNRLSDSKLADFANAFQFNQPPEYTSSMEALV-------GEFNAMNDG-------NGP 223

Query: 384 NSAEEPIIT---LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
            +A+E +     L+  +D+++L   +     L+ +L SNP DPDS  N+ +D R + ++ 
Sbjct: 224 ANADELLENEDLLKAVVDSFDLEYTNTIF--LKRMLESNPYDPDSPVNQQEDPRYLAMSR 281

Query: 441 AFNFNA---DGSIGPIPMMQSRLTIRDNVKHY------------------ANRKRSIHDA 479
           AF F     +    P  ++     + D ++ +                  ++    ++  
Sbjct: 282 AFGFGISDINSFTSPEELLAQPQLLEDALEQFNLSNPGEQYIRDVLESDLSDPNSFVNQP 341

Query: 480 ENKSFNSM------EQISTQKRINL---EINSEVDYYTLNINTIHSFEELLANKRILNFL 530
            N +F         E  S   R+ +   E+  ++  Y      +  F+   A   + N  
Sbjct: 342 SNLAFYDFAEAFQNEWPSAPSRMQVLADEVGGKLAGYEQPQQFVFDFDAFEAGLDVFN-- 399

Query: 531 LESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIG 590
                I  +++  D + + F+SDL    S+AN ++D   K +  +F F+  G       G
Sbjct: 400 -----ISERELDFDVMIKAFESDLSSEISYANLHRDPNLKAMAHAFAFNPGGSDHTYPAG 454

Query: 591 KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILG 642
             Q      +  DLYK +  E    E DPN+ LAL  +R + +I +         + I+G
Sbjct: 455 FAQ------EIADLYKDRNFEIAIGESDPNMRLALSLERELQSIADAGGSEDAHWFGIIG 508

Query: 643 DSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSI 702
              L  +    L L   F  L   +++  +K+  + + F  +       + A  ++ +++
Sbjct: 509 SPPLKSMFETALGLPASFGQLDVDRQVNEMKERAQTS-FGTT-------HPADLLEPETL 560

Query: 703 D-YKKALFSSPNQNKDPWNNSFDDP 726
           D ++         N D   N F DP
Sbjct: 561 DAFRNRFLLLSGLNSDQAANGFSDP 585



 Score = 71.6 bits (174), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 100/461 (21%), Positives = 184/461 (39%), Gaps = 79/461 (17%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           K PI+    + + ++I+ I + D+ + D  +   AL AFGL +  +   FIKK+L+SDLS
Sbjct: 31  KSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKVLDSDLS 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
           +P S  N+LN  +Y   A+++ F     P++  S ++                       
Sbjct: 91  EPTSFANRLNDNRYLGLAQTFGFGNDAGPQLPSSSVE----------------------- 127

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
               K    + S + L  ++ LL+  L  F +     +  FL  VL     +P  +    
Sbjct: 128 ----KPYANVASPEDLLSNQTLLNQALDDFGLKKYAGNEFFLMRVLESDTTDPASFVNRL 183

Query: 202 RDNRFRAMAENFRF-QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLA 260
            D++    A  F+F QP    S  + ++ +        N  N   +   ++ +++  K  
Sbjct: 184 SDSKLADFANAFQFNQPPEYTSSMEALVGEFN----AMNDGNGPANADELLENEDLLKAV 239

Query: 261 INSVS---SFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQIN 317
           ++S     + + FLK     +ML+ +  P +P+   +      Q+ DP    +   F   
Sbjct: 240 VDSFDLEYTNTIFLK-----RMLESN--PYDPDSPVN------QQEDPRYLAMSRAFGFG 286

Query: 318 FHRDNSSSTKIQQDSQIQKMLD------LYKKNCQILHD--------------------- 350
               NS ++  +  +Q Q + D      L     Q + D                     
Sbjct: 287 ISDINSFTSPEELLAQPQLLEDALEQFNLSNPGEQYIRDVLESDLSDPNSFVNQPSNLAF 346

Query: 351 -DKMQSLIKDYQLPLGKIKSIDNLLSGK-CQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
            D  ++   ++     +++ + + + GK    E P          +  LD +N++ ++LD
Sbjct: 347 YDFAEAFQNEWPSAPSRMQVLADEVGGKLAGYEQPQQFVFDFDAFEAGLDVFNISERELD 406

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGS 449
            D +     S+ S   SYAN  +D  L  + HAF FN  GS
Sbjct: 407 FDVMIKAFESDLSSEISYANLHRDPNLKAMAHAFAFNPGGS 447



 Score = 48.1 bits (113), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           ++  V  +T  I  I S ++LL +  +L   L + G+D       F+ ++  SDL +P S
Sbjct: 35  LDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKVLDSDLSEPTS 94

Query: 560 FANTYKDNRYKEIISSFNF 578
           FAN   DNRY  +  +F F
Sbjct: 95  FANRLNDNRYLGLAQTFGF 113


>gi|319403954|emb|CBI77542.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 266

 Score = 75.1 bits (183), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 98/208 (47%), Gaps = 20/208 (9%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  E DYY  +I  + S ++ LAN +I N+ +++ G++       F   + +  L DP+
Sbjct: 27  QVKRETDYYVKHIIGVKSVDDFLANDKIYNYAMKAYGLEDM----IFAKGMIRKVLSDPE 82

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
            +A+   D RY++   +FNF  +GE +       Q       T + Y  Q +E +  E +
Sbjct: 83  -YASQLVDKRYQQFAEAFNFSKYGEKA------TQRESAKTVTVNKYMQQTLEVEVGEVN 135

Query: 619 PNIALALYFKRTIPN-IRNH--------YEILGDSKLFKVVSKKLKLSPYFAVLPERKKI 669
               LALYF RTI   ++N+        Y+IL D  L  V+ K   +S      P   + 
Sbjct: 136 EGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAVIFKAFNISENVLTSPIEVQK 195

Query: 670 RILKKHIKINDFKDSKKVEDFLYAAKAM 697
            +L+  + + D +D KK+E  +    AM
Sbjct: 196 SLLESRMSLKDLQDPKKLEHLIAKFSAM 223



 Score = 72.0 bits (175), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 110/230 (47%), Gaps = 28/230 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + + P V  E  YY + I  + ++D+F+ + ++++YA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKIYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM  A+  I+K+    LSDP+   +QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKV----LSDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAK 115

Query: 120 KTIIQDYKQSHQHKEEVALEESK----YFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y Q     E   + E      YF + I  +         N   Q+  D+ L   
Sbjct: 116 TVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLP------FLKDVLTLG-LANPKKYFIESRDNRFRAM 209
           + ++F+I+   ++ P       L+  ++L  L +PKK  +E    +F AM
Sbjct: 176 IFKAFNISENVLTSPIEVQKSLLESRMSLKDLQDPKK--LEHLIAKFSAM 223


>gi|254464676|ref|ZP_05078087.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685584|gb|EDZ46066.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 574

 Score = 75.1 bits (183), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 96/207 (46%), Gaps = 32/207 (15%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++D Q +++    K P++    + + +RI  I + D+ + D  L +  L AFGL +  + 
Sbjct: 21  TRDQQQEVYE---KSPVLDRTVKDFTQRITSIQSADQLLDDYNLLTVTLGAFGLDEDINN 77

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP--PKVIQSDIQHKTIIQDYKQ 128
             FIK++LESD+SDPKS+VN+LN  +YQ  A ++ F     PK+                
Sbjct: 78  RAFIKQVLESDMSDPKSIVNRLNDSRYQALAETFGFGSADGPKL---------------P 122

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           S + + E A             I + D L  +R LL   L +  +     +  FL+ VL 
Sbjct: 123 SARAENEFA------------GIATPDDLLSNRTLLRKALGNAGLEGLENNQFFLQKVLE 170

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRF 215
             L +P  +  +  D R+ A A  F F
Sbjct: 171 SDLDDPSSFANKLSDPRYAAFAGQFNF 197



 Score = 60.1 bits (144), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 102/206 (49%), Gaps = 25/206 (12%)

Query: 39  IKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQ 98
              I+T D+ + ++ L   AL   GL  + + + F++K+LESDL DP S  N+L+  +Y 
Sbjct: 130 FAGIATPDDLLSNRTLLRKALGNAGLEGLENNQFFLQKVLESDLDDPSSFANKLSDPRYA 189

Query: 99  YFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLF 158
            FA  ++F   P   +S I+   ++ ++   +QH + +A               S D L 
Sbjct: 190 AFAGQFNFGQVP-AYESSIE--ALVSEF---NQHTDGLA---------------SADDLL 228

Query: 159 KDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRF-QP 217
            D  LL  V+ +F +   Y    FL+ VL     +P  +  +  D R+ A++E F F  P
Sbjct: 229 ADEDLLQAVIDTFGLERTYPD--FLRRVLNSDTTDPDSFVNQLEDKRYLAVSEAFGFGWP 286

Query: 218 D-GSLSKRDKILTDMQIEKIVSNYFN 242
           D  +++  +++L++ Q+ +   + FN
Sbjct: 287 DINAMTDPEELLSNPQLLEHALDTFN 312



 Score = 54.3 bits (129), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 65/295 (22%), Positives = 123/295 (41%), Gaps = 37/295 (12%)

Query: 410 DQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNA---DGSIGPIPMMQS-------- 458
           D LR VL S+ +DPDS+ N+ +D R + ++ AF F     +    P  ++ +        
Sbjct: 249 DFLRRVLNSDTTDPDSFVNQLEDKRYLAVSEAFGFGWPDINAMTDPEELLSNPQLLEHAL 308

Query: 459 -RLTIRDNVKHY---------ANRKRSIHDAENKSFNSMEQISTQKRINLEINSEV--DY 506
               + D  + Y         ++    ++  EN ++ +  +    +        +V  D 
Sbjct: 309 DTFNVSDRGETYLRQVLESDLSDPNSFVNQPENLAYYNFAEAFQNEWPEPVSKMQVFADE 368

Query: 507 YTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKD 566
            T  + T  +  EL+ +  +    L+  G   +    D + + F SDL    SFAN + D
Sbjct: 369 ITDKLGTFTNPRELVFDLGLFEATLDLFGQSKRSTDFDTVLKAFDSDLSSRTSFANMHYD 428

Query: 567 NRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALY 626
              K +  +F+F+  GE+S     +  + F  ++  +LY  +  E +    DPN+ LAL 
Sbjct: 429 TGLKAMAQAFSFNA-GEVSR----EYPEGF-AEELAELYTTRQFEIEIGNSDPNMRLALA 482

Query: 627 FKRTIPNI--------RNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILK 673
            +R + ++         + Y I+G   L  +    L L    A L   +++  +K
Sbjct: 483 LERELQDVVDAGGSENAHWYNIIGSPPLRSIFETALGLPSGIAQLDIERQLEEMK 537



 Score = 51.6 bits (122), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 2/74 (2%)

Query: 39  IKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQ 98
           I  ++  +E + + +L  +AL  F +SD    E +++++LESDLSDP S VNQ  +L Y 
Sbjct: 288 INAMTDPEELLSNPQLLEHALDTFNVSD--RGETYLRQVLESDLSDPNSFVNQPENLAYY 345

Query: 99  YFARSYDFSPPPKV 112
            FA ++    P  V
Sbjct: 346 NFAEAFQNEWPEPV 359



 Score = 51.2 bits (121), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 85/223 (38%), Gaps = 65/223 (29%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
           +KD+   +  I+S D LL             +    L   L A+ L+    +R  ++ VL
Sbjct: 39  VKDFTQRITSIQSADQLL-------------DDYNLLTVTLGAFGLDEDINNRAFIKQVL 85

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFN-ADGSIGPIPMMQSRLTIRDNVKHYANRKRS 475
            S+ SDP S  N+  D R   L   F F  ADG     P + S                 
Sbjct: 86  ESDMSDPKSIVNRLNDSRYQALAETFGFGSADG-----PKLPS----------------- 123

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
              AEN+                               I + ++LL+N+ +L   L + G
Sbjct: 124 -ARAENE----------------------------FAGIATPDDLLSNRTLLRKALGNAG 154

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNF 578
           ++  +  + FL ++ +SDL DP SFAN   D RY      FNF
Sbjct: 155 LEGLENNQFFLQKVLESDLDDPSSFANKLSDPRYAAFAGQFNF 197



 Score = 48.9 bits (115), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 3/109 (2%)

Query: 110 PKVIQSDIQHKTIIQ---DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDY 166
           P V  + I   + +Q   D +Q    K  V     K F + I  I S DQL  D  LL  
Sbjct: 5   PYVFGTGIAGWSFLQRTRDQQQEVYEKSPVLDRTVKDFTQRITSIQSADQLLDDYNLLTV 64

Query: 167 VLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRF 215
            L +F +     +  F+K VL   +++PK       D+R++A+AE F F
Sbjct: 65  TLGAFGLDEDINNRAFIKQVLESDMSDPKSIVNRLNDSRYQALAETFGF 113



 Score = 45.8 bits (107), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 89/232 (38%), Gaps = 62/232 (26%)

Query: 401 NLNMQDLDRDQ--LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQS 458
           N  ++ L+ +Q  L+ VL S+  DP S+ANK  D R       FNF      G +P  +S
Sbjct: 152 NAGLEGLENNQFFLQKVLESDLDDPSSFANKLSDPRYAAFAGQFNF------GQVPAYES 205

Query: 459 RLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFE 518
             +I   V  +           N+  + +            + + +D + L         
Sbjct: 206 --SIEALVSEF-----------NQHTDGLASADDLLADEDLLQAVIDTFGL--------- 243

Query: 519 ELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNF 578
                               ++   DFL  +  SD  DP SF N  +D RY  +  +F F
Sbjct: 244 --------------------ERTYPDFLRRVLNSDTTDPDSFVNQLEDKRYLAVSEAFGF 283

Query: 579 ---DIHGE------LSHKKIGK-VQDNFHIDDTCDLYKHQMIEKKEEEKDPN 620
              DI+        LS+ ++ +   D F++ D  + Y  Q++E   +  DPN
Sbjct: 284 GWPDINAMTDPEELLSNPQLLEHALDTFNVSDRGETYLRQVLES--DLSDPN 333


>gi|319898630|ref|YP_004158723.1| hypothetical protein BARCL_0458 [Bartonella clarridgeiae 73]
 gi|319402594|emb|CBI76139.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 266

 Score = 74.3 bits (181), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 110/230 (47%), Gaps = 28/230 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + + P V  E  YY + I  + ++D+F+ + +++SYA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKVYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM  A+  I+K+    LSDP+   +QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKV----LSDPQ-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAK 115

Query: 120 KTIIQDYKQSHQHKEEVALEESK----YFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y Q     E   + E      YF + +  +         N   Q+  D+ L   
Sbjct: 116 TVTVNKYMQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILKEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLP------FLKDVLTLG-LANPKKYFIESRDNRFRAM 209
           V ++F+I+   ++ P       L+  ++L  L +PKK  +E    +F AM
Sbjct: 176 VFKAFNISENVLTSPIESQKSLLESRMSLKDLQDPKK--LEHLIAKFSAM 223



 Score = 72.8 bits (177), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 97/208 (46%), Gaps = 20/208 (9%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  E DYY  +I  + S ++ LAN ++ ++ +++ G++       F   + +  L DP+
Sbjct: 27  QVKRETDYYVKHIIGVKSVDDFLANDKVYSYAMKAYGLEDM----IFAKGMIRKVLSDPQ 82

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
            +A+   D RY++   +FNF  +GE +       Q       T + Y  Q +E +  + +
Sbjct: 83  -YASQLVDKRYQQFAEAFNFSKYGEKA------TQRESAKTVTVNKYMQQTLEVEAGQVN 135

Query: 619 PNIALALYFKRTIPNI--------RNH-YEILGDSKLFKVVSKKLKLSPYFAVLPERKKI 669
               LALYF RT+  +        +N  Y+IL D  L  VV K   +S      P   + 
Sbjct: 136 EGTRLALYFTRTVGGMVKDNILKEKNWAYQILSDKALSAVVFKAFNISENVLTSPIESQK 195

Query: 670 RILKKHIKINDFKDSKKVEDFLYAAKAM 697
            +L+  + + D +D KK+E  +    AM
Sbjct: 196 SLLESRMSLKDLQDPKKLEHLIAKFSAM 223


>gi|159184366|ref|NP_353586.2| hypothetical protein Atu0559 [Agrobacterium tumefaciens str. C58]
 gi|2459707|gb|AAB71783.1| OrfX [Agrobacterium tumefaciens]
 gi|159139680|gb|AAK86371.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 211

 Score = 73.6 bits (179), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 82/175 (46%), Gaps = 14/175 (8%)

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
           +A+ R+ N+ L++ G++     + F+ ++      D  +FAN   DNRY E+  S +F  
Sbjct: 1   MADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAG 60

Query: 581 HGELSHK----KIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN 636
            G  +      K G + +          Y  Q +E++  + +  + LALYF+R  P I++
Sbjct: 61  LGAAATATEAAKSGVIGN----------YARQTLEQEAGDDNNGVRLALYFERKAPTIKS 110

Query: 637 HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
             + L D  L +V      L   FA     K+  +++K I I D +D +KV   L
Sbjct: 111 GLDFLADDALAQVFRTTFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLL 165



 Score = 57.0 bits (136), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 63/130 (48%), Gaps = 5/130 (3%)

Query: 49  IKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP 108
           + D RL++YALKA GL DM++A+ FI+K+L    SD  +  N+L+  +Y   A+S DF+ 
Sbjct: 1   MADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAG 60

Query: 109 PPKVIQSDIQHKT-IIQDYKQSHQHKEEV----ALEESKYFRKNIHKINSVDQLFKDRRL 163
                 +    K+ +I +Y +    +E       +  + YF +    I S      D  L
Sbjct: 61  LGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDAL 120

Query: 164 LDYVLQSFSI 173
                 +F++
Sbjct: 121 AQVFRTTFNL 130


>gi|209967005|ref|YP_002299920.1| flagellar basal-body rod protein FlgF, putative [Rhodospirillum
           centenum SW]
 gi|209960471|gb|ACJ01108.1| flagellar basal-body rod protein FlgF, putative [Rhodospirillum
           centenum SW]
          Length = 259

 Score = 73.2 bits (178), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 94/198 (47%), Gaps = 12/198 (6%)

Query: 493 QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKS 552
           QK +   IN   D+ T  I  I S E LL ++R L F+L S  ++S+  +   L ++   
Sbjct: 28  QKTVEKTIN---DFKT-RIEKIDSPEALLKDRRALEFVLTSFQLESEIGKTGILRKLLTE 83

Query: 553 DLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEK 612
           D  + KS AN   D RY ++ +S        LS K     Q+   ++   + Y     EK
Sbjct: 84  DPTEEKSLANRLVDPRYTKLATS--------LSGKIPEAFQNESFVNGLINNYVTNTFEK 135

Query: 613 KEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRIL 672
              E +  +  ALYFKR I N+ +  +IL D  L  VV K L L   FA+    ++ R L
Sbjct: 136 SVGEGNTGLREALYFKRNIANVTSVSQILADRALSYVVRKGLNLPDSFAMQDFDQQKRYL 195

Query: 673 KKHIKINDFKDSKKVEDF 690
           +K + +  FKD   VE F
Sbjct: 196 EKKLDLTKFKDPGYVEKF 213



 Score = 58.2 bits (139), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 68/139 (48%), Gaps = 6/139 (4%)

Query: 35  YRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNS 94
           ++ RI+ I + +  +KD+R   + L +F L         ++K+L  D ++ KSL N+L  
Sbjct: 38  FKTRIEKIDSPEALLKDRRALEFVLTSFQLESEIGKTGILRKLLTEDPTEEKSLANRLVD 97

Query: 95  LKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKE----EVALEESKYFRKNIHK 150
            +Y   A S      P+  Q++     +I +Y  +   K        L E+ YF++NI  
Sbjct: 98  PRYTKLATSLS-GKIPEAFQNESFVNGLINNYVTNTFEKSVGEGNTGLREALYFKRNIAN 156

Query: 151 INSVDQLFKDRRLLDYVLQ 169
           + SV Q+  D R L YV++
Sbjct: 157 VTSVSQILAD-RALSYVVR 174



 Score = 40.8 bits (94), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 63/142 (44%), Gaps = 19/142 (13%)

Query: 144 FRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRD 203
           F+  I KI+S + L KDRR L++VL SF +  +      L+ +LT      K       D
Sbjct: 38  FKTRIEKIDSPEALLKDRRALEFVLTSFQLESEIGKTGILRKLLTEDPTEEKSLANRLVD 97

Query: 204 NRFRAMAENFRFQPDGSLSKR--DKILTDMQIEKIVSNYFNNTIDCVPIVSDQN------ 255
            R+  +A         SLS +  +    +  +  +++NY  NT +    V + N      
Sbjct: 98  PRYTKLAT--------SLSGKIPEAFQNESFVNGLINNYVTNTFE--KSVGEGNTGLREA 147

Query: 256 -YYKLAINSVSSFSDFLKDPKL 276
            Y+K  I +V+S S  L D  L
Sbjct: 148 LYFKRNIANVTSVSQILADRAL 169


>gi|319405395|emb|CBI79014.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 266

 Score = 72.4 bits (176), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 97/208 (46%), Gaps = 20/208 (9%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  E DYY  +I  + S ++ LAN +I N+ +++ G++     +  + ++    L DP+
Sbjct: 27  QVKHETDYYVKHIIGVKSVDDFLANDKIYNYAMKAYGLEDMIFAKGMIRKV----LSDPQ 82

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
            +A    D RY++   +FNF  +GE +       Q       T + Y  Q +E +  + +
Sbjct: 83  -YAAQLVDKRYQQFAEAFNFSKYGEKT------TQRESAKTITVNKYIQQTLEVEAGQVN 135

Query: 619 PNIALALYFKRTIPNI--------RNH-YEILGDSKLFKVVSKKLKLSPYFAVLPERKKI 669
               LALYF RT+  +        +N  Y+IL D  L  V+ K   +S      P   + 
Sbjct: 136 EGTRLALYFTRTVGGMVKDNILTEKNWAYQILSDKALSAVIFKAFNISENVLTSPIEAQK 195

Query: 670 RILKKHIKINDFKDSKKVEDFLYAAKAM 697
            +L+  + + D +D KK+E  +    AM
Sbjct: 196 SLLESRMSLKDLQDPKKLEHLIAKFSAM 223



 Score = 71.6 bits (174), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 109/230 (47%), Gaps = 28/230 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + K P V  E  YY + I  + ++D+F+ + ++++YA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFKKPQVKHETDYYVKHIIGVKSVDDFLANDKIYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM  A+  I+K+    LSDP+    QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKV----LSDPQ-YAAQLVDKRYQQFAEAFNFSKYGEKTTQRESAK 115

Query: 120 KTIIQDYKQSHQHKEEVALEESK----YFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y Q     E   + E      YF + +  +         N   Q+  D+ L   
Sbjct: 116 TITVNKYIQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILTEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLP------FLKDVLTLG-LANPKKYFIESRDNRFRAM 209
           + ++F+I+   ++ P       L+  ++L  L +PKK  +E    +F AM
Sbjct: 176 IFKAFNISENVLTSPIEAQKSLLESRMSLKDLQDPKK--LEHLIAKFSAM 223


>gi|114762157|ref|ZP_01441625.1| flagellar protein, putative [Pelagibaca bermudensis HTCC2601]
 gi|114545181|gb|EAU48184.1| flagellar protein, putative [Roseovarius sp. HTCC2601]
          Length = 405

 Score = 72.0 bits (175), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 89/205 (43%), Gaps = 34/205 (16%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           + D Q   F+   K P ++ E  Y+ E I  I + +E + ++RL S AL AFG+ D   +
Sbjct: 21  TMDTQRTAFN---KTPEITREAAYFTETIGSIGSAEELVGNRRLLSVALTAFGMEDELDS 77

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQ------ 124
           +  +++++E    D ++L N+LN  ++   A ++DF P   VI    Q +   +      
Sbjct: 78  KYLVRRLIEEGTKDDEALANKLNDSRFVALADAFDFEP---VITRKTQEEGFAETVLVRY 134

Query: 125 ---------------------DYKQSHQHKEEVALEESK-YFRKNIHKINSVDQLFKDRR 162
                                DY      + E  LE S+ YF +NI +I S ++L  D  
Sbjct: 135 EERIRANLAQTLTEPDYVADPDYAALFAAQVEENLEISRAYFTENIGRITSAEELLLDPE 194

Query: 163 LLDYVLQSFSITPKYISLPFLKDVL 187
           L      +F +  +  S   L+  L
Sbjct: 195 LRQVATTAFDLGDRARSTTLLRRAL 219



 Score = 52.4 bits (124), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 69/323 (21%), Positives = 125/323 (38%), Gaps = 36/323 (11%)

Query: 384 NSAEEPIIT---LQFALDAYNLNMQDLDRDQL-RNVLTSNPSDPDSYANKSKDDRLIKLN 439
            SAEE +     L  AL A+ +   +LD   L R ++     D ++ ANK  D R + L 
Sbjct: 50  GSAEELVGNRRLLSVALTAFGME-DELDSKYLVRRLIEEGTKDDEALANKLNDSRFVALA 108

Query: 440 HAFNF-------NADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQIST 492
            AF+F         +       +++    IR N+         + D +  +       + 
Sbjct: 109 DAFDFEPVITRKTQEEGFAETVLVRYEERIRANLAQTLTEPDYVADPDYAAL-----FAA 163

Query: 493 QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKS 552
           Q   NLEI+    Y+T NI  I S EELL +  +      +  +  +      L    + 
Sbjct: 164 QVEENLEISRA--YFTENIGRITSAEELLLDPELRQVATTAFDLGDRARSTTLLRRALEE 221

Query: 553 DLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEK 612
           D  +  + +N   D   +    +F F    E S      +Q      +  + ++ Q  E 
Sbjct: 222 DPAEATALSNVLNDRNLRAFSMAFAF-YETETST----VLQTEGFASNITEQFRWQRFED 276

Query: 613 KEEEKDPNIALALYFKRTIPNIRNH--------YEILGDSKLFKVVSKKLKLSPYFAVLP 664
              + +  I  AL F+R++P +  +        Y +LG + + +V    L L   F+ + 
Sbjct: 277 AVSDVNEAIGAALKFQRSLPELAANDLSETAKWYNVLGSTMMREVFETALSLPDGFSQID 336

Query: 665 ERKKIRIL----KKHIKINDFKD 683
             K++ ++    ++   I  F D
Sbjct: 337 LDKQVEVISDRARQRFGIETFSD 359



 Score = 50.1 bits (118), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (53%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           N+M+   T      EI  E  Y+T  I +I S EEL+ N+R+L+  L + G++ +   + 
Sbjct: 20  NTMDTQRTAFNKTPEITREAAYFTETIGSIGSAEELVGNRRLLSVALTAFGMEDELDSKY 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
            +  + +   KD ++ AN   D+R+  +  +F+F+
Sbjct: 80  LVRRLIEEGTKDDEALANKLNDSRFVALADAFDFE 114



 Score = 46.6 bits (109), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 48/218 (22%), Positives = 93/218 (42%), Gaps = 26/218 (11%)

Query: 110 PKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
           P ++   I   T+  D +++  +K      E+ YF + I  I S ++L  +RRLL   L 
Sbjct: 10  PGLVGWQILQNTM--DTQRTAFNKTPEITREAAYFTETIGSIGSAEELVGNRRLLSVALT 67

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +F +  +  S   ++ ++  G  + +    +  D+RF A+A+ F F+P  +   +++   
Sbjct: 68  AFGMEDELDSKYLVRRLIEEGTKDDEALANKLNDSRFVALADAFDFEPVITRKTQEEGFA 127

Query: 230 DMQI----EKIVSNYFNNTIDCVPIVSDQNYYKL------------------AINSVSSF 267
           +  +    E+I +N    T+     V+D +Y  L                   I  ++S 
Sbjct: 128 ETVLVRYEERIRAN-LAQTLTEPDYVADPDYAALFAAQVEENLEISRAYFTENIGRITSA 186

Query: 268 SDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDP 305
            + L DP+L + +  + F L     +   L    E DP
Sbjct: 187 EELLLDPEL-RQVATTAFDLGDRARSTTLLRRALEEDP 223


>gi|158422871|ref|YP_001524163.1| hypothetical protein AZC_1247 [Azorhizobium caulinodans ORS 571]
 gi|158329760|dbj|BAF87245.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 295

 Score = 72.0 bits (175), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 89/194 (45%), Gaps = 7/194 (3%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           E+  +  YY  NI ++ S ++ + N R+LN+ + + G+  +   +  + ++  SDL D  
Sbjct: 61  EVARDTAYYEANIGSVTSVDDFVNNYRLLNYAMTAYGLSDETNAKALVKQVLSSDLSDSS 120

Query: 559 SFANTYKDNRYKEIISSF-NFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEK 617
           S      D RY  +  +F N + +   +       Q         + Y  Q +E    ++
Sbjct: 121 SLVYKLNDQRYLNLAKAFANLNPNDSAASYTAATTQQ------VVNSYLEQQLENDVGQQ 174

Query: 618 DPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK 677
           D    LALYF+R   NI + Y ILGDS+L+KVV     L      +   ++  +++  + 
Sbjct: 175 DEGTQLALYFQRNAANITSGYSILGDSQLWKVVQTVYDLPESLGSIDINQQKDLVESKVN 234

Query: 678 INDFKDSKKVEDFL 691
           I D +D  KV   L
Sbjct: 235 IADLQDPTKVSALL 248



 Score = 58.9 bits (141), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 80/152 (52%), Gaps = 8/152 (5%)

Query: 23  SKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDL 82
           +  P V+ +  YY   I  ++++D+F+ + RL +YA+ A+GLSD ++A+  +K++L SDL
Sbjct: 57  AAQPEVARDTAYYEANIGSVTSVDDFVNNYRLLNYAMTAYGLSDETNAKALVKQVLSSDL 116

Query: 83  SDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKT--IIQDYKQSHQHKEEVALEE 140
           SD  SLV +LN  +Y   A+++    P     S     T  ++  Y +  Q + +V  ++
Sbjct: 117 SDSSSLVYKLNDQRYLNLAKAFANLNPNDSAASYTAATTQQVVNSYLE-QQLENDVGQQD 175

Query: 141 SK-----YFRKNIHKINSVDQLFKDRRLLDYV 167
                  YF++N   I S   +  D +L   V
Sbjct: 176 EGTQLALYFQRNAANITSGYSILGDSQLWKVV 207



 Score = 38.5 bits (88), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 74/153 (48%), Gaps = 11/153 (7%)

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANP 194
           EVA  ++ Y+  NI  + SVD    + RLL+Y + ++ ++ +  +   +K VL+  L++ 
Sbjct: 61  EVA-RDTAYYEANIGSVTSVDDFVNNYRLLNYAMTAYGLSDETNAKALVKQVLSSDLSDS 119

Query: 195 KKYFIESRDNRFRAMAENF-RFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD 253
                +  D R+  +A+ F    P+ S +      T    +++V++Y    ++      D
Sbjct: 120 SSLVYKLNDQRYLNLAKAFANLNPNDSAASYTAATT----QQVVNSYLEQQLENDVGQQD 175

Query: 254 QN-----YYKLAINSVSSFSDFLKDPKLFKMLQ 281
           +      Y++    +++S    L D +L+K++Q
Sbjct: 176 EGTQLALYFQRNAANITSGYSILGDSQLWKVVQ 208


>gi|149912827|ref|ZP_01901361.1| flagellar protein, putative [Roseobacter sp. AzwK-3b]
 gi|149813233|gb|EDM73059.1| flagellar protein, putative [Roseobacter sp. AzwK-3b]
          Length = 267

 Score = 71.6 bits (174), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (54%), Gaps = 3/97 (3%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           + D Q K F      P +S +  Y+  RI+ IST +E + D+RL   AL AFGL D   +
Sbjct: 21  TMDAQRKAFDA---GPRISSDTAYFEARIRDISTAEELVNDRRLLRVALGAFGLQDDIDS 77

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS 107
              I+K+LE   +DP +L N+L   +Y+  A ++ F 
Sbjct: 78  RFLIRKVLEGGTADPDALANRLTDRRYKDLADAFGFG 114



 Score = 68.9 bits (167), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 92/222 (41%), Gaps = 32/222 (14%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           +  DA+ K+F++  +IS          S+  Y+   I  I + EEL+ ++R+L   L + 
Sbjct: 20  ATMDAQRKAFDAGPRIS----------SDTAYFEARIRDISTAEELVNDRRLLRVALGAF 69

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHG--ELSHKKIGKV 592
           G+         + ++ +    DP + AN   D RYK++  +F F   G  E      GK 
Sbjct: 70  GLQDDIDSRFLIRKVLEGGTADPDALANRLTDRRYKDLADAFGFGATGGPETQSPGFGK- 128

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDS 644
                  D  DL++ +  E    E D  + LAL  +R +  + N           I+G  
Sbjct: 129 -------DIVDLFRRRSFENAVGESDQGLRLALNAQRELAILANDTGQGDTGWLRIMGTP 181

Query: 645 KLFKVVSKKLKLSPYFAVLPERKKIRILKK----HIKINDFK 682
            L KV    L L   FA L   +++ + K      + I D +
Sbjct: 182 PLRKVFETALGLPDGFAQLDLDRQLDVFKARAADRLGITDLR 223



 Score = 44.7 bits (104), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           ++ YF   I  I++ ++L  DRRLL   L +F +     S   ++ VL  G A+P     
Sbjct: 38  DTAYFEARIRDISTAEELVNDRRLLRVALGAFGLQDDIDSRFLIRKVLEGGTADPDALAN 97

Query: 200 ESRDNRFRAMAENFRFQPDGS 220
              D R++ +A+ F F   G 
Sbjct: 98  RLTDRRYKDLADAFGFGATGG 118



 Score = 43.5 bits (101), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 46/92 (50%), Gaps = 8/92 (8%)

Query: 393 LQFALDAYNLNMQDLD-RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIG 451
           L+ AL A+ L   D+D R  +R VL    +DPD+ AN+  D R   L  AF F A G   
Sbjct: 62  LRVALGAFGLQ-DDIDSRFLIRKVLEGGTADPDALANRLTDRRYKDLADAFGFGATGG-- 118

Query: 452 PIPMMQSRLTIRDNVKHYANRKRSIHDAENKS 483
             P  QS    +D V  +  R+RS  +A  +S
Sbjct: 119 --PETQSPGFGKDIVDLF--RRRSFENAVGES 146


>gi|170748128|ref|YP_001754388.1| hypothetical protein Mrad2831_1710 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654650|gb|ACB23705.1| protein of unknown function DUF1217 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 472

 Score = 70.5 bits (171), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 67/100 (67%), Gaps = 8/100 (8%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           S+DI +K     + +  V+ + +Y+ E I  ++++D+FI + RLF++A++AFGL DM++A
Sbjct: 12  SRDI-AKSLKNKAAERAVANDTKYFSEHIGDVTSVDDFIGNARLFNFAMRAFGLEDMAYA 70

Query: 71  EKFIKKILESDLSDPKS----LVNQLNSLKYQYFARSYDF 106
           + F+KK+L   L +P +    LV++L   +Y+ FA +++F
Sbjct: 71  KSFMKKVL---LGEPDANGHVLVDRLQDTRYRDFANAFNF 107



 Score = 52.8 bits (125), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 67/157 (42%), Gaps = 8/157 (5%)

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNF---- 596
           V +  L +I  S L  P +  N  KD + +  + + N D+      + + +  D F    
Sbjct: 273 VADTTLTDIVWSTLGLPAT--NASKDPKAQAALIAKNLDVASLRDPRTLSQFIDRFKDAR 330

Query: 597 --HIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
                 T D Y  Q +E     +D    LALYFKR    I++ Y IL D  L +VV   L
Sbjct: 331 VAARSATVDAYVRQTLEDDAGAQDQGTRLALYFKRQAGTIKSIYGILADKALAEVVRTTL 390

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
                 A      ++  + + + I  F+D +K++ F+
Sbjct: 391 GFPAEMARSNLDSQVAQISRKLDITTFQDPEKLDRFI 427



 Score = 51.2 bits (121), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 83/179 (46%), Gaps = 12/179 (6%)

Query: 117 IQHKTIIQDYKQSHQHK--EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           + +  I +D  +S ++K  E     ++KYF ++I  + SVD    + RL ++ +++F + 
Sbjct: 6   MDYTLISRDIAKSLKNKAAERAVANDTKYFSEHIGDVTSVDDFIGNARLFNFAMRAFGLE 65

Query: 175 PKYISLPFLKDVLTLGLANPKKYFIESR--DNRFRAMAENFRFQPDGSLSKRDKILTDMQ 232
               +  F+K VL LG  +   + +  R  D R+R  A  F F+  G    + K   + +
Sbjct: 66  DMAYAKSFMKKVL-LGEPDANGHVLVDRLQDTRYRDFANAFNFRSYGDDPSKPKTFDNPE 124

Query: 233 IEKIV-SNYFNNTIDCVPIV------SDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           +E ++ S   N T+D   +        D  Y        +S  D + DPKL  +++ ++
Sbjct: 125 VEAMLESVGANKTVDQQKLAYDNQTGRDTQYISDFAAYATSVDDIVSDPKLSSIVRATV 183



 Score = 41.2 bits (95), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/88 (20%), Positives = 47/88 (53%), Gaps = 7/88 (7%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           + ++  Y++ +I  + S ++ + N R+ NF + + G++     + F+ ++    L +P +
Sbjct: 28  VANDTKYFSEHIGDVTSVDDFIGNARLFNFAMRAFGLEDMAYAKSFMKKVL---LGEPDA 84

Query: 560 ----FANTYKDNRYKEIISSFNFDIHGE 583
                 +  +D RY++  ++FNF  +G+
Sbjct: 85  NGHVLVDRLQDTRYRDFANAFNFRSYGD 112


>gi|254477619|ref|ZP_05091005.1| flagellar protein, putative [Ruegeria sp. R11]
 gi|214031862|gb|EEB72697.1| flagellar protein, putative [Ruegeria sp. R11]
          Length = 590

 Score = 70.1 bits (170), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 106/456 (23%), Positives = 173/456 (37%), Gaps = 71/456 (15%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           K PI+    + +  +I  I T D+ + D  +   AL AFGL +      FIK++LESDLS
Sbjct: 31  KSPILDRAVQDFTNKIDSIQTADQLLDDYNVLQVALGAFGLEEDIANRAFIKQVLESDLS 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKY 143
           DP+S  N+LN  +Y   A+++ F                 +D  Q      E        
Sbjct: 91  DPRSFANRLNDNRYLGLAQTFGFGS---------------EDGPQLPSASAE-------- 127

Query: 144 FRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRD 203
             K    + S + L  ++ LL+  L  F +     +  FL+ VL   L++   +     D
Sbjct: 128 --KPYVNVASPEDLLSNKTLLNQALDDFGLQRYAGNEFFLQKVLESDLSDDNSFVNRLSD 185

Query: 204 NRFRAMAENFRF-QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAIN 262
            R    A  F+F  P    S  D +L     E    N      +   ++ ++      I 
Sbjct: 186 TRLADFASQFKFNAPPEYTSSMDAMLG----EFTAMNDGAGPANADELLGNETLLNAVI- 240

Query: 263 SVSSFSDFLKDPKLFK-MLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRD 321
              +F     +P   K ML+   +        D+   + Q+ DP V  +   F       
Sbjct: 241 --ETFDLEYTNPIFLKRMLEADPY--------DENSAVRQQEDPRVLAMSRAFGFGMPDI 290

Query: 322 NSSSTK---IQQDSQIQKMLDLYKKNC-------QILHDD--------------KMQSLI 357
           NS S+      +   ++++LD +  +        Q+L  D                  L 
Sbjct: 291 NSFSSPDELFARPELLEEVLDQFNNSNPGEDFLRQVLESDLSDPNSFVNQPGNLAFFDLA 350

Query: 358 KDYQL----PLGKIKSIDNLLSGK-CQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQL 412
           + YQ     P  K+K + + +  K    E P          +  LD +N+N + LD   +
Sbjct: 351 EAYQTEWTPPPSKVKVLADEVGTKLSGYENPRQFVFDFDAFEAGLDVFNMNERQLDFSFM 410

Query: 413 RNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
             V  S+ S   SYAN  +D  +  + +AF FN  G
Sbjct: 411 LKVFESDLSSETSYANLYRDPNVQAMANAFAFNPGG 446



 Score = 57.0 bits (136), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 77/194 (39%), Gaps = 50/194 (25%)

Query: 392 TLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIG 451
            LQ AL A+ L     +R  ++ VL S+ SDP S+AN+  D+R + L   F F ++   G
Sbjct: 61  VLQVALGAFGLEEDIANRAFIKQVLESDLSDPRSFANRLNDNRYLGLAQTFGFGSED--G 118

Query: 452 PIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNI 511
           P      +L      K Y N                                        
Sbjct: 119 P------QLPSASAEKPYVN---------------------------------------- 132

Query: 512 NTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKE 571
             + S E+LL+NK +LN  L+  G+      E FL ++ +SDL D  SF N   D R  +
Sbjct: 133 --VASPEDLLSNKTLLNQALDDFGLQRYAGNEFFLQKVLESDLSDDNSFVNRLSDTRLAD 190

Query: 572 IISSFNFDIHGELS 585
             S F F+   E +
Sbjct: 191 FASQFKFNAPPEYT 204



 Score = 55.1 bits (131), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 99/243 (40%), Gaps = 36/243 (14%)

Query: 24  KDPIVSCEERYYR---ERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILES 80
           +DP V    R +      I   S+ DE      L    L  F  S+    E F++++LES
Sbjct: 272 EDPRVLAMSRAFGFGMPDINSFSSPDELFARPELLEEVLDQFNNSN--PGEDFLRQVLES 329

Query: 81  DLSDPKSLVNQLNSLKYQYFARSY--DFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVAL 138
           DLSDP S VNQ  +L +   A +Y  +++PPP  ++       ++ D         EV  
Sbjct: 330 DLSDPNSFVNQPGNLAFFDLAEAYQTEWTPPPSKVK-------VLAD---------EVGT 373

Query: 139 EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYF 198
           + S Y         +  Q   D    +  L  F++  + +   F+  V    L++   Y 
Sbjct: 374 KLSGY--------ENPRQFVFDFDAFEAGLDVFNMNERQLDFSFMLKVFESDLSSETSYA 425

Query: 199 IESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYK 258
              RD   +AMA  F F P G+    D+       E+I   Y +   +     SD N  +
Sbjct: 426 NLYRDPNVQAMANAFAFNPGGN----DRTYPPGFAEEIADLYTDRNFEIAIGESDPN-MR 480

Query: 259 LAI 261
           LA+
Sbjct: 481 LAL 483



 Score = 54.3 bits (129), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 60/272 (22%), Positives = 107/272 (39%), Gaps = 61/272 (22%)

Query: 410 DQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHY 469
           D LR VL S+ SDP+S+ N+  +     L  A+          + ++   +  +  +  Y
Sbjct: 321 DFLRQVLESDLSDPNSFVNQPGNLAFFDLAEAYQTEWTPPPSKVKVLADEVGTK--LSGY 378

Query: 470 ANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNF 529
            N ++ + D     F++ E             + +D + +N             +R L+F
Sbjct: 379 ENPRQFVFD-----FDAFE-------------AGLDVFNMN-------------ERQLDF 407

Query: 530 LLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKI 589
                          F+ ++F+SDL    S+AN Y+D   + + ++F F+  G       
Sbjct: 408 --------------SFMLKVFESDLSSETSYANLYRDPNVQAMANAFAFNPGGNDRTYPP 453

Query: 590 GKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEIL 641
           G        ++  DLY  +  E    E DPN+ LAL  +R + +I +         Y I+
Sbjct: 454 G------FAEEIADLYTDRNFEIAIGESDPNMRLALALERELQSIADAGGSEDAHWYGII 507

Query: 642 GDSKLFKVVSKKLKLSPYFAVLPERKKIRILK 673
           G   L  V    L L   F  L   +++  +K
Sbjct: 508 GSPPLKTVFESALGLPSSFGQLDVDRQVNEMK 539



 Score = 53.5 bits (127), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 482 KSFNSMEQISTQKRINLE----INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
             +N +++  TQ++   E    ++  V  +T  I++I + ++LL +  +L   L + G++
Sbjct: 13  AGWNFLDRTRTQQQQIFEKSPILDRAVQDFTNKIDSIQTADQLLDDYNVLQVALGAFGLE 72

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNF 578
                  F+ ++ +SDL DP+SFAN   DNRY  +  +F F
Sbjct: 73  EDIANRAFIKQVLESDLSDPRSFANRLNDNRYLGLAQTFGF 113



 Score = 42.4 bits (98), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 78/194 (40%), Gaps = 30/194 (15%)

Query: 396 ALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNA--------D 447
           ALD + L     +   L+ VL S+ SD +S+ N+  D RL      F FNA        D
Sbjct: 149 ALDDFGLQRYAGNEFFLQKVLESDLSDDNSFVNRLSDTRLADFASQFKFNAPPEYTSSMD 208

Query: 448 GSIGPIPMMQSRLTIRDNVKHYANRK-------------------RSIHDAENKSFNSME 488
             +G    M       +  +   N                     + + +A+    NS  
Sbjct: 209 AMLGEFTAMNDGAGPANADELLGNETLLNAVIETFDLEYTNPIFLKRMLEADPYDENSAV 268

Query: 489 QISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCE 548
           +     R+ L ++    +   +IN+  S +EL A   +L  +L+    ++    EDFL +
Sbjct: 269 RQQEDPRV-LAMSRAFGFGMPDINSFSSPDELFARPELLEEVLDQ--FNNSNPGEDFLRQ 325

Query: 549 IFKSDLKDPKSFAN 562
           + +SDL DP SF N
Sbjct: 326 VLESDLSDPNSFVN 339


>gi|170744539|ref|YP_001773194.1| hypothetical protein M446_6502 [Methylobacterium sp. 4-46]
 gi|168198813|gb|ACA20760.1| protein of unknown function DUF1217 [Methylobacterium sp. 4-46]
          Length = 429

 Score = 68.6 bits (166), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 60/97 (61%), Gaps = 1/97 (1%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++DI +K  +  + +  V  +  Y+   I  + ++D+F+KD RL++YA++A GL +M +A
Sbjct: 12  TRDI-TKTLTRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDRLYAYAMRAHGLEEMIYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS 107
           + F++++L   ++ P S  N+L   +Y  FAR + F+
Sbjct: 71  KAFMRRVLTEGVASPSSFANRLADQRYVEFARQFQFA 107



 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 90/378 (23%), Positives = 141/378 (37%), Gaps = 81/378 (21%)

Query: 364 LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
           +GK+KS+D+ +                    +A+ A+ L      +  +R VLT   + P
Sbjct: 39  IGKVKSVDDFMKDDR-------------LYAYAMRAHGLEEMIYAKAFMRRVLTEGVASP 85

Query: 424 DSYANKSKDDRLIKLNHAFNFN-----------------ADGSIGP-IPM---------- 455
            S+AN+  D R ++    F F                  AD  +GP IP           
Sbjct: 86  SSFANRLADQRYVEFARQFQFATDVTAQGADPVMTGKTYADYRLGPAIPARLSGAFPLGQ 145

Query: 456 -------MQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQIS--TQKRINLEINSEVDY 506
                  +++R TI   V     +  +I   ++   +++  ++  T   +   INS++  
Sbjct: 146 AMDFSDKVEARFTISSRVDATTTKSATIVLNKSTLRDAVSDLARVTPAELVAAINSQI-- 203

Query: 507 YTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL-CEIFKSDLKDPK-SFANTY 564
                    S E  LA K  ++  L +KG       E FL    F S   D K      Y
Sbjct: 204 -------AASGEANLAGK--VSASLGAKG-------ELFLETTAFASLGPDGKPGGTGAY 247

Query: 565 KDNRYKEIISSFNFDIHG-------ELSHKKIGKVQDNFHIDDTCDL-YKHQMIEKKEEE 616
            D  Y+         I         +L+    G             L Y +Q IE+ E E
Sbjct: 248 ADVLYEGGGQVRTITIQNLAPAEGRQLADVGFGSALPMSARAQRVTLAYLNQAIERDEGE 307

Query: 617 KDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIR---ILK 673
           KD  + LALYF R  P + + Y+IL D  L KV +  L L            +R   ++K
Sbjct: 308 KDTGVRLALYFTRMAPTLSSPYDILSDPALTKVANVVLGLPATSGAATSDALVRRAALIK 367

Query: 674 KHIKINDFKDSKKVEDFL 691
           + I I  F+D  KV+ F+
Sbjct: 368 QKIDIASFQDPAKVQAFV 385



 Score = 57.0 bits (136), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 50/102 (49%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           + +  E+    ++ YF  NI K+ SVD   KD RL  Y +++  +     +  F++ VLT
Sbjct: 20  TRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDRLYAYAMRAHGLEEMIYAKAFMRRVLT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
            G+A+P  +     D R+   A  F+F  D +    D ++T 
Sbjct: 80  EGVASPSSFANRLADQRYVEFARQFQFATDVTAQGADPVMTG 121



 Score = 49.7 bits (117), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 41/87 (47%)

Query: 492 TQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
           T+K     +  + DY+T NI  + S ++ + + R+  + + + G++     + F+  +  
Sbjct: 20  TRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDRLYAYAMRAHGLEEMIYAKAFMRRVLT 79

Query: 552 SDLKDPKSFANTYKDNRYKEIISSFNF 578
             +  P SFAN   D RY E    F F
Sbjct: 80  EGVASPSSFANRLADQRYVEFARQFQF 106


>gi|89056691|ref|YP_512142.1| flagellar protein, putative [Jannaschia sp. CCS1]
 gi|88866240|gb|ABD57117.1| flagellar protein putative [Jannaschia sp. CCS1]
          Length = 265

 Score = 66.2 bits (160), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 57/104 (54%), Gaps = 4/104 (3%)

Query: 13  DIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEK 72
           D+Q   F+   +DP+ S +  Y+RE I  +S+ ++ + D RL   AL AFGL D      
Sbjct: 23  DVQQTRFA---EDPVQSRDREYFRENIGAVSSAEDLVGDYRLLRVALGAFGLQDDLPNRA 79

Query: 73  FIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQS 115
           F++K+L   + D  +L N+L    Y+ FA ++ F SP P + Q 
Sbjct: 80  FVEKVLSDGVLDDDALSNKLADKTYRAFAEAFGFGSPLPPLTQG 123



 Score = 47.4 bits (111), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 11/107 (10%)

Query: 111 KVIQS--DIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVL 168
           KV+QS  D+Q     +D  QS   +         YFR+NI  ++S + L  D RLL   L
Sbjct: 16  KVLQSTLDVQQTRFAEDPVQSRDRE---------YFRENIGAVSSAEDLVGDYRLLRVAL 66

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRF 215
            +F +     +  F++ VL+ G+ +      +  D  +RA AE F F
Sbjct: 67  GAFGLQDDLPNRAFVEKVLSDGVLDDDALSNKLADKTYRAFAEAFGF 113



 Score = 44.3 bits (103), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 74/205 (36%), Gaps = 23/205 (11%)

Query: 505 DYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTY 564
           +Y+  NI  + S E+L+ + R+L   L + G+        F+ ++    + D  + +N  
Sbjct: 40  EYFRENIGAVSSAEDLVGDYRLLRVALGAFGLQDDLPNRAFVEKVLSDGVLDDDALSNKL 99

Query: 565 KDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALA 624
            D  Y+    +F F              Q     D     +  Q  E    E+D ++ LA
Sbjct: 100 ADKTYRAFAEAFGF------GSPLPPLTQGPGFADKILARFDEQAFEVAVGEQDTDMRLA 153

Query: 625 LYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKI------- 669
           L   R +P I +           +LG   L +V      L      L   K++       
Sbjct: 154 LEATREVPGIASADTSDTTAWLTVLGKPSLRQVFETAFALPSSIGTLDLDKQLDAFRGGA 213

Query: 670 -RILKKHIKINDFKDSKKVEDFLYA 693
            R+L    +    +D   VED + A
Sbjct: 214 ERVLGSS-EFAALQDPTVVEDLVQA 237


>gi|159045898|ref|YP_001534692.1| hypothetical protein Dshi_3358 [Dinoroseobacter shibae DFL 12]
 gi|157913658|gb|ABV95091.1| protein of unknown function DUF1217 [Dinoroseobacter shibae DFL 12]
          Length = 263

 Score = 65.9 bits (159), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/196 (24%), Positives = 88/196 (44%), Gaps = 21/196 (10%)

Query: 503 EVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFAN 562
           E DY+  NI  I + E+L+A++R+L F L + G+D+    + F+ +I      D  + +N
Sbjct: 38  EEDYFRANIGNIETAEQLVADRRLLAFSLSAFGLDADLPNKFFIQKILSDGTSDNAALSN 97

Query: 563 TYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIA 622
              D  Y+E   +F       L   ++ K Q     D+    Y+ Q  E+     + ++ 
Sbjct: 98  RLSDKTYREFSDAFG------LGQGQVRKTQQTSFADEIIQKYETQKFEESVGNVNDDLR 151

Query: 623 LALYFKRTIPNIRNH--------YEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKK 674
           LAL  KR I ++ +         + +LG   L        +L   FA L   +++ +L++
Sbjct: 152 LALNLKREISDLASSDMSERAKLFTVLGSPPLRTTFETAFRLPSAFAGLDIDRQVTVLEE 211

Query: 675 HIK-------INDFKD 683
            ++       I+ FKD
Sbjct: 212 KLESAFGDASISQFKD 227



 Score = 54.3 bits (129), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 4/109 (3%)

Query: 31  EERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
           EE Y+R  I +I T ++ + D+RL +++L AFGL      + FI+KIL    SD  +L N
Sbjct: 38  EEDYFRANIGNIETAEQLVADRRLLAFSLSAFGLDADLPNKFFIQKILSDGTSDNAALSN 97

Query: 91  QLNSLKYQYFARSYDFSPPP--KVIQSDIQHKTIIQDYKQSHQHKEEVA 137
           +L+   Y+ F+ ++        K  Q+    + IIQ Y ++ + +E V 
Sbjct: 98  RLSDKTYREFSDAFGLGQGQVRKTQQTSFADE-IIQKY-ETQKFEESVG 144



 Score = 42.7 bits (99), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 69/160 (43%), Gaps = 15/160 (9%)

Query: 126 YKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
           + QS Q++ E       YFR NI  I + +QL  DRRLL + L +F +     +  F++ 
Sbjct: 29  FGQSTQYRRE-----EDYFRANIGNIETAEQLVADRRLLAFSLSAFGLDADLPNKFFIQK 83

Query: 186 VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI 245
           +L+ G ++         D  +R  ++ F          +     D  I+K  +  F  ++
Sbjct: 84  ILSDGTSDNAALSNRLSDKTYREFSDAFGLGQGQVRKTQQTSFADEIIQKYETQKFEESV 143

Query: 246 DCVPIVSDQNYYKLAIN-----SVSSFSDFLKDPKLFKML 280
             V      +  +LA+N     S  + SD  +  KLF +L
Sbjct: 144 GNV-----NDDLRLALNLKREISDLASSDMSERAKLFTVL 178


>gi|254471377|ref|ZP_05084779.1| flagellar basal-body rod protein flgf [Pseudovibrio sp. JE062]
 gi|211959523|gb|EEA94721.1| flagellar basal-body rod protein flgf [Pseudovibrio sp. JE062]
          Length = 365

 Score = 65.1 bits (157), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 51/86 (59%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
            +KDP ++ E +YY E    + T+D+ + D RL+++ +K  GL DM++A+  ++K+L   
Sbjct: 21  TAKDPEIAREIKYYEENFSKVETVDDLLNDYRLYNFMMKTMGLEDMAYAKGMVRKVLVEG 80

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFS 107
             D  +L N L   +++  A ++ F+
Sbjct: 81  TDDSGALANTLKDKRFKELAEAFPFN 106



 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 98/205 (47%), Gaps = 10/205 (4%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           EI  E+ YY  N + + + ++LL + R+ NF++++ G++     +  + ++      D  
Sbjct: 26  EIAREIKYYEENFSKVETVDDLLNDYRLYNFMMKTMGLEDMAYAKGMVRKVLVEGTDDSG 85

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + ANT KD R+KE+  +F F+  G +  K   + +    +D    L+ +       EE D
Sbjct: 86  ALANTLKDKRFKELAEAFPFNKDGTIKGKFDWESE---GLDPRMVLWSNT----PGEEVD 138

Query: 619 PNIALALYFKRTIP-NIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK 677
               LA YF   +P ++    +IL D  L++V++    +       P+ ++I    ++I 
Sbjct: 139 DVDRLAEYFTLKMPRDVIFTTQILADPALYEVITVAFDVPEEIINGPKSERIDWFDENID 198

Query: 678 INDFKDSKKVEDFLYAAKAMDHQSI 702
           I   K   +++D +  AK  D+  I
Sbjct: 199 IEALKKPSELKDTI--AKYRDNLEI 221



 Score = 55.8 bits (133), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 110/237 (46%), Gaps = 23/237 (9%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           K+      E+A  E KY+ +N  K+ +VD L  D RL ++++++  +     +   ++ V
Sbjct: 18  KERTAKDPEIA-REIKYYEENFSKVETVDDLLNDYRLYNFMMKTMGLEDMAYAKGMVRKV 76

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIV--SNYFNNT 244
           L  G  +        +D RF+ +AE F F  DG++  +    ++    ++V  SN     
Sbjct: 77  LVEGTDDSGALANTLKDKRFKELAEAFPFNKDGTIKGKFDWESEGLDPRMVLWSNTPGEE 136

Query: 245 IDCVPIVSDQNYYKLAI-NSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEN 303
           +D V  +++  Y+ L +   V   +  L DP L++++ ++ F +  EI           N
Sbjct: 137 VDDVDRLAE--YFTLKMPRDVIFTTQILADPALYEVITVA-FDVPEEII----------N 183

Query: 304 DPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY 360
            P   ++ +F       +N     +++ S+++  +  Y+ N +I   D+ + +++ Y
Sbjct: 184 GPKSERIDWF------DENIDIEALKKPSELKDTIAKYRDNLEIREADRTKGIVEQY 234



 Score = 40.8 bits (94), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%)

Query: 621 IALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIND 680
           + LAL F+RT  NI + YEILG   L++VV   L +S          +  ++ +   I  
Sbjct: 250 VRLALNFQRTGGNITSAYEILGSPALYQVVRTVLGMSESMVGSDIDNQAAVINEKFDIKK 309

Query: 681 FKDSKKVEDFL 691
           F+D ++V+ F+
Sbjct: 310 FQDPEEVDKFV 320


>gi|255263694|ref|ZP_05343036.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255106029|gb|EET48703.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 262

 Score = 64.7 bits (156), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 13  DIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEK 72
           D+Q   F+   + P +     Y+RE I  I+T +  + D++L   AL AFGL D  +   
Sbjct: 22  DVQQTAFN---EAPQIERATSYFRENISKITTAEALVADRQLLEVALGAFGLDDDINNTY 78

Query: 73  FIKKILESDLSDPKSLVNQLNSLKYQYFARSY---DFSPPPKVIQS 115
           FIK ILE    D  +L N+L   +Y+ FA S+   DFS P  V+ +
Sbjct: 79  FIKTILEEGTLDDDALANRLADSRYKEFAESFGFGDFSTPRTVLST 124



 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 86/185 (46%), Gaps = 14/185 (7%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           +I     Y+  NI+ I + E L+A++++L   L + G+D       F+  I +    D  
Sbjct: 33  QIERATSYFRENISKITTAEALVADRQLLEVALGAFGLDDDINNTYFIKTILEEGTLDDD 92

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + AN   D+RYKE   SF F   G+ S  +   V   F  DD  + ++    E+   E++
Sbjct: 93  ALANRLADSRYKEFAESFGF---GDFSTPR--TVLSTFP-DDIINRFEAGQFEQAVGEQN 146

Query: 619 PNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIR 670
           P++ LAL F  T+ +I           ++I+G+    K+    L L   FA +   +++ 
Sbjct: 147 PDLRLALNFSSTMESILATDSSNDVLWFKIMGNPPARKLFETALGLPASFAQIDIDRQLG 206

Query: 671 ILKKH 675
           I K+ 
Sbjct: 207 IFKER 211



 Score = 45.1 bits (105), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%)

Query: 141 SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
           + YFR+NI KI + + L  DR+LL+  L +F +     +  F+K +L  G  +       
Sbjct: 38  TSYFRENISKITTAEALVADRQLLEVALGAFGLDDDINNTYFIKTILEEGTLDDDALANR 97

Query: 201 SRDNRFRAMAENFRF 215
             D+R++  AE+F F
Sbjct: 98  LADSRYKEFAESFGF 112


>gi|89068718|ref|ZP_01156104.1| hypothetical protein OG2516_06756 [Oceanicola granulosus HTCC2516]
 gi|89045681|gb|EAR51743.1| hypothetical protein OG2516_06756 [Oceanicola granulosus HTCC2516]
          Length = 274

 Score = 64.7 bits (156), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 82/188 (43%), Gaps = 4/188 (2%)

Query: 504 VDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANT 563
           +D +   +  I + E+LLA++ +  F++ +  ++ Q   +  + ++ + D+ D K+  N 
Sbjct: 37  IDTFRERVGGIETVEDLLADQDVYAFVMRAYDLEDQIFGKALVGKVLEGDITDSKALINR 96

Query: 564 YKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIAL 623
             D R +E+ +   F   G     K     D    +   D Y  Q     + +++  + +
Sbjct: 97  LTDPRMRELYTGLGFTEGG----TKNANTLDPAWQEAMVDRYVEQHFINAQADQNATVGV 152

Query: 624 ALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKD 683
           AL F+R  P I    ++L D+ L  ++   L +    A L   K+  +  +   I   +D
Sbjct: 153 ALEFRRAAPEISTWMDVLKDADLSTLMRTALGVPSSVAQLDIDKQAELFARKFDITKLQD 212

Query: 684 SKKVEDFL 691
             +VE  +
Sbjct: 213 PAEVEKLV 220



 Score = 53.9 bits (128), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 44/73 (60%)

Query: 35  YRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNS 94
           +RER+  I T+++ + D+ ++++ ++A+ L D    +  + K+LE D++D K+L+N+L  
Sbjct: 40  FRERVGGIETVEDLLADQDVYAFVMRAYDLEDQIFGKALVGKVLEGDITDSKALINRLTD 99

Query: 95  LKYQYFARSYDFS 107
            + +       F+
Sbjct: 100 PRMRELYTGLGFT 112


>gi|119384357|ref|YP_915413.1| flagellar protein, putative [Paracoccus denitrificans PD1222]
 gi|119374124|gb|ABL69717.1| flagellar protein, putative [Paracoccus denitrificans PD1222]
          Length = 264

 Score = 63.5 bits (153), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGL-SDMSHAEKFIKKIL 78
             +S+D ++   + Y+ +R   + T D+F+ D R+ + AL+AFGL SD+S+ + F+KK+L
Sbjct: 27  GALSQDHVIRSSKEYFSQRFPLVETADQFVNDYRILTVALRAFGLDSDISN-KYFLKKVL 85

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYK 127
           E+D +D  S +N+L+  +Y    ++  F  P       I   +II+ Y+
Sbjct: 86  EADPNDSGSFINRLSDKRYLRMNQALSFYAPLDERGGVIDISSIIEKYE 134



 Score = 47.8 bits (112), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 92/215 (42%), Gaps = 19/215 (8%)

Query: 476 IHDAENKSFNSMEQISTQKRINLE----INSEVDYYTLNINTIHSFEELLANKRILNFLL 531
           I      S+  +E+   ++R  L     I S  +Y++     + + ++ + + RIL   L
Sbjct: 7   IGPGGYASWKILERTMLRQRGALSQDHVIRSSKEYFSQRFPLVETADQFVNDYRILTVAL 66

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
            + G+DS    + FL ++ ++D  D  SF N   D RY  +  + +F  +  L  +  G 
Sbjct: 67  RAFGLDSDISNKYFLKKVLEADPNDSGSFINRLSDKRYLRMNQALSF--YAPLDER--GG 122

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIR--------NHYEILGD 643
           V D   I    + Y+ + +EK    + P I LAL  +R + ++           Y++L  
Sbjct: 123 VID---ISSIIEKYEIRSLEKNIGGRYPEIELALNARRELSDLAASDASENVKWYQVLSS 179

Query: 644 SKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKI 678
             L +V      L   F+ L   +++  LK    I
Sbjct: 180 KPLRRVFEVAYGLGEGFSALSIDRQLYELKGRTGI 214


>gi|254488868|ref|ZP_05102073.1| flagellar protein, putative [Roseobacter sp. GAI101]
 gi|214045737|gb|EEB86375.1| flagellar protein, putative [Roseobacter sp. GAI101]
          Length = 262

 Score = 63.2 bits (152), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 84/189 (44%), Gaps = 27/189 (14%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
           F T +K   +  +  Y+++ I  I T +  +KD+RL +  L AFGL D  +   FI+K+L
Sbjct: 25  FETFTKSVELKRDTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFGLQDDINNRYFIRKVL 84

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVAL 138
           E   ++  SL N+    +Y   ++++ F P                  +         A 
Sbjct: 85  EEGTTNDDSLANRFADPRYAELSKAFGFGPN-----------------ESRKNGASGFAA 127

Query: 139 EESKYFRKNIHKINSVDQ-------LFKDRRLLDYVLQSFSITPKYISL---PFLKDVLT 188
           E S  F+ N  ++++ DQ       L+  R+L+D      S+  K+ ++   P L+++  
Sbjct: 128 EISAKFQANSFEVSTGDQDQAMRIALYAQRQLVDIAESDGSVDTKWFTIMGDPPLRNLFQ 187

Query: 189 LGLANPKKY 197
             L  P+ +
Sbjct: 188 KALNLPESF 196



 Score = 55.8 bits (133), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 94/210 (44%), Gaps = 21/210 (10%)

Query: 497 NLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKD 556
           ++E+  + +Y+  NI  I + E L+ ++R+L   L + G+        F+ ++ +    +
Sbjct: 31  SVELKRDTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFGLQDDINNRYFIRKVLEEGTTN 90

Query: 557 PKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEE 616
             S AN + D RY E+  +F F   G    +K G     F  + +   ++    E    +
Sbjct: 91  DDSLANRFADPRYAELSKAFGF---GPNESRKNGA--SGFAAEISAK-FQANSFEVSTGD 144

Query: 617 KDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKK 668
           +D  + +ALY +R + +I           + I+GD  L  +  K L L   F  +   ++
Sbjct: 145 QDQAMRIALYAQRQLVDIAESDGSVDTKWFTIMGDPPLRNLFQKALNLPESFGQIDIDQQ 204

Query: 669 IRILKKHIK-------INDFKDSKKVEDFL 691
           + + K+  K       I  F D++K+++ +
Sbjct: 205 LGVFKERAKKAFGTEDIATFGDTEKLQELI 234



 Score = 45.8 bits (107), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           +++YF+KNI  I + + L KDRRLL   L +F +     +  F++ VL  G  N      
Sbjct: 37  DTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFGLQDDINNRYFIRKVLEEGTTNDDSLAN 96

Query: 200 ESRDNRFRAMAENFRFQPDGS 220
              D R+  +++ F F P+ S
Sbjct: 97  RFADPRYAELSKAFGFGPNES 117


>gi|163797864|ref|ZP_02191808.1| hypothetical protein BAL199_20070 [alpha proteobacterium BAL199]
 gi|159176826|gb|EDP61394.1| hypothetical protein BAL199_20070 [alpha proteobacterium BAL199]
          Length = 829

 Score = 62.8 bits (151), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 90/183 (49%), Gaps = 12/183 (6%)

Query: 503 EVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFAN 562
           ++D +  ++  + + ++LL ++R L+F+L + G++S+      L  +  SD  D  SFAN
Sbjct: 52  KIDAFKKSVGKLSTVDDLLKDRRTLSFVLSAFGLESEVNNPGKLKAVLNSDPDDINSFAN 111

Query: 563 TYKDNRYKEI---ISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
              D+R+ E+   +S+  F +       K  ++ D F  +     ++  +  +    +D 
Sbjct: 112 RLSDSRFGELAAFVSAPAFGLKNLTVSDKQSQLIDKFLTNG----FEQSLAAQNPAARD- 166

Query: 620 NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
               AL+F R I ++ N ++ILGD  L  +V+  L L    A     K+  +++   K++
Sbjct: 167 ----ALFFLRRINSVENTFDILGDLPLRSIVTTALNLPAEIARQSVDKQAALIEAKFKLD 222

Query: 680 DFK 682
            FK
Sbjct: 223 SFK 225



 Score = 47.8 bits (112), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 16/133 (12%)

Query: 35  YRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNS 94
           +++ +  +ST+D+ +KD+R  S+ L AFGL    +    +K +L SD  D  S  N+L+ 
Sbjct: 56  FKKSVGKLSTVDDLLKDRRTLSFVLSAFGLESEVNNPGKLKAVLNSDPDDINSFANRLSD 115

Query: 95  LKYQYFARSYDFSPPPKVI---------QSDIQHKTIIQDYKQSHQHKEEVALEESKYFR 145
            ++   A    F   P            QS +  K +   ++QS   +   A  ++ +F 
Sbjct: 116 SRFGELAA---FVSAPAFGLKNLTVSDKQSQLIDKFLTNGFEQSLAAQNPAA-RDALFF- 170

Query: 146 KNIHKINSVDQLF 158
             + +INSV+  F
Sbjct: 171 --LRRINSVENTF 181



 Score = 45.8 bits (107), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 80/162 (49%), Gaps = 8/162 (4%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           + +   +E+V + +   F+K++ K+++VD L KDRR L +VL +F +  +  +   LK V
Sbjct: 40  RTAFAEREDV-VRKIDAFKKSVGKLSTVDDLLKDRRTLSFVLSAFGLESEVNNPGKLKAV 98

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQ---IEKIVSNYFNN 243
           L     +   +     D+RF  +A  F   P  +   ++  ++D Q   I+K ++N F  
Sbjct: 99  LNSDPDDINSFANRLSDSRFGELAA-FVSAP--AFGLKNLTVSDKQSQLIDKFLTNGFEQ 155

Query: 244 TIDCV-PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           ++    P   D  ++   INSV +  D L D  L  ++  +L
Sbjct: 156 SLAAQNPAARDALFFLRRINSVENTFDILGDLPLRSIVTTAL 197


>gi|86139476|ref|ZP_01058045.1| flagellar protein, putative [Roseobacter sp. MED193]
 gi|85823979|gb|EAQ44185.1| flagellar protein, putative [Roseobacter sp. MED193]
          Length = 268

 Score = 62.4 bits (150), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 91/189 (48%), Gaps = 32/189 (16%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
           F   +KDPI+  +  Y+ E I ++ T ++ + D RL   AL AFGL+    ++  I+K+L
Sbjct: 26  FEHFNKDPILERDNEYFMENIGNVKTAEDLVSDYRLLEVALNAFGLASEIDSKAMIQKVL 85

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS------DIQHKTIIQDYKQSHQH 132
           E       +L N+L   ++  F  ++ F P    +        +I  K ++Q ++ +   
Sbjct: 86  EDGSEADDALANKLGDDRWIDFTDAFKFGPGLAPVTGLTYKMQEIADKNVVQSFEDAV-G 144

Query: 133 KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVL-----QSFSITPKYISL---PFLK 184
            ++V+++ +               L+ +R L+D V      +  SIT +++++   P L+
Sbjct: 145 AQDVSMQIA---------------LYAERELVDLVTFDDEGEELSITGQWLNIIGQPQLQ 189

Query: 185 DVL--TLGL 191
            ++  TLGL
Sbjct: 190 SMMQTTLGL 198



 Score = 38.9 bits (89), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%)

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
           H +K+ +   +++YF +NI  + + + L  D RLL+  L +F +  +  S   ++ VL  
Sbjct: 28  HFNKDPILERDNEYFMENIGNVKTAEDLVSDYRLLEVALNAFGLASEIDSKAMIQKVLED 87

Query: 190 GLANPKKYFIESRDNRFRAMAENFRFQP 217
           G         +  D+R+    + F+F P
Sbjct: 88  GSEADDALANKLGDDRWIDFTDAFKFGP 115


>gi|56698279|ref|YP_168652.1| flagellar protein, putative [Ruegeria pomeroyi DSS-3]
 gi|56680016|gb|AAV96682.1| flagellar protein, putative [Ruegeria pomeroyi DSS-3]
          Length = 265

 Score = 62.0 bits (149), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 55/96 (57%), Gaps = 3/96 (3%)

Query: 13  DIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEK 72
           D Q++ FS  +   + + E  Y+ E+I  + T ++ + D+RL   AL AFGL D  +   
Sbjct: 23  DAQAQSFSNST---VRNRESSYFMEKIGQVKTAEDLVSDRRLLQVALGAFGLEDDLNNTY 79

Query: 73  FIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP 108
           F++KILE   +   +L N+L+  +Y+ F++++   P
Sbjct: 80  FVRKILEDGTTSSDALANKLSDKRYREFSKAFGLGP 115



 Score = 42.0 bits (97), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 46/227 (20%), Positives = 97/227 (42%), Gaps = 31/227 (13%)

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI 536
           +DA+ +SF++    ST +      N E  Y+   I  + + E+L++++R+L   L + G+
Sbjct: 22  YDAQAQSFSN----STVR------NRESSYFMEKIGQVKTAEDLVSDRRLLQVALGAFGL 71

Query: 537 DSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNF 596
           +       F+ +I +       + AN   D RY+E   +F     GE+  +  G V    
Sbjct: 72  EDDLNNTYFVRKILEDGTTSSDALANKLSDKRYREFSKAFGLG-PGEI--RTTGLVT--- 125

Query: 597 HIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFK 648
            ++D     +    E+    +D  + +ALY +  +  + +         + ++G   L K
Sbjct: 126 FMEDIVAKNEAAGFEQAVGAQDETMRIALYAQHELKALADDRSSDNAKWFSLMGIPPLRK 185

Query: 649 VVSKKLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVE 688
           ++   L L      +   K++ I +  +       +++ F D + VE
Sbjct: 186 MMETALGLPSGLGSVDIDKQLEIFQDKLQRLTGSPQVSQFTDPEMVE 232



 Score = 39.3 bits (90), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           ES YF + I ++ + + L  DRRLL   L +F +     +  F++ +L  G  +      
Sbjct: 38  ESSYFMEKIGQVKTAEDLVSDRRLLQVALGAFGLEDDLNNTYFVRKILEDGTTSSDALAN 97

Query: 200 ESRDNRFRAMAENFRFQP 217
           +  D R+R  ++ F   P
Sbjct: 98  KLSDKRYREFSKAFGLGP 115


>gi|148259125|ref|YP_001233252.1| hypothetical protein Acry_0105 [Acidiphilium cryptum JF-5]
 gi|146400806|gb|ABQ29333.1| protein of unknown function DUF1217 [Acidiphilium cryptum JF-5]
          Length = 290

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 87/192 (45%), Gaps = 4/192 (2%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  ++  +T  +N+  + ++LL N  +L  LL + G+ SQ        +   S+  DP 
Sbjct: 69  QVQRDIAAFTKAVNSAKTAKQLLQNPTVLKVLLTANGLGSQVGFPALAQKALLSNPSDPN 128

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
             AN       + + ++    I+ + + K +  +Q    I    + Y   +  +  +++ 
Sbjct: 129 GLANQLSSTNSQWLSTA---QIY-QFATKGLSIIQKPSSISTLTNAYAEVLWRQSLDKQT 184

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKI 678
           P ++ ALYF +      N  +ILGDS +  VV+  L +    A  P   + + +   + +
Sbjct: 185 PGLSNALYFIQNAQKFTNATQILGDSVMRSVVTTALGVPQQIAFQPLLAQEQAITSRLDV 244

Query: 679 NDFKDSKKVEDF 690
           + F++ + V+ F
Sbjct: 245 SKFQNKQFVQSF 256



 Score = 52.4 bits (124), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 95/225 (42%), Gaps = 19/225 (8%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KDIQ++     +K P V  +   + + +    T  + +++  +    L A GL      
Sbjct: 58  TKDIQAE-----AKSPQVQRDIAAFTKAVNSAKTAKQLLQNPTVLKVLLTANGLGSQVGF 112

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYF--ARSYDFSPPP-KVIQSDIQHKTIIQDYK 127
               +K L S+ SDP  L NQL+S   Q+   A+ Y F+     +IQ      T+   Y 
Sbjct: 113 PALAQKALLSNPSDPNGLANQLSSTNSQWLSTAQIYQFATKGLSIIQKPSSISTLTNAYA 172

Query: 128 QSHQH----KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL-PF 182
           +        K+   L  + YF +N  K  +  Q+  D  +   V  +  + P+ I+  P 
Sbjct: 173 EVLWRQSLDKQTPGLSNALYFIQNAQKFTNATQILGDSVMRSVVTTALGV-PQQIAFQPL 231

Query: 183 L--KDVLTLGLANPK---KYFIESRDNRFRAMAENFRFQPDGSLS 222
           L  +  +T  L   K   K F++S  +RF A+ +       GS S
Sbjct: 232 LAQEQAITSRLDVSKFQNKQFVQSFADRFLAVTQASNMNAYGSSS 276


>gi|114765258|ref|ZP_01444390.1| hypothetical protein 1100011001307_R2601_00475 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542393|gb|EAU45421.1| hypothetical protein R2601_00475 [Roseovarius sp. HTCC2601]
          Length = 274

 Score = 62.0 bits (149), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 78/159 (49%), Gaps = 7/159 (4%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           +  +P  + E  Y+ + I ++  +++  +D RL+S+ +KA+ L D    +  ++K+LESD
Sbjct: 27  IRNEPQHAREIAYFLDNIGNVENVEDLTEDYRLYSFVMKAYDLEDQIFGKAMMEKLLESD 86

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPK--VIQSDIQHKTIIQDYKQSHQH-----KE 134
           ++D  +LVN+L   +++ F  +  F P  +  +   D   K  + D     Q+      E
Sbjct: 87  INDSSALVNRLTDSRFKDFHNAMGFGPEGQGNLNTLDASWKAAVVDKYVDTQYVNGKGDE 146

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
             A+     FR+    INS   + +D  L ++   +F +
Sbjct: 147 NEAIGTVLEFRRKAGSINSAYDILRDSDLSEFFRTAFGL 185



 Score = 57.0 bits (136), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 86/189 (45%), Gaps = 4/189 (2%)

Query: 503 EVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFAN 562
           E+ Y+  NI  + + E+L  + R+ +F++++  ++ Q   +  + ++ +SD+ D  +  N
Sbjct: 36  EIAYFLDNIGNVENVEDLTEDYRLYSFVMKAYDLEDQIFGKAMMEKLLESDINDSSALVN 95

Query: 563 TYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIA 622
              D+R+K+  ++  F   G+ +   +        +D   D    Q +  K +E +  I 
Sbjct: 96  RLTDSRFKDFHNAMGFGPEGQGNLNTLDASWKAAVVDKYVD---TQYVNGKGDENEA-IG 151

Query: 623 LALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFK 682
             L F+R   +I + Y+IL DS L +       L    A +   ++  I+   + +    
Sbjct: 152 TVLEFRRKAGSINSAYDILRDSDLSEFFRTAFGLPEALAGIDIDRQAAIINDRLDLETLS 211

Query: 683 DSKKVEDFL 691
           D   V+D +
Sbjct: 212 DPDVVDDLV 220



 Score = 40.8 bits (94), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 73/166 (43%), Gaps = 10/166 (6%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
           QH  E+A     YF  NI  + +V+ L +D RL  +V++++ +  +      ++ +L   
Sbjct: 32  QHAREIA-----YFLDNIGNVENVEDLTEDYRLYSFVMKAYDLEDQIFGKAMMEKLLESD 86

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPD--GSLSKRDKILTDMQIEKIV-SNYFNNTIDC 247
           + +         D+RF+       F P+  G+L+  D       ++K V + Y N   D 
Sbjct: 87  INDSSALVNRLTDSRFKDFHNAMGFGPEGQGNLNTLDASWKAAVVDKYVDTQYVNGKGDE 146

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITA 293
              +     ++    S++S  D L+D  L +  + + F L PE  A
Sbjct: 147 NEAIGTVLEFRRKAGSINSAYDILRDSDLSEFFRTA-FGL-PEALA 190


>gi|326402279|ref|YP_004282360.1| hypothetical protein ACMV_01310 [Acidiphilium multivorum AIU301]
 gi|325049140|dbj|BAJ79478.1| hypothetical protein ACMV_01310 [Acidiphilium multivorum AIU301]
          Length = 303

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/192 (20%), Positives = 87/192 (45%), Gaps = 4/192 (2%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  ++  +T  +N+  + ++LL N  +L  LL + G+ SQ        +   S+  DP 
Sbjct: 82  QVQRDIAAFTKAVNSAKTAKQLLQNPTVLKVLLTANGLGSQVGFPALAQKALLSNPSDPN 141

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
             AN       + + ++    I+ + + K +  +Q    I    + Y   +  +  +++ 
Sbjct: 142 GLANQLSSTNSQWLSTA---QIY-QFATKGLSIIQKPSSISTLTNAYAEVLWRQSLDKQT 197

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKI 678
           P ++ ALYF +      N  +ILGDS +  VV+  L +    A  P   + + +   + +
Sbjct: 198 PGLSNALYFIQNAQKFTNATQILGDSVMRSVVTTALGVPQQIAFQPLLAQEQAITSRLDV 257

Query: 679 NDFKDSKKVEDF 690
           + F++ + V+ F
Sbjct: 258 SKFQNKQFVQSF 269



 Score = 52.4 bits (124), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/225 (24%), Positives = 95/225 (42%), Gaps = 19/225 (8%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KDIQ++     +K P V  +   + + +    T  + +++  +    L A GL      
Sbjct: 71  TKDIQAE-----AKSPQVQRDIAAFTKAVNSAKTAKQLLQNPTVLKVLLTANGLGSQVGF 125

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYF--ARSYDFSPPP-KVIQSDIQHKTIIQDYK 127
               +K L S+ SDP  L NQL+S   Q+   A+ Y F+     +IQ      T+   Y 
Sbjct: 126 PALAQKALLSNPSDPNGLANQLSSTNSQWLSTAQIYQFATKGLSIIQKPSSISTLTNAYA 185

Query: 128 QSHQH----KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL-PF 182
           +        K+   L  + YF +N  K  +  Q+  D  +   V  +  + P+ I+  P 
Sbjct: 186 EVLWRQSLDKQTPGLSNALYFIQNAQKFTNATQILGDSVMRSVVTTALGV-PQQIAFQPL 244

Query: 183 L--KDVLTLGLANPK---KYFIESRDNRFRAMAENFRFQPDGSLS 222
           L  +  +T  L   K   K F++S  +RF A+ +       GS S
Sbjct: 245 LAQEQAITSRLDVSKFQNKQFVQSFADRFLAVTQASNMNAYGSSS 289


>gi|190894704|ref|YP_001984997.1| hypothetical protein RHECIAT_PC0000367 [Rhizobium etli CIAT 652]
 gi|190700365|gb|ACE94447.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 193

 Score = 61.6 bits (148), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 45/74 (60%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y+ E I  I+++D+F+   RL +Y L AFGLS    +  F K +L SDL D  S VNQL+
Sbjct: 47  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 106

Query: 94  SLKYQYFARSYDFS 107
              Y   A++++F+
Sbjct: 107 DDVYVSLAKAFNFN 120



 Score = 61.2 bits (147), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 35/98 (35%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 143 YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESR 202
           YF +NI  I SVD      RL +YVL +F ++ +Y S  F KDVLT  L +   +  +  
Sbjct: 47  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 106

Query: 203 DNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
           D+ + ++A+ F F  DGS+     +L++ QI  + S Y
Sbjct: 107 DDVYVSLAKAFNFNEDGSVD--GGLLSEDQISLVTSAY 142



 Score = 51.2 bits (121), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 44/79 (55%)

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK 565
           Y+  NI +I S ++ L++ R+ N++L + G+ ++     F  ++  SDL D  SF N   
Sbjct: 47  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 106

Query: 566 DNRYKEIISSFNFDIHGEL 584
           D+ Y  +  +FNF+  G +
Sbjct: 107 DDVYVSLAKAFNFNEDGSV 125



 Score = 45.1 bits (105), Expect = 0.046,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI 450
           + L A+ L+ +       ++VLTS+  D DS+ N+  DD  + L  AFNFN DGS+
Sbjct: 70  YVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLDDDVYVSLAKAFNFNEDGSV 125


>gi|218510514|ref|ZP_03508392.1| hypothetical protein RetlB5_25561 [Rhizobium etli Brasil 5]
          Length = 112

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 2/96 (2%)

Query: 143 YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESR 202
           YF +NI  I SVD      RL +YVL +F ++ +Y S  F KDVLT  L +   +  +  
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQFD 77

Query: 203 DNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVS 238
           D+ + ++A+ F F  DGS+     +L++ QI  + S
Sbjct: 78  DDVYVSLAKAFNFNEDGSVDG--GLLSEDQISLVTS 111



 Score = 61.2 bits (147), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 45/79 (56%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y+ E I  I+++D+F+   RL +Y L AFGLS    +  F K +L SDL D  S VNQ +
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQFD 77

Query: 94  SLKYQYFARSYDFSPPPKV 112
              Y   A++++F+    V
Sbjct: 78  DDVYVSLAKAFNFNEDGSV 96



 Score = 51.2 bits (121), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 48/88 (54%)

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK 565
           Y+  NI +I S ++ L++ R+ N++L + G+ ++     F  ++  SDL D  SF N + 
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQFD 77

Query: 566 DNRYKEIISSFNFDIHGELSHKKIGKVQ 593
           D+ Y  +  +FNF+  G +    + + Q
Sbjct: 78  DDVYVSLAKAFNFNEDGSVDGGLLSEDQ 105



 Score = 44.3 bits (103), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%)

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
           + L A+ L+ +       ++VLTS+  D DS+ N+  DD  + L  AFNFN DGS+    
Sbjct: 41  YVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQFDDDVYVSLAKAFNFNEDGSVDGGL 100

Query: 455 MMQSRLTI 462
           + + ++++
Sbjct: 101 LSEDQISL 108


>gi|310816824|ref|YP_003964788.1| flagellar protein, putative [Ketogulonicigenium vulgare Y25]
 gi|308755559|gb|ADO43488.1| flagellar protein, putative [Ketogulonicigenium vulgare Y25]
          Length = 262

 Score = 61.2 bits (147), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 4/113 (3%)

Query: 15  QSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFI 74
           Q+ +F+   +   V+    Y+R+ I  I T ++ + D+RL S AL AFGL D  +A+ FI
Sbjct: 25  QTAVFAASGE---VAMNSTYFRDTIAKIQTPEDLLADRRLLSVALGAFGLQDDLNAKAFI 81

Query: 75  KKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK-TIIQDY 126
           K++L     D  +  N+L+  +Y   A ++ F        +D     TI+  Y
Sbjct: 82  KRVLVEGTDDKTAFANKLSDKRYAALANAFGFGNEGGARTADAGFADTILARY 134



 Score = 57.4 bits (137), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 61/138 (44%), Gaps = 6/138 (4%)

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANP 194
           EVA+  S YFR  I KI + + L  DRRLL   L +F +     +  F+K VL  G  + 
Sbjct: 34  EVAMN-STYFRDTIAKIQTPEDLLADRRLLSVALGAFGLQDDLNAKAFIKRVLVEGTDDK 92

Query: 195 KKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQ 254
             +  +  D R+ A+A  F F  +G     D    D  + +  +  F      + +    
Sbjct: 93  TAFANKLSDKRYAALANAFGFGNEGGARTADAGFADTILARYTAESFE-----LAVGEQD 147

Query: 255 NYYKLAINSVSSFSDFLK 272
           N  +LA+N     SD ++
Sbjct: 148 NTMRLALNLSGGISDVMQ 165



 Score = 56.2 bits (134), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 67/171 (39%), Gaps = 14/171 (8%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           E+     Y+   I  I + E+LLA++R+L+  L + G+      + F+  +      D  
Sbjct: 34  EVAMNSTYFRDTIAKIQTPEDLLADRRLLSVALGAFGLQDDLNAKAFIKRVLVEGTDDKT 93

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           +FAN   D RY  + ++F F   G        +  D    D     Y  +  E    E+D
Sbjct: 94  AFANKLSDKRYAALANAFGFGNEGG------ARTADAGFADTILARYTAESFELAVGEQD 147

Query: 619 PNIALALYFKRTIPNIRNH--------YEILGDSKLFKVVSKKLKLSPYFA 661
             + LAL     I ++  H        + ++GDS L  V    L     F 
Sbjct: 148 NTMRLALNLSGGISDVMQHATSDSAQWFAMMGDSPLRSVFETALGFPTGFG 198


>gi|218516824|ref|ZP_03513664.1| hypothetical protein Retl8_26089 [Rhizobium etli 8C-3]
          Length = 164

 Score = 60.8 bits (146), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 30/74 (40%), Positives = 45/74 (60%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y+ E I  I+++D+F+   RL +Y L AFGLS    +  F K +L SDL D  S VNQL+
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 77

Query: 94  SLKYQYFARSYDFS 107
              Y   A++++F+
Sbjct: 78  DDVYVSLAKAFNFN 91



 Score = 60.5 bits (145), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 35/98 (35%), Positives = 54/98 (55%), Gaps = 2/98 (2%)

Query: 143 YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESR 202
           YF +NI  I SVD      RL +YVL +F ++ +Y S  F KDVLT  L +   +  +  
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 77

Query: 203 DNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
           D+ + ++A+ F F  DGS+     +L++ QI  + S Y
Sbjct: 78  DDVYVSLAKAFNFNEDGSVD--GGLLSEDQISLVTSAY 113



 Score = 50.4 bits (119), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 44/79 (55%)

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK 565
           Y+  NI +I S ++ L++ R+ N++L + G+ ++     F  ++  SDL D  SF N   
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 77

Query: 566 DNRYKEIISSFNFDIHGEL 584
           D+ Y  +  +FNF+  G +
Sbjct: 78  DDVYVSLAKAFNFNEDGSV 96



 Score = 44.7 bits (104), Expect = 0.061,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI 450
           + L A+ L+ +       ++VLTS+  D DS+ N+  DD  + L  AFNFN DGS+
Sbjct: 41  YVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLDDDVYVSLAKAFNFNEDGSV 96


>gi|126738585|ref|ZP_01754290.1| flagellar protein, putative [Roseobacter sp. SK209-2-6]
 gi|126720384|gb|EBA17090.1| flagellar protein, putative [Roseobacter sp. SK209-2-6]
          Length = 268

 Score = 60.5 bits (145), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
           F   S    +  E  Y+ E I  + T ++ IKD+RL S AL AFGL D    +  ++K+L
Sbjct: 26  FEVFSSGAAIERESDYFLENIGKVETAEDLIKDRRLLSVALGAFGLEDQIDMKALVQKVL 85

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQ 118
           E   S   +L  +L   ++  F  ++ F P       D++
Sbjct: 86  EEGSSADDALATRLGDDRWVSFTDAFGFGPGESRKTGDLE 125



 Score = 47.8 bits (112), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 92/212 (43%), Gaps = 26/212 (12%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           I  E DY+  NI  + + E+L+ ++R+L+  L + G++ Q   +  + ++ +       +
Sbjct: 35  IERESDYFLENIGKVETAEDLIKDRRLLSVALGAFGLEDQIDMKALVQKVLEEGSSADDA 94

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            A    D+R+     +F F   G    +K G ++    + D     K Q  E     ++ 
Sbjct: 95  LATRLGDDRWVSFTDAFGF---GPGESRKTGDLE---AMKDVVFTNKTQSFETAVGNQEQ 148

Query: 620 NIALALYFKRTI------------PNIRNH-YEILGDSKLFKVVSKKLKLSPYFAVLPER 666
            + +ALY +R +            P+I    Y I+G  +L  ++   L L      +   
Sbjct: 149 TLRVALYAERELVPLVAEGEDGETPSINTQWYNIIGQPQLHSMMQTALGLPDSIGQVDVD 208

Query: 667 KKIRILKKHIK-------INDFKDSKKVEDFL 691
           ++++I ++  +       +++F D +K+ + +
Sbjct: 209 QQVKIFREASERFFGSDDLSEFSDPEKMSNLI 240



 Score = 47.0 bits (110), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 75/162 (46%), Gaps = 20/162 (12%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           ES YF +NI K+ + + L KDRRLL   L +F +  +      ++ VL  G +       
Sbjct: 38  ESDYFLENIGKVETAEDLIKDRRLLSVALGAFGLEDQIDMKALVQKVLEEGSSADDALAT 97

Query: 200 ESRDNRFRAMAENFRFQPD-----GSL-SKRDKILTD--MQIEKIVSNYFNNTI------ 245
              D+R+ +  + F F P      G L + +D + T+     E  V N    T+      
Sbjct: 98  RLGDDRWVSFTDAFGFGPGESRKTGDLEAMKDVVFTNKTQSFETAVGNQ-EQTLRVALYA 156

Query: 246 --DCVPIVSD-QNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             + VP+V++ ++    +IN  + + + +  P+L  M+Q +L
Sbjct: 157 ERELVPLVAEGEDGETPSIN--TQWYNIIGQPQLHSMMQTAL 196


>gi|163733161|ref|ZP_02140605.1| flagellar protein, putative [Roseobacter litoralis Och 149]
 gi|161393696|gb|EDQ18021.1| flagellar protein, putative [Roseobacter litoralis Och 149]
          Length = 262

 Score = 59.7 bits (143), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 59/110 (53%), Gaps = 1/110 (0%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
           F+  ++   ++    Y+ E+I  ++T +E + D+RL   AL AFGL D      FIKK+L
Sbjct: 25  FAAFNQSSQLARAAEYFEEKISSVTTAEELVADRRLREVALGAFGLQDDIDNRFFIKKVL 84

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKV-IQSDIQHKTIIQDYK 127
           E   ++  SL N+ +  +Y+ F+ ++   P  ++ +Q     + II  Y+
Sbjct: 85  EEGTTNEDSLANRFSDSRYKDFSAAFGLGPGEQLKLQDTGFAQDIIAKYR 134



 Score = 58.9 bits (141), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/230 (20%), Positives = 99/230 (43%), Gaps = 31/230 (13%)

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI 536
           +D++  +FN   Q++             +Y+   I+++ + EEL+A++R+    L + G+
Sbjct: 21  YDSQFAAFNQSSQLA----------RAAEYFEEKISSVTTAEELVADRRLREVALGAFGL 70

Query: 537 DSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNF 596
                   F+ ++ +    +  S AN + D+RYK+  ++F      +L      K+QD  
Sbjct: 71  QDDIDNRFFIKKVLEEGTTNEDSLANRFSDSRYKDFSAAFGLGPGEQL------KLQDTG 124

Query: 597 HIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFK 648
              D    Y+    E     +D ++ +AL+ +R IP +           + I+G   L  
Sbjct: 125 FAQDIIAKYRANSFEIATGSQDDSMRVALFAQREIPALATDDTSNDAKWFGIMGQPPLRA 184

Query: 649 VVSKKLKLSPYFAVLPERKKIRILKKHIK-------INDFKDSKKVEDFL 691
           V  K L L   F  +   +++ + K+  +       ++ F   + V+D +
Sbjct: 185 VFEKALNLPSSFGQIDIDQQLVVFKERSRAVFGTDEVSQFAGDEAVQDLV 234



 Score = 39.3 bits (90), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 44/101 (43%)

Query: 141 SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
           ++YF + I  + + ++L  DRRL +  L +F +     +  F+K VL  G  N       
Sbjct: 38  AEYFEEKISSVTTAEELVADRRLREVALGAFGLQDDIDNRFFIKKVLEEGTTNEDSLANR 97

Query: 201 SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF 241
             D+R++  +  F   P   L  +D       I K  +N F
Sbjct: 98  FSDSRYKDFSAAFGLGPGEQLKLQDTGFAQDIIAKYRANSF 138


>gi|163744335|ref|ZP_02151695.1| hypothetical protein OIHEL45_02090 [Oceanibulbus indolifex HEL-45]
 gi|161381153|gb|EDQ05562.1| hypothetical protein OIHEL45_02090 [Oceanibulbus indolifex HEL-45]
          Length = 277

 Score = 59.3 bits (142), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 82/172 (47%), Gaps = 19/172 (11%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           V+ D + + +   ++ERI  I +  EF+ D  ++++ ++AF L D    +  I+K+LES+
Sbjct: 27  VANDALNARQIEAFKERIGDIKSAKEFVADTEVYTFVMRAFDLEDQIFGKAMIRKVLESN 86

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPP-------------KVIQSDIQHKTIIQDYKQ 128
             +P +LVN+L++ K +    +  F+P               +VI  D   + I+ +   
Sbjct: 87  SDEPSALVNRLSNPKIKEMYDTLGFAPGGGRSFNFNRTGWQDEVI--DRFKERIVLNSAG 144

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
                  +ALE    F+    +INS   + KD  L  ++ ++  +  + I +
Sbjct: 145 EENEGARIALE----FKSKAGEINSWLDVLKDADLGSFMRRALGVPNEAIGV 192


>gi|126734100|ref|ZP_01749847.1| flagellar protein, putative [Roseobacter sp. CCS2]
 gi|126716966|gb|EBA13830.1| flagellar protein, putative [Roseobacter sp. CCS2]
          Length = 268

 Score = 58.9 bits (141), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 46/82 (56%), Gaps = 2/82 (2%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y+RE I  + T  + + D++L S AL AFGL D  +   FI+KILE       +L N+L 
Sbjct: 41  YFRENIGDVRTASDLVNDRQLLSIALGAFGLDDDINNRAFIQKILEDGTVAQDALANRLA 100

Query: 94  SLKYQYFARSYDF--SPPPKVI 113
             +Y  F+ ++ F  SP P+ +
Sbjct: 101 DNRYADFSAAFGFGDSPIPRTV 122



 Score = 42.7 bits (99), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 33/165 (20%), Positives = 70/165 (42%), Gaps = 14/165 (8%)

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
           I    DY+  NI  + +  +L+ ++++L+  L + G+D       F+ +I +       +
Sbjct: 35  IQRATDYFRENIGDVRTASDLVNDRQLLSIALGAFGLDDDINNRAFIQKILEDGTVAQDA 94

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            AN   DNRY +  ++F F     +    +G+        +  D ++ Q   +   E++ 
Sbjct: 95  LANRLADNRYADFSAAFGFG-DSPIPRTVLGRFP-----TEIIDRFEAQQFARAIGEQNN 148

Query: 620 NIALALYFKRTIPNI--------RNHYEILGDSKLFKVVSKKLKL 656
           ++ LA      + +I           + I+G++ L +V    L L
Sbjct: 149 DMRLASNVNSGVADIVAGNATNTGRWFSIMGNAPLREVFQTALGL 193


>gi|260574408|ref|ZP_05842412.1| protein of unknown function DUF1217 [Rhodobacter sp. SW2]
 gi|259023304|gb|EEW26596.1| protein of unknown function DUF1217 [Rhodobacter sp. SW2]
          Length = 267

 Score = 58.9 bits (141), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 3/82 (3%)

Query: 31  EERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
           EE Y+R  I  I T +  + D++L   AL AFGL    +++ FI+K+LE       +L N
Sbjct: 38  EEEYFRANIGKIKTAEALVSDRKLLKVALGAFGLDADINSKAFIQKVLEGGTLKTGALAN 97

Query: 91  QLNSLKYQYFARSY---DFSPP 109
           +L   +YQ F+  +   DF+ P
Sbjct: 98  KLADKQYQAFSAGFGFGDFATP 119



 Score = 52.8 bits (125), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 92/214 (42%), Gaps = 28/214 (13%)

Query: 490 ISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
           +ST KR       E +Y+  NI  I + E L++++++L   L + G+D+    + F+ ++
Sbjct: 32  VSTSKR-------EEEYFRANIGKIKTAEALVSDRKLLKVALGAFGLDADINSKAFIQKV 84

Query: 550 FKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
            +       + AN   D +Y+   + F F   G+ +     + Q +   D+    YK++ 
Sbjct: 85  LEGGTLKTGALANKLADKQYQAFSAGFGF---GDFATP---RTQLSTFADEILTAYKNRQ 138

Query: 610 IEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFA 661
            E    E++ ++ LA+  +R +  +           + ++G   L  V  K   L    A
Sbjct: 139 FETAVGEQNDDMRLAMNVERELVTLAGKSTTEDAKWFTVMGSKPLRAVFEKAFGLPSSLA 198

Query: 662 VLPERKKIRILK-------KHIKINDFKDSKKVE 688
            L   +++ + K           ++ F D+ K++
Sbjct: 199 ALDLDQQLSVFKSAANKAFGATSVSQFADTTKLD 232



 Score = 45.4 bits (106), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           E +YFR NI KI + + L  DR+LL   L +F +     S  F++ VL  G         
Sbjct: 38  EEEYFRANIGKIKTAEALVSDRKLLKVALGAFGLDADINSKAFIQKVLEGGTLKTGALAN 97

Query: 200 ESRDNRFRAMAENFRF----QPDGSLSK-RDKILT 229
           +  D +++A +  F F     P   LS   D+ILT
Sbjct: 98  KLADKQYQAFSAGFGFGDFATPRTQLSTFADEILT 132


>gi|85706198|ref|ZP_01037293.1| flagellar protein, putative [Roseovarius sp. 217]
 gi|85669362|gb|EAQ24228.1| flagellar protein, putative [Roseovarius sp. 217]
          Length = 267

 Score = 58.9 bits (141), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 65/127 (51%), Gaps = 11/127 (8%)

Query: 15  QSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFI 74
           QS LF+   K P +  +  Y+ + I  I+T ++ + D+RL   AL AFGL +   +  FI
Sbjct: 25  QSDLFN---KSPQIVRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAFGLQEDIDSRAFI 81

Query: 75  KKILESDLSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQHKTIIQDYKQSHQH 132
           + ILE    +  SL N+L   +Y+  A ++ F+  P P+      Q  T   +  +  + 
Sbjct: 82  RAILEGGTINEDSLANRLADDRYKQLAEAFAFADRPIPRT-----QLSTFGSEITEKFRR 136

Query: 133 KE-EVAL 138
           +E EVA+
Sbjct: 137 REFEVAV 143



 Score = 57.4 bits (137), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 79/171 (46%), Gaps = 14/171 (8%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           +I  + DY+   I  I + E+L++++R+L   L + G+        F+  I +    +  
Sbjct: 34  QIVRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAFGLQEDIDSRAFIRAILEGGTINED 93

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           S AN   D+RYK++  +F F      + + I + Q +    +  + ++ +  E    ++D
Sbjct: 94  SLANRLADDRYKQLAEAFAF------ADRPIPRTQLSTFGSEITEKFRRREFEVAVGDQD 147

Query: 619 PNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFA 661
            ++ LAL  +R + +I           + ILG++ L +V    L L   FA
Sbjct: 148 QSLRLALNARRELGDIAGDDAAEDTRWFRILGNTPLRRVFEVALGLPESFA 198



 Score = 46.2 bits (108), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 65/153 (42%), Gaps = 20/153 (13%)

Query: 138 LEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY 197
           + ++ YF + I KI + + L  DRRLL   L +F +     S  F++ +L  G  N    
Sbjct: 36  VRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAFGLQEDIDSRAFIRAILEGGTINEDSL 95

Query: 198 FIESRDNRFRAMAENFRFQ----PDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD 253
                D+R++ +AE F F     P   LS     +T    EK     F         V D
Sbjct: 96  ANRLADDRYKQLAEAFAFADRPIPRTQLSTFGSEIT----EKFRRREFEVA------VGD 145

Query: 254 QNY-YKLAINSVSSFSDF-----LKDPKLFKML 280
           Q+   +LA+N+     D       +D + F++L
Sbjct: 146 QDQSLRLALNARRELGDIAGDDAAEDTRWFRIL 178



 Score = 41.6 bits (96), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 61/125 (48%), Gaps = 27/125 (21%)

Query: 335 QKMLDLYKKNCQILHDDKMQSLIKDY-QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           ++  DL+ K+ QI+ D        DY +  +GKI + ++L+S +               L
Sbjct: 23  ERQSDLFNKSPQIVRD-------TDYFEQTIGKITTAEDLVSDRR-------------LL 62

Query: 394 QFALDAYNLNMQDLD-RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGP 452
           + AL A+ L  +D+D R  +R +L     + DS AN+  DDR  +L  AF F AD    P
Sbjct: 63  RVALGAFGLQ-EDIDSRAFIRAILEGGTINEDSLANRLADDRYKQLAEAFAF-AD---RP 117

Query: 453 IPMMQ 457
           IP  Q
Sbjct: 118 IPRTQ 122


>gi|294679038|ref|YP_003579653.1| flagellar protein [Rhodobacter capsulatus SB 1003]
 gi|294477858|gb|ADE87246.1| flagellar protein, putative [Rhodobacter capsulatus SB 1003]
          Length = 275

 Score = 57.4 bits (137), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 2/81 (2%)

Query: 31  EERYYRERIKHISTIDEFIKDKRLFSYALKAFGL-SDMSHAEKFIKKILESDLSDPKSLV 89
           +E Y+R +I  I+T ++ + D+RL   AL AFGL SD+ + + FI+K+LE+   D   L 
Sbjct: 38  DEDYFRAKIGSITTAEDLVSDRRLLKVALGAFGLDSDIDN-KFFIRKVLETAADDKTGLA 96

Query: 90  NQLNSLKYQYFARSYDFSPPP 110
           N+L    Y   A ++ F   P
Sbjct: 97  NKLADKTYLKLATAFGFGDTP 117



 Score = 50.4 bits (119), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 79/179 (44%), Gaps = 13/179 (7%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           +ME+       + +I  + DY+   I +I + E+L++++R+L   L + G+DS    + F
Sbjct: 21  TMEKQKAAFAASADIKRDEDYFRAKIGSITTAEDLVSDRRLLKVALGAFGLDSDIDNKFF 80

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++ ++   D    AN   D  Y ++ ++F F   G+       + Q +   D+    Y
Sbjct: 81  IRKVLETAADDKTGLANKLADKTYLKLATAFGF---GDTPDAP--RTQTSGFADEILSKY 135

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNHYEILGDSKLFKVVSKKLKL 656
           + +  E    E D +  LA+  +R +  +           Y ++G   L  V+   L L
Sbjct: 136 ETRQFETAVGESDESYRLAMAAQRDLGELVASSSTNNAKWYSVIGSKSLSTVMRTALGL 194


>gi|84502363|ref|ZP_01000499.1| hypothetical protein OB2597_20146 [Oceanicola batsensis HTCC2597]
 gi|84389175|gb|EAQ01972.1| hypothetical protein OB2597_20146 [Oceanicola batsensis HTCC2597]
          Length = 274

 Score = 57.0 bits (136), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/209 (19%), Positives = 97/209 (46%), Gaps = 8/209 (3%)

Query: 504 VDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANT 563
           ++++  NI  + + ++LL ++ +  F++ +  ++ Q   +  + ++ KS++++  +  N 
Sbjct: 37  IEHFKANIKDVETVDQLLEDQELYAFVMRAFDLEDQIFGKAMIEKVLKSNIEENDALVNR 96

Query: 564 YKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIAL 623
             D R++E+ +   F   GE +   I     N  +D     Y  +      EE++  + +
Sbjct: 97  LTDPRFREMYNELGFGTDGEGNLNTILNTWQNRMVDR----YVERQFINFTEEQNETVGI 152

Query: 624 ALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKD 683
           AL F+  + +I + ++IL D+++ +     L L    + +   K+  +L+  I ++   D
Sbjct: 153 ALEFRNKVGDINSVFDILKDNQMTRFFQTALGLPSQMSGIDIDKQAELLESKIDLDTLSD 212

Query: 684 ----SKKVEDFLYAAKAMDHQSIDYKKAL 708
                K V  ++  + A+   S     AL
Sbjct: 213 PEVVDKLVRKYVAISDALSGTSTQSNGAL 241



 Score = 55.1 bits (131), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 72/141 (51%), Gaps = 15/141 (10%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           +++  IK + T+D+ ++D+ L+++ ++AF L D    +  I+K+L+S++ +  +LVN+L 
Sbjct: 39  HFKANIKDVETVDQLLEDQELYAFVMRAFDLEDQIFGKAMIEKVLKSNIEENDALVNRLT 98

Query: 94  SLKYQYFARSYDFSPPPK----VIQSDIQHKTIIQ-------DYKQSHQHKEEVALEESK 142
             +++       F    +     I +  Q++ + +       ++ +       +ALE   
Sbjct: 99  DPRFREMYNELGFGTDGEGNLNTILNTWQNRMVDRYVERQFINFTEEQNETVGIALE--- 155

Query: 143 YFRKNIHKINSVDQLFKDRRL 163
            FR  +  INSV  + KD ++
Sbjct: 156 -FRNKVGDINSVFDILKDNQM 175



 Score = 50.4 bits (119), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 72/164 (43%), Gaps = 14/164 (8%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           + S QHK  +     ++F+ NI  + +VDQL +D+ L  +V+++F +  +      ++ V
Sbjct: 28  RNSAQHKRAI-----EHFKANIKDVETVDQLLEDQELYAFVMRAFDLEDQIFGKAMIEKV 82

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGS------LSKRDKILTDMQIEKIVSNY 240
           L   +           D RFR M     F  DG       L+     + D  +E+   N+
Sbjct: 83  LKSNIEENDALVNRLTDPRFREMYNELGFGTDGEGNLNTILNTWQNRMVDRYVERQFINF 142

Query: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
                + V I  +   ++  +  ++S  D LKD ++ +  Q +L
Sbjct: 143 TEEQNETVGIALE---FRNKVGDINSVFDILKDNQMTRFFQTAL 183


>gi|99082811|ref|YP_614965.1| hypothetical protein TM1040_2971 [Ruegeria sp. TM1040]
 gi|99039091|gb|ABF65703.1| conserved hypothetical protein [Ruegeria sp. TM1040]
          Length = 650

 Score = 56.6 bits (135), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y+ E I  +++ ++ + D+RL   A+KAFGL +  +    +++ L    S   +L N +N
Sbjct: 41  YFAENIGEVTSSEDLLNDRRLLQVAVKAFGLEEEINYRALLQRALNEGTSASDALANTMN 100

Query: 94  SLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVA 137
             +Y  F+ ++ F P    + SD +    + D  QS   +E V 
Sbjct: 101 DERYVEFSNAFGFGPGQSPMTSDSKAMQAVIDKFQSASFEEAVG 144



 Score = 41.6 bits (96), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 55/130 (42%), Gaps = 6/130 (4%)

Query: 505 DYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTY 564
           +Y+  NI  + S E+LL ++R+L   +++ G++ +      L            + ANT 
Sbjct: 40  EYFAENIGEVTSSEDLLNDRRLLQVAVKAFGLEEEINYRALLQRALNEGTSASDALANTM 99

Query: 565 KDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALA 624
            D RY E  ++F F         +     D+  +    D ++    E+   E D  +  A
Sbjct: 100 NDERYVEFSNAFGF------GPGQSPMTSDSKAMQAVIDKFQSASFEEAVGEVDETMRTA 153

Query: 625 LYFKRTIPNI 634
           L+ KR +  +
Sbjct: 154 LFAKRAMIEV 163



 Score = 41.2 bits (95), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 45/109 (41%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           +S+YF +NI ++ S + L  DRRLL   +++F +  +      L+  L  G +       
Sbjct: 38  DSEYFAENIGEVTSSEDLLNDRRLLQVAVKAFGLEEEINYRALLQRALNEGTSASDALAN 97

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
              D R+   +  F F P  S    D       I+K  S  F   +  V
Sbjct: 98  TMNDERYVEFSNAFGFGPGQSPMTSDSKAMQAVIDKFQSASFEEAVGEV 146


>gi|125654647|ref|YP_001033841.1| flagellar basal-body rod protein FLGF [Rhodobacter sphaeroides
           2.4.1]
 gi|77386307|gb|ABA81736.1| possible flagellar basal-body ROD protein FLGF [Rhodobacter
           sphaeroides 2.4.1]
          Length = 262

 Score = 56.6 bits (135), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +D  +
Sbjct: 35  VQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGAADKGA 94

Query: 88  LVNQLNSLKYQYFARSYDF 106
           L N+L+  ++   A+++DF
Sbjct: 95  LANRLSDKRWLALAKAFDF 113



 Score = 50.1 bits (118), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 69/181 (38%), Gaps = 14/181 (7%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  EV Y+   I T+ + E+L+++ R+L   L + G+      +  + ++      D  
Sbjct: 34  QVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGAADKG 93

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + AN   D R+  +  +F+F                    D     Y+ Q  E    E D
Sbjct: 94  ALANRLSDKRWLALAKAFDF------GGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVD 147

Query: 619 PNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIR 670
            N+ LAL     +  + +         + +LG + L  V      L   FA L   +++ 
Sbjct: 148 ANLGLALTLDHEMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVE 207

Query: 671 I 671
           I
Sbjct: 208 I 208


>gi|126464886|ref|YP_001041862.1| hypothetical protein Rsph17029_4159 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126106701|gb|ABN79226.1| protein of unknown function DUF1217 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 262

 Score = 56.6 bits (135), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +D  +
Sbjct: 35  VQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGAADKGA 94

Query: 88  LVNQLNSLKYQYFARSYDF 106
           L N+L+  ++   A+++DF
Sbjct: 95  LANRLSDKRWLALAKAFDF 113



 Score = 53.1 bits (126), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 70/181 (38%), Gaps = 14/181 (7%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  EV Y+   I T+ + E+L+++ R+L   L + G+      +  + ++      D  
Sbjct: 34  QVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGAADKG 93

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + AN   D R+  +  +F+F                    D     Y+ Q  E    E D
Sbjct: 94  ALANRLSDKRWLALAKAFDF------GGTSGAGTGTAGFADRIAGQYRTQSFEAAIGEVD 147

Query: 619 PNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIR 670
            N+ LAL   R +  + +         + +LG + L  V      L   FA L   +++ 
Sbjct: 148 ANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVE 207

Query: 671 I 671
           I
Sbjct: 208 I 208


>gi|221634512|ref|YP_002523200.1| hypothetical protein RSKD131_4487 [Rhodobacter sphaeroides KD131]
 gi|221163385|gb|ACM04347.1| Hypothetical Protein RSKD131_4487 [Rhodobacter sphaeroides KD131]
          Length = 262

 Score = 56.6 bits (135), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +D  +
Sbjct: 35  VQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGAADKGA 94

Query: 88  LVNQLNSLKYQYFARSYDF 106
           L N+L+  ++   A+++DF
Sbjct: 95  LANRLSDKRWLALAKAFDF 113



 Score = 53.1 bits (126), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 70/181 (38%), Gaps = 14/181 (7%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  EV Y+   I T+ + E+L+++ R+L   L + G+      +  + ++      D  
Sbjct: 34  QVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGAADKG 93

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + AN   D R+  +  +F+F                    D     Y+ Q  E    E D
Sbjct: 94  ALANRLSDKRWLALAKAFDF------GGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVD 147

Query: 619 PNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIR 670
            N+ LAL   R +  + +         + +LG + L  V      L   FA L   +++ 
Sbjct: 148 ANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVE 207

Query: 671 I 671
           I
Sbjct: 208 I 208


>gi|259417640|ref|ZP_05741559.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259346546|gb|EEW58360.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 650

 Score = 56.2 bits (134), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y+ E I  +++ ++ + D+RL   A+KAFGL +  +    +++ L    S   +L N +N
Sbjct: 41  YFAENIGGVTSSEDLLNDRRLLQVAVKAFGLEEEINYRALLQRALNEGTSASDALANTMN 100

Query: 94  SLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVA 137
             +Y  F+ ++ F P    + SD +    + D  QS   +E V 
Sbjct: 101 DERYVEFSNAFGFGPGQSPMTSDSKAMQAVIDKFQSASFEEAVG 144



 Score = 42.0 bits (97), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 55/130 (42%), Gaps = 6/130 (4%)

Query: 505 DYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTY 564
           +Y+  NI  + S E+LL ++R+L   +++ G++ +      L            + ANT 
Sbjct: 40  EYFAENIGGVTSSEDLLNDRRLLQVAVKAFGLEEEINYRALLQRALNEGTSASDALANTM 99

Query: 565 KDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALA 624
            D RY E  ++F F         +     D+  +    D ++    E+   E D  +  A
Sbjct: 100 NDERYVEFSNAFGF------GPGQSPMTSDSKAMQAVIDKFQSASFEEAVGEVDETMRTA 153

Query: 625 LYFKRTIPNI 634
           L+ KR +  +
Sbjct: 154 LFAKRAMIEV 163



 Score = 40.8 bits (94), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 44/109 (40%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           +S+YF +NI  + S + L  DRRLL   +++F +  +      L+  L  G +       
Sbjct: 38  DSEYFAENIGGVTSSEDLLNDRRLLQVAVKAFGLEEEINYRALLQRALNEGTSASDALAN 97

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
              D R+   +  F F P  S    D       I+K  S  F   +  V
Sbjct: 98  TMNDERYVEFSNAFGFGPGQSPMTSDSKAMQAVIDKFQSASFEEAVGEV 146


>gi|332561334|ref|ZP_08415649.1| flagellar basal-body rod protein FLGF [Rhodobacter sphaeroides
           WS8N]
 gi|332274133|gb|EGJ19450.1| flagellar basal-body rod protein FLGF [Rhodobacter sphaeroides
           WS8N]
          Length = 262

 Score = 55.8 bits (133), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +D  +
Sbjct: 35  VQREVAYFAEKIDTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGAADKGA 94

Query: 88  LVNQLNSLKYQYFARSYDF 106
           L N+L+  ++   A+++DF
Sbjct: 95  LANRLSDKRWLALAKAFDF 113



 Score = 52.8 bits (125), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 71/181 (39%), Gaps = 14/181 (7%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           ++  EV Y+   I+T+ + E+L+++ R+L   L + G+      +  + ++      D  
Sbjct: 34  QVQREVAYFAEKIDTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGAADKG 93

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + AN   D R+  +  +F+F                    D     Y+ Q  E    E D
Sbjct: 94  ALANRLSDKRWLALAKAFDF------GGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVD 147

Query: 619 PNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIR 670
            N+ LAL   R +  + +         + +LG + L  V      L   FA L   +++ 
Sbjct: 148 ANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVE 207

Query: 671 I 671
           I
Sbjct: 208 I 208


>gi|260432290|ref|ZP_05786261.1| putative flagellar protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416118|gb|EEX09377.1| putative flagellar protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 265

 Score = 55.8 bits (133), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 88/193 (45%), Gaps = 26/193 (13%)

Query: 13  DIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEK 72
           D Q + FS  +++     E +Y+ E I+++ + ++ + D+RL   AL AFGL        
Sbjct: 23  DAQLQTFSASAEN---ERETQYFLENIRNVRSAEDLVSDRRLLRVALDAFGLEADLDNRY 79

Query: 73  FIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQH 132
           FI+K+L        +L N+L   +Y+ F+ ++   P       +++   +I D ++  Q 
Sbjct: 80  FIQKVLSDGTKAEDALANRLADSRYREFSEAFGLGP------GEVRKTALITDMEKIAQK 133

Query: 133 K-----EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY---ISLPFLK 184
                 E    E  +  R  ++  +S+ +L +         Q+ S T K+   +SLP L+
Sbjct: 134 GIVARFESAVGESDETMRIALYAQHSLRELAE---------QTGSETKKWYDLMSLPPLR 184

Query: 185 DVLTLGLANPKKY 197
            ++   L  P  +
Sbjct: 185 SMMETALGLPSSF 197



 Score = 48.9 bits (115), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 86/200 (43%), Gaps = 22/200 (11%)

Query: 503 EVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFAN 562
           E  Y+  NI  + S E+L++++R+L   L++ G+++      F+ ++     K   + AN
Sbjct: 38  ETQYFLENIRNVRSAEDLVSDRRLLRVALDAFGLEADLDNRYFIQKVLSDGTKAEDALAN 97

Query: 563 TYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEE---EKDP 619
              D+RY+E   +F             G+V+    I D   + +  ++ + E    E D 
Sbjct: 98  RLADSRYREFSEAFGLG---------PGEVRKTALITDMEKIAQKGIVARFESAVGESDE 148

Query: 620 NIALALYFK--------RTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRI 671
            + +ALY +        +T    +  Y+++    L  ++   L L   F  L   K++ I
Sbjct: 149 TMRIALYAQHSLRELAEQTGSETKKWYDLMSLPPLRSMMETALGLPSSFGQLDIDKQLEI 208

Query: 672 LKKHIKINDFKDSKKVEDFL 691
            +   K+     S+ +  F+
Sbjct: 209 FRD--KLAGLTGSEDLSQFV 226


>gi|83955108|ref|ZP_00963764.1| hypothetical protein NAS141_03346 [Sulfitobacter sp. NAS-14.1]
 gi|83840437|gb|EAP79610.1| hypothetical protein NAS141_03346 [Sulfitobacter sp. NAS-14.1]
          Length = 274

 Score = 54.7 bits (130), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 75/157 (47%), Gaps = 8/157 (5%)

Query: 32  ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
           E  +R RI  IS+ +E I D  ++S+ ++AF L D    +  I+K+LESD  +P SL+N+
Sbjct: 37  EEAFRNRIGDISSPEELIADFEVYSFVMRAFDLEDQIFGKGLIRKMLESDPVEPSSLLNR 96

Query: 92  LNSLKYQYFARSYDFSP-----PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKY--- 143
           L   +++    +  F+       P +   D  +    + Y + + ++ +   E       
Sbjct: 97  LTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTRFYNRQYINENDAQNETVGTVLE 156

Query: 144 FRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
           FR     IN+  ++  + +L ++   + S+  +  +L
Sbjct: 157 FRDKFSGINNWFEVLANEKLTNFFQVALSLPEQMSAL 193



 Score = 50.1 bits (118), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 78/181 (43%), Gaps = 3/181 (1%)

Query: 511 INTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYK 570
           I  I S EEL+A+  + +F++ +  ++ Q   +  + ++ +SD  +P S  N   D+R++
Sbjct: 44  IGDISSPEELIADFEVYSFVMRAFDLEDQIFGKGLIRKMLESDPVEPSSLLNRLTDSRFR 103

Query: 571 EIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRT 630
           E+  +  F    E   +       +F  D T   Y  Q I + + + +  +   L F+  
Sbjct: 104 EMHLALGFTT--EAGPQTPDLTDPDFLNDVTTRFYNRQYINENDAQNE-TVGTVLEFRDK 160

Query: 631 IPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDF 690
              I N +E+L + KL       L L    + L   K+  +L     +    D  + E+ 
Sbjct: 161 FSGINNWFEVLANEKLTNFFQVALSLPEQMSALDLDKQKALLADKFDLEKLADPAERENL 220

Query: 691 L 691
           +
Sbjct: 221 I 221


>gi|83944192|ref|ZP_00956648.1| hypothetical protein EE36_02633 [Sulfitobacter sp. EE-36]
 gi|83845059|gb|EAP82940.1| hypothetical protein EE36_02633 [Sulfitobacter sp. EE-36]
          Length = 274

 Score = 54.7 bits (130), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 46/76 (60%)

Query: 32  ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
           E  +R+RI  IS+ +E I D  ++S+ ++AF L D    +  I+K+LESD  +P SL+N+
Sbjct: 37  EEAFRDRIGDISSPEELIADFEVYSFVMRAFDLEDQIFGKGLIRKMLESDPVEPSSLLNR 96

Query: 92  LNSLKYQYFARSYDFS 107
           L   +++    +  F+
Sbjct: 97  LTDSRFREMHLALGFT 112



 Score = 48.5 bits (114), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 75/178 (42%), Gaps = 3/178 (1%)

Query: 511 INTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYK 570
           I  I S EEL+A+  + +F++ +  ++ Q   +  + ++ +SD  +P S  N   D+R++
Sbjct: 44  IGDISSPEELIADFEVYSFVMRAFDLEDQIFGKGLIRKMLESDPVEPSSLLNRLTDSRFR 103

Query: 571 EIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRT 630
           E+  +  F    E   +       +F  D T   Y  Q I + + + +  +   L F+  
Sbjct: 104 EMHLALGFTT--EAGPQTPDLTDPDFLNDVTTRFYNRQYINENDAQNE-TVGTVLEFRDK 160

Query: 631 IPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVE 688
              I N +E+L   KL       L L    + L   K+  +L     +    D  + E
Sbjct: 161 FSGINNWFEVLASEKLTNFFQVALSLPEQMSALDLDKQKALLADKFDLEKLADPAERE 218


>gi|296531762|ref|ZP_06894584.1| possible flagellar protein [Roseomonas cervicalis ATCC 49957]
 gi|296267901|gb|EFH13706.1| possible flagellar protein [Roseomonas cervicalis ATCC 49957]
          Length = 389

 Score = 54.7 bits (130), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 2   IPSHVAPFPSKDIQSKL---FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYA 58
           IP+ VA +  K +Q K    F   +KDP++  +  Y RE +    T  + + D+RL +  
Sbjct: 10  IPTGVAGW--KLLQGKSPTDFKAFAKDPVLQRDLAYLRETLPTKLTAKDLLADRRLQTIV 67

Query: 59  LKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS 107
           LKA+GL      +  I+K+LES+  D  S+  ++   +Y+  +R  ++ 
Sbjct: 68  LKAYGLDGQIGYDALIRKVLESNPDDSNSVAGRMTDYRYRQISRDLNYG 116


>gi|218679039|ref|ZP_03526936.1| hypothetical protein RetlC8_09234 [Rhizobium etli CIAT 894]
          Length = 264

 Score = 54.3 bits (129), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 90/217 (41%), Gaps = 38/217 (17%)

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPKVI---QSDIQHKTIIQDYKQSHQ--------- 131
           DP S+VN     KY+  A  + F+    V    Q+  Q  ++I+ Y  + Q         
Sbjct: 1   DPSSVVNTQGGDKYKALAAQFSFNADGTVTGTAQTAAQKASVIETYTLNSQSVIIDNSVG 60

Query: 132 ----HKEEVALEESK-YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
               +    A E +K Y+   I  I +VD L  D+RL  Y+  ++S+   + +   L+ V
Sbjct: 61  SDVYYVGATAAEYNKAYYTAKIGTITNVDDLVADKRLTSYITTAYSMGADFTAAA-LRTV 119

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
           LT    +P    +    N + A    F F+ DGS S   ++ +  Q  K+ S        
Sbjct: 120 LT----DPGYAQLMGFTNVYNA----FNFKADGSTSSTARVQSVDQANKLKS-------- 163

Query: 247 CVPIVSDQNYYKLAINS--VSSFSDFLKDPKLFKMLQ 281
                S  NYY +   S  +++  D L D  + + ++
Sbjct: 164 --AASSTTNYYSVTSQSSAITNVDDLLADSVMARYIK 198



 Score = 47.4 bits (111), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 70/181 (38%), Gaps = 51/181 (28%)

Query: 422 DPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAEN 481
           DP S  N    D+   L   F+FNADG++                   A +K S+   E 
Sbjct: 1   DPSSVVNTQGGDKYKALAAQFSFNADGTV-------------TGTAQTAAQKASV--IET 45

Query: 482 KSFNSMEQISTQKRINLEINSEV------------DYYTLNINTIHSFEELLANKRILNF 529
            + NS   I     I+  + S+V             YYT  I TI + ++L+A+KR+ ++
Sbjct: 46  YTLNSQSVI-----IDNSVGSDVYYVGATAAEYNKAYYTAKIGTITNVDDLVADKRLTSY 100

Query: 530 LLESKGIDSQKVREDFLCEIFKSDLKDPK-----SFANTYKDNRYKEIISSFNFDIHGEL 584
           +  +  + +     DF     ++ L DP       F N Y          +FNF   G  
Sbjct: 101 ITTAYSMGA-----DFTAAALRTVLTDPGYAQLMGFTNVYN---------AFNFKADGST 146

Query: 585 S 585
           S
Sbjct: 147 S 147


>gi|149203152|ref|ZP_01880123.1| flagellar protein, putative [Roseovarius sp. TM1035]
 gi|149143698|gb|EDM31734.1| flagellar protein, putative [Roseovarius sp. TM1035]
          Length = 267

 Score = 53.1 bits (126), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 15  QSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFI 74
           Q+ LF+   K P +  +  Y+ + I  I+T +  + D+RL   AL AFGL +  ++  FI
Sbjct: 25  QTDLFN---KSPQIVRDTEYFEQNIAKITTAEGLVSDRRLLRVALGAFGLQEDINSRAFI 81

Query: 75  KKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP 110
           + ILE       ++ N+L   +Y+  + ++ F+  P
Sbjct: 82  RAILEEGTIRDDAIANRLADDRYKQLSEAFAFADRP 117



 Score = 46.6 bits (109), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 75/171 (43%), Gaps = 14/171 (8%)

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
           +I  + +Y+  NI  I + E L++++R+L   L + G+        F+  I +       
Sbjct: 34  QIVRDTEYFEQNIAKITTAEGLVSDRRLLRVALGAFGLQEDINSRAFIRAILEEGTIRDD 93

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           + AN   D+RYK++  +F F      + + I + Q +    +  + ++ +  E    +++
Sbjct: 94  AIANRLADDRYKQLSEAFAF------ADRPIPRTQLSTFGTEITEKFRRREFEVAVGDQN 147

Query: 619 PNIALALYFKRTIPNIRNHYE--------ILGDSKLFKVVSKKLKLSPYFA 661
             + LAL  +R + +I    E        ILG+  L +V    L L   F 
Sbjct: 148 QALRLALNVQRELGDIAGDAETEDTRWFRILGNPPLRRVFEVALGLPDSFG 198



 Score = 45.1 bits (105), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 65/153 (42%), Gaps = 20/153 (13%)

Query: 138 LEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY 197
           + +++YF +NI KI + + L  DRRLL   L +F +     S  F++ +L  G       
Sbjct: 36  VRDTEYFEQNIAKITTAEGLVSDRRLLRVALGAFGLQEDINSRAFIRAILEEGTIRDDAI 95

Query: 198 FIESRDNRFRAMAENFRFQ----PDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD 253
                D+R++ ++E F F     P   LS     +T    EK     F         V D
Sbjct: 96  ANRLADDRYKQLSEAFAFADRPIPRTQLSTFGTEIT----EKFRRREFEVA------VGD 145

Query: 254 QN-YYKLAINSVSSFSDF-----LKDPKLFKML 280
           QN   +LA+N      D       +D + F++L
Sbjct: 146 QNQALRLALNVQRELGDIAGDAETEDTRWFRIL 178


>gi|254509607|ref|ZP_05121674.1| flagellar protein, putative [Rhodobacteraceae bacterium KLH11]
 gi|221533318|gb|EEE36306.1| flagellar protein, putative [Rhodobacteraceae bacterium KLH11]
          Length = 265

 Score = 52.0 bits (123), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 88/200 (44%), Gaps = 21/200 (10%)

Query: 503 EVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFAN 562
           E DY+  NI  + S E+L++++R+L   L + G+++      F+ +I     +   + AN
Sbjct: 38  ETDYFLENIGKVQSAEDLVSDRRLLQVALGAFGLEADLDNRFFIQKILSDGTQAEDALAN 97

Query: 563 TYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIA 622
              D RY++  ++F     G++    +    +    D+    +     E    E D ++ 
Sbjct: 98  RLADGRYRDFANAFGLG-PGDVRKTGLTNEMEKIASDNLVARF-----EISVGEADESMR 151

Query: 623 LALYFKRTIPNI--------RNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKK 674
           +AL+ +  +  I        R  ++++G   L  ++   L L   FA L   K++ + + 
Sbjct: 152 IALFTQHALQEIAAQDGSENRKWFDLMGLPPLRSMMETALGLPSAFAQLDIDKQLEVFRD 211

Query: 675 HIK-------INDFKDSKKV 687
            ++       ++ F DS+ +
Sbjct: 212 RLQRVTGSSDLSQFTDSEAI 231



 Score = 49.7 bits (117), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 39/78 (50%)

Query: 31  EERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
           E  Y+ E I  + + ++ + D+RL   AL AFGL        FI+KIL        +L N
Sbjct: 38  ETDYFLENIGKVQSAEDLVSDRRLLQVALGAFGLEADLDNRFFIQKILSDGTQAEDALAN 97

Query: 91  QLNSLKYQYFARSYDFSP 108
           +L   +Y+ FA ++   P
Sbjct: 98  RLADGRYRDFANAFGLGP 115



 Score = 45.1 bits (105), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 54/117 (46%), Gaps = 9/117 (7%)

Query: 123 IQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
           +Q Y  S+ ++ E     + YF +NI K+ S + L  DRRLL   L +F +     +  F
Sbjct: 26  LQSYSASNVNQRE-----TDYFLENIGKVQSAEDLVSDRRLLQVALGAFGLEADLDNRFF 80

Query: 183 LKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
           ++ +L+ G            D R+R  A  F   P      R   LT+ ++EKI S+
Sbjct: 81  IQKILSDGTQAEDALANRLADGRYRDFANAFGLGPG---DVRKTGLTN-EMEKIASD 133


>gi|218662936|ref|ZP_03518866.1| CTP synthetase [Rhizobium etli IE4771]
          Length = 391

 Score = 50.8 bits (120), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 40/73 (54%)

Query: 625 LYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDS 684
           LYF+R  P I + Y+ILGDS LF+  +    LS Y + +   K+  +++  I I D  D 
Sbjct: 282 LYFERKAPEISSAYDILGDSALFEFFTTSFNLSSYVSNMDVEKQAEMVENFIDIKDLSDP 341

Query: 685 KKVEDFLYAAKAM 697
            KV+D +    AM
Sbjct: 342 DKVDDLIKRFTAM 354


>gi|89069825|ref|ZP_01157160.1| flagellar protein, putative [Oceanicola granulosus HTCC2516]
 gi|89044626|gb|EAR50742.1| flagellar protein, putative [Oceanicola granulosus HTCC2516]
          Length = 264

 Score = 48.9 bits (115), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
           F ++ ++ +  +  +  PI    E + RE++  I++ID+ + D++     L AFGL D  
Sbjct: 17  FLARTLEVQQAAYAASAPIERATESF-REKVPQITSIDDLLDDRQAMQVVLGAFGLDDDI 75

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS 107
            +  F++K+LE     P S   +L+  +Y   A +  F 
Sbjct: 76  DSAAFVRKVLEEGTVAPDSFAIRLSDKRYLQLADALGFG 114



 Score = 46.6 bits (109), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 65/156 (41%), Gaps = 13/156 (8%)

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEII 573
           I S ++LL +++ +  +L + G+D       F+ ++ +     P SFA    D RY ++ 
Sbjct: 49  ITSIDDLLDDRQAMQVVLGAFGLDDDIDSAAFVRKVLEEGTVAPDSFAIRLSDKRYLQLA 108

Query: 574 SSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPN 633
            +  F   G+L     GK Q     D     Y+ +  E+   E+D  + +AL   R +  
Sbjct: 109 DALGF---GDLGGA--GKTQWLGFADVIVARYEARQFERAVGEQDEQLRIALSVSRGVEE 163

Query: 634 I--------RNHYEILGDSKLFKVVSKKLKLSPYFA 661
           +           + I+G++ L  V    L  S  F 
Sbjct: 164 VLQGQDGRTARWFAIMGNAPLRSVFETALGFSSSFG 199



 Score = 45.4 bits (106), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%)

Query: 141 SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
           ++ FR+ + +I S+D L  DR+ +  VL +F +     S  F++ VL  G   P  + I 
Sbjct: 39  TESFREKVPQITSIDDLLDDRQAMQVVLGAFGLDDDIDSAAFVRKVLEEGTVAPDSFAIR 98

Query: 201 SRDNRFRAMAENFRFQPDGSLSK 223
             D R+  +A+   F   G   K
Sbjct: 99  LSDKRYLQLADALGFGDLGGAGK 121


>gi|58038542|ref|YP_190506.1| hypothetical protein GOX0053 [Gluconobacter oxydans 621H]
 gi|58000956|gb|AAW59850.1| Hypothetical protein GOX0053 [Gluconobacter oxydans 621H]
          Length = 273

 Score = 47.4 bits (111), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 77/173 (44%), Gaps = 14/173 (8%)

Query: 118 QHKTIIQDYKQSHQHKEEVALEESKY---FRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           Q+ +II+D   S    E+ ++   +    F+K+   I + +QL K+ + L  VL ++ ++
Sbjct: 13  QYVSIIKDEDSSANKWEKTSVSAQQAVTAFQKDAASIKTPEQLLKNYKALTVVLGAYGMS 72

Query: 175 PKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIE 234
                   LKD++T    + K     S ++ ++A A  F       L+  D       ++
Sbjct: 73  SVIGQTAVLKDLMTQDPTSSKSLAQTSGNSAWKAFANAFSDWSTSPLASSDT------VQ 126

Query: 235 KIVSNYFNNTID-----CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQL 282
            I  +Y  N+ +       P + D  Y+     +  + ++ + DPKL K+ ++
Sbjct: 127 SITQSYLTNSYEDSLQTETPGLGDALYFTRTATTDMTLANVMADPKLLKVAEV 179



 Score = 40.4 bits (93), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 61/134 (45%), Gaps = 5/134 (3%)

Query: 35  YRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNS 94
           +++    I T ++ +K+ +  +  L A+G+S +      +K ++  D +  KSL     +
Sbjct: 42  FQKDAASIKTPEQLLKNYKALTVVLGAYGMSSVIGQTAVLKDLMTQDPTSSKSLAQTSGN 101

Query: 95  LKYQYFARSY-DFSPPPKVIQSDIQHKT---IIQDYKQSHQHKEEVALEESKYFRKNIHK 150
             ++ FA ++ D+S  P      +Q  T   +   Y+ S Q  E   L ++ YF +    
Sbjct: 102 SAWKAFANAFSDWSTSPLASSDTVQSITQSYLTNSYEDSLQ-TETPGLGDALYFTRTATT 160

Query: 151 INSVDQLFKDRRLL 164
             ++  +  D +LL
Sbjct: 161 DMTLANVMADPKLL 174


>gi|218512422|ref|ZP_03509262.1| hypothetical protein Retl8_01379 [Rhizobium etli 8C-3]
          Length = 249

 Score = 44.3 bits (103), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 61/141 (43%), Gaps = 11/141 (7%)

Query: 317 NFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ---------LPLG 365
           NF  D S  + + +Q   Q Q   D Y        D+ ++ +  +Y          L   
Sbjct: 77  NFAADGSLPAVSSVQTADQAQTTNDNYMARYDDERDEAIEEVADNYSSMMADSTSLLDTA 136

Query: 366 KIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDS 425
           +IK++++ L      +   S ++       AL A+ L  Q++ R  +R +LTS+  DP+ 
Sbjct: 137 EIKTVNDFLRTNAAADFKKSNDKLPDPYHVALQAFGLTDQEVPRSMMRKILTSDAYDPNG 196

Query: 426 YANKSKDDRLIKLNHAFNFNA 446
           Y    KD+R+  L  AF   A
Sbjct: 197 YIASLKDERITNLARAFQLRA 217



 Score = 41.6 bits (96), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 100/228 (43%), Gaps = 35/228 (15%)

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
           DY   +  I ++D L++            +P IT  F    YNL   D+   +L+++LT 
Sbjct: 15  DYSSRMATIANVDELIA------------DPAIT-NFLKSTYNLPF-DISDAELKSILT- 59

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR---LTIRDN--VKHYANRK 473
              D  + A     D    LN  FNF ADGS+  +  +Q+     T  DN   ++   R 
Sbjct: 60  ---DATAAAAAGHAD----LNADFNFAADGSLPAVSSVQTADQAQTTNDNYMARYDDERD 112

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI---LNFL 530
            +I +  + +++SM   ST      EI +  D+  L  N    F++  +N ++    +  
Sbjct: 113 EAIEEVAD-NYSSMMADSTSLLDTAEIKTVNDF--LRTNAAADFKK--SNDKLPDPYHVA 167

Query: 531 LESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNF 578
           L++ G+  Q+V    + +I  SD  DP  +  + KD R   +  +F  
Sbjct: 168 LQAFGLTDQEVPRSMMRKILTSDAYDPNGYIASLKDERITNLARAFQL 215



 Score = 38.5 bits (88), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%)

Query: 55  FSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP 109
           +  AL+AFGL+D       ++KIL SD  DP   +  L   +    AR++    P
Sbjct: 164 YHVALQAFGLTDQEVPRSMMRKILTSDAYDPNGYIASLKDERITNLARAFQLRAP 218


>gi|114800299|ref|YP_758998.1| putative flagellar protein [Hyphomonas neptunium ATCC 15444]
 gi|114740473|gb|ABI78598.1| putative flagellar protein [Hyphomonas neptunium ATCC 15444]
          Length = 282

 Score = 43.5 bits (101), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 17  KLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKK 76
           K   + +  P V  +  Y  E+     ++++F+KD RL    + AF L+     + FIKK
Sbjct: 24  KQLESYTNSPQVRNDRDYMIEKFAQPISVEDFLKDSRLVRVTMTAFDLAGEEWKKGFIKK 83

Query: 77  ILESDLSDPKS-LVNQLNSLKYQYFARS 103
            LE ++SDP+S  + +LN+ KY   A +
Sbjct: 84  TLE-EVSDPESTFLARLNNPKYTALANA 110


>gi|162147451|ref|YP_001601912.1| hypothetical protein GDI_1667 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545560|ref|YP_002277789.1| hypothetical protein Gdia_3449 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786028|emb|CAP55610.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533237|gb|ACI53174.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 281

 Score = 42.4 bits (98), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 37/197 (18%), Positives = 82/197 (41%), Gaps = 5/197 (2%)

Query: 497 NLEINSEVDYYTLNINTIHSFEELLANKRIL--NFLLESKGIDSQKVREDFLCEIFKSDL 554
           N  I +EV  +  + ++I S  +L++NK       +L +  + S       + ++   D 
Sbjct: 32  NPTIQNEVTSFEESASSITSAADLMSNKNYTAEQVVLGAYNLSSISGETALVKDLLTQDP 91

Query: 555 KDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKE 614
              KS A +  +  +     +F+    G+           +  I      ++    E   
Sbjct: 92  TSSKSVAKSSGNATWLAFADAFS--TWGQNGGSASASPFTSDTISSIVTKFEESQYESST 149

Query: 615 EEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP-YFAVLPERKKIRILK 673
             ++  +  ALYF R + +  +  +I+ ++ L KVV      +P  F  L   +++R+L+
Sbjct: 150 ANQNSGVGNALYFTRNMTSSMSLADIMSNATLLKVVETVSGFNPDQFGALDYPEQVRLLQ 209

Query: 674 KHIKINDFKDSKKVEDF 690
             + ++DF   + V+ +
Sbjct: 210 NKVDLSDFSTPEGVQKY 226


>gi|218677561|ref|ZP_03525458.1| hypothetical protein RetlC8_01365 [Rhizobium etli CIAT 894]
          Length = 251

 Score = 40.0 bits (92), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 94/240 (39%), Gaps = 39/240 (16%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           YY+  I  IS +D+ + D RL ++   AFG+               +D++    L +Q  
Sbjct: 41  YYQATIAGISNVDQLLTDSRLNNFVRNAFGIPST-----------VTDVNLRAILTDQSG 89

Query: 94  SLKYQYFARSYDFSPPPKVIQS-DIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKIN 152
           +  Y   A +++F     +      Q  T I+D K +   + +        +   +  I 
Sbjct: 90  TGTYADVAAAFNFKADGTLKDGMAAQTATQIRDTKFAASTRTD-------DYSARMSTIG 142

Query: 153 SVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAEN 212
           +VD L  D  + +++  ++++ P  IS   LK +LT   A       +        +  +
Sbjct: 143 NVDDLLADDAITNFLKSTYNL-PTGISNADLKSILTDATAAAAAGHAD--------LNAD 193

Query: 213 FRFQPDGSLSKRDKILTDMQIEKIVSNYF-------NNTIDCVPIVSDQNYYKLAINSVS 265
           F F  DGSL     + T  Q +    NY        +  ID V      NY K+  +S S
Sbjct: 194 FNFAADGSLPVVSSVQTADQAQTTNDNYMARYDDERDEAIDEVA----SNYSKMMADSSS 249


>gi|328469147|gb|EGF40093.1| hypothetical protein VP10329_09681 [Vibrio parahaemolyticus 10329]
          Length = 559

 Score = 39.7 bits (91), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 48/111 (43%), Gaps = 3/111 (2%)

Query: 311 KYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSI 370
           K F +     D SS T    D  IQ M  L   +   +  D + S + D+   +G   ++
Sbjct: 236 KPFAESAAQSDVSSQTTTLFDEAIQNMGQLQVVDVSEISPDTLFSEVTDHATNIGTEDTV 295

Query: 371 DNLLSG--KCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           DNLL     C L+    A+   +TL+  L AY   + D   D L  V+T N
Sbjct: 296 DNLLGALESCHLQS-GQAKLVKVTLEGGLQAYLGGISDDTADALPPVVTEN 345


>gi|260899848|ref|ZP_05908243.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
 gi|308107291|gb|EFO44831.1| conserved hypothetical protein [Vibrio parahaemolyticus AQ4037]
          Length = 1976

 Score = 39.3 bits (90), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 49/113 (43%), Gaps = 7/113 (6%)

Query: 311 KYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSI 370
           K F +     D SS T    D  IQ M  L   +   +  D + S + D+   +G   ++
Sbjct: 236 KPFAESAAQSDASSQTTTLFDEAIQNMGQLQVVDVSEISPDTLFSEVTDHATNIGTEDTV 295

Query: 371 DNLLSG--KCQLEGPNSAEEPII--TLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           DNLL     C L+   S +  ++  TL+  L AY   + D   D L  V+T N
Sbjct: 296 DNLLGALESCHLQ---SGQAKLVKVTLEGGLQAYLGGISDDTADALPPVVTEN 345


>gi|182419225|ref|ZP_02950478.1| transcriptional regulator [Clostridium butyricum 5521]
 gi|237668888|ref|ZP_04528872.1| alanine racemase [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182376865|gb|EDT74436.1| transcriptional regulator [Clostridium butyricum 5521]
 gi|237657236|gb|EEP54792.1| alanine racemase [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 337

 Score = 37.7 bits (86), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 4/108 (3%)

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDG---SLSKRDKILTDMQIEKIVSNYFNNTIDCVP 249
           N   Y  E   NR  A+ +   + P     SLSKR+     + +  I ++YF   I  + 
Sbjct: 24  NGSGYVKEETKNRIEAVIKELNYTPSAIARSLSKRETNAIGVIVPDITNSYFGEVIKGIS 83

Query: 250 IVSDQNYYKLAI-NSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
            V+D+N   +   N+ +SF   ++   L K  ++    + P   AD F
Sbjct: 84  QVADKNNLNIIFYNTENSFEKEIRALNLLKEQRIKGIIMTPGFGADDF 131


>gi|170034350|ref|XP_001845037.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167875670|gb|EDS39053.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 1093

 Score = 37.4 bits (85), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 58/134 (43%), Gaps = 21/134 (15%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + +H    P+ +  + +  T+  D +    E+   E I H +     + +K LFSYA   
Sbjct: 76  VANHHQDVPTAEANTTMLGTMEADAVEDLYEKVLME-IVHGNINRSDVSEKALFSYAQDV 134

Query: 62  FGLSDMSHAEKFIKK--------------ILESDLSDPKSLVNQLNSLKYQYFARSYDFS 107
           F +++ +H E+ +KK              ++E+ L++  ++   LN+    Y        
Sbjct: 135 FNMNEKAH-EEILKKARVKPASEVHLRVELVEAKLTERATVTGALNAFVIMYLQTGL--- 190

Query: 108 PPPKVIQSDIQHKT 121
             P V++S IQ  T
Sbjct: 191 --PDVVRSTIQENT 202


>gi|123965518|ref|YP_001010599.1| peptidyl-tRNA hydrolase [Prochlorococcus marinus str. MIT 9515]
 gi|166229435|sp|A2BUN1|PTH_PROM5 RecName: Full=Peptidyl-tRNA hydrolase; Short=PTH
 gi|123199884|gb|ABM71492.1| Peptidyl-tRNA hydrolase [Prochlorococcus marinus str. MIT 9515]
          Length = 199

 Score = 37.4 bits (85), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 11/89 (12%)

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKI---LTDMQIEKIV---- 237
           +V  +GL NP K +I+SR N    + E F  + D   + ++K+    T+ +I   +    
Sbjct: 5   EVFIIGLGNPGKQYIKSRHNIGFLLLETFSKKYDAQFTLKNKLKSRYTEFKINDSIYKLF 64

Query: 238 --SNYFNNTIDCVPIVSDQNYYKLAINSV 264
               Y NN+ D V  + D  +YK++++ V
Sbjct: 65  MPHTYMNNSGDAVKAIVD--WYKISLDKV 91


Searching..................................................done


Results from round 2




>gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040686|gb|ACT57482.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 750

 Score =  858 bits (2216), Expect = 0.0,   Method: Composition-based stats.
 Identities = 750/750 (100%), Positives = 750/750 (100%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK
Sbjct: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK
Sbjct: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
           TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL
Sbjct: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
           PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY
Sbjct: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240

Query: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM 300
           FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM
Sbjct: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM 300

Query: 301 QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY 360
           QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY
Sbjct: 301 QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY 360

Query: 361 QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP 420
           QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP
Sbjct: 361 QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP 420

Query: 421 SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE 480
           SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE
Sbjct: 421 SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE 480

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
           NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK
Sbjct: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
           VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD
Sbjct: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660
           TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF
Sbjct: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660

Query: 661 AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN 720
           AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN
Sbjct: 661 AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN 720

Query: 721 NSFDDPQNNVSLQLSPQKKSNGRFSILNLF 750
           NSFDDPQNNVSLQLSPQKKSNGRFSILNLF
Sbjct: 721 NSFDDPQNNVSLQLSPQKKSNGRFSILNLF 750


>gi|315122487|ref|YP_004062976.1| hypothetical protein CKC_03695 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495889|gb|ADR52488.1| hypothetical protein CKC_03695 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 757

 Score =  664 bits (1713), Expect = 0.0,   Method: Composition-based stats.
 Identities = 423/758 (55%), Positives = 547/758 (72%), Gaps = 20/758 (2%)

Query: 1   MIPSHVAP--FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYA 58
           MI +        S  +  K  +T+SKDPIVS EE+YYRE+IK IST++EFI DKRL +Y 
Sbjct: 11  MISTASISNLILSDKVYKKSIATISKDPIVSREEKYYREKIKKISTVEEFINDKRLLNYV 70

Query: 59  LKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQ 118
           LKAF LSDMSHA+ F++KIL SDLS P+SLVN++NS KYQ FA  +DFSP PK IQ+ IQ
Sbjct: 71  LKAFDLSDMSHAKTFLQKILTSDLSVPESLVNKMNSKKYQTFASQFDFSPAPKSIQTTIQ 130

Query: 119 HKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYI 178
            K +I+DY  S++ KE+ ALEESKYFR+NI+ I SVDQL K+RRL++Y LQSF I P+YI
Sbjct: 131 QKKVIEDYITSYKRKEKDALEESKYFRQNINNITSVDQLIKNRRLVNYALQSFGINPQYI 190

Query: 179 SLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVS 238
           SL FLK+ LT  L + K+     ++N   A+A+NFRFQ +GS   +DKILT+MQIE +V 
Sbjct: 191 SLSFLKESLTSELDHTKQ--KTPKENLLHALADNFRFQSNGSPIHKDKILTNMQIENMVH 248

Query: 239 NYFNNTIDCVP---IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADK 295
           NYF++TI  VP   I SDQ YY+ +INS+ SF   LKDPKL+K+LQ+SL  L+P++T + 
Sbjct: 249 NYFSHTIMSVPEEVIFSDQKYYRSSINSIPSFEQLLKDPKLYKILQISL-SLDPKVTENN 307

Query: 296 FLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS 355
           FL L++ NDP + QVK FFQI++  D +S   IQ   QI K+L LY+ NC+ L   K++S
Sbjct: 308 FLKLIKNNDPSIVQVKKFFQIDYAGDINSRPAIQTKKQIDKLLFLYQTNCKKLRSQKIES 367

Query: 356 LIKDYQLPL-GKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRN 414
           LI++Y+  + G IKS+D  L+ K +    ++  +PI  L+FAL AY +   DL++ +LR+
Sbjct: 368 LIENYKKDISGDIKSVDQFLNMKPKSYISSNKSQPITPLEFALQAYGIKKNDLNKYRLRD 427

Query: 415 VLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKR 474
           +L S+ SD  SY N+ KD+R I L+HAFNFN  G IG   + QS+LT+RDNV +Y   K+
Sbjct: 428 ILISDSSDSKSYVNQLKDNRFINLHHAFNFNKKGEIGFNRLTQSKLTLRDNVMNYIGYKK 487

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S++  ENK F+S + I    RI  + + EV+YYT NI TIHSF +LLANKRILNFLLESK
Sbjct: 488 SLY-NENKIFSSAQNI----RIKKDTDKEVEYYTSNIQTIHSFNDLLANKRILNFLLESK 542

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
            ID +KV+  FL +IFKSDL + KS ANTYKD+RYKEI+ SFNFDIHG  S++  GKVQD
Sbjct: 543 EIDPKKVKNSFLEKIFKSDLNNTKSLANTYKDSRYKEIMLSFNFDIHGTKSNENTGKVQD 602

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
           NFHID   DLYK+Q+++KKEEEKDP++AL LYFKRTIP I+N Y+ILGD  LF+V+SKKL
Sbjct: 603 NFHIDHVVDLYKNQILQKKEEEKDPDVALLLYFKRTIPTIKNIYDILGDKNLFQVISKKL 662

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSS--P 712
           +LSP+F  LPE  KI ILKK I I DFKD KK+E+FLYA     +QS  +K AL  +  P
Sbjct: 663 RLSPHFPSLPESTKIHILKKLINIKDFKDPKKLENFLYAVNVNHYQSTTHKIALTLAFFP 722

Query: 713 NQNKDPWNNSFDDPQNNVSLQLSPQKKSNGRFSILNLF 750
              KD    S DD + N+SLQLSP KK NG+FSILNLF
Sbjct: 723 PLEKD----SMDDHEKNISLQLSPNKKENGKFSILNLF 756



 Score =  198 bits (503), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 113/588 (19%), Positives = 229/588 (38%), Gaps = 89/588 (15%)

Query: 99  YFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             A  + +S       S++     +     +   K+ +   E KY+R+ I KI++V++  
Sbjct: 2   SLANVWSYSMISTASISNLILSDKVYKKSIATISKDPIVSREEKYYREKIKKISTVEEFI 61

Query: 159 KDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPD 218
            D+RLL+YVL++F ++    +  FL+ +LT  L+ P+    +    +++  A  F F P 
Sbjct: 62  NDKRLLNYVLKAFDLSDMSHAKTFLQKILTSDLSVPESLVNKMNSKKYQTFASQFDFSP- 120

Query: 219 GSLSKRDKILTDMQIEKIVSNYFNN-TIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLF 277
                   I T +Q +K++ +Y  +        + +  Y++  IN+++S    +K+ +L 
Sbjct: 121 ----APKSIQTTIQQKKVIEDYITSYKRKEKDALEESKYFRQNINNITSVDQLIKNRRLV 176

Query: 278 KMLQLSLFPLNPEITADKFLTLMQENDPIVSQVK---------YFFQINFHRDNSS--ST 326
               L  F +NP+  +  FL     ++   ++ K               F  + S     
Sbjct: 177 NY-ALQSFGINPQYISLSFLKESLTSELDHTKQKTPKENLLHALADNFRFQSNGSPIHKD 235

Query: 327 KIQQDSQIQKMLDLYKKNCQILHDDKM-QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNS 385
           KI  + QI+ M+  Y  +  +   +++  S  K Y+  +  I S + LL           
Sbjct: 236 KILTNMQIENMVHNYFSHTIMSVPEEVIFSDQKYYRSSINSIPSFEQLLKDPK------- 288

Query: 386 AEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFN 445
                   +    + +L+ +  + + L+ +             K+ D  ++++   F  +
Sbjct: 289 ------LYKILQISLSLDPKVTENNFLKLI-------------KNNDPSIVQVKKFFQID 329

Query: 446 ADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVD 505
             G I   P +Q++  I   +  Y    + +                    + +I S ++
Sbjct: 330 YAGDINSRPAIQTKKQIDKLLFLYQTNCKKL-------------------RSQKIESLIE 370

Query: 506 YYTLNI-NTIHSFEELLANK-------------RILNFLLESKGIDSQKVREDFLCEIFK 551
            Y  +I   I S ++ L  K               L F L++ GI    + +  L +I  
Sbjct: 371 NYKKDISGDIKSVDQFLNMKPKSYISSNKSQPITPLEFALQAYGIKKNDLNKYRLRDILI 430

Query: 552 SDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD-------L 604
           SD  D KS+ N  KDNR+  +  +FNF+  GE+   ++ +       D+  +       L
Sbjct: 431 SDSSDSKSYVNQLKDNRFINLHHAFNFNKKGEIGFNRLTQS-KLTLRDNVMNYIGYKKSL 489

Query: 605 YKHQMIEKKEEE---KDPNIALALYFKRTIPNIRNHYEILGDSKLFKV 649
           Y    I    +    K        Y+   I  I +  ++L + ++   
Sbjct: 490 YNENKIFSSAQNIRIKKDTDKEVEYYTSNIQTIHSFNDLLANKRILNF 537


>gi|15889789|ref|NP_355470.1| hypothetical protein Atu2524 [Agrobacterium tumefaciens str. C58]
 gi|15157715|gb|AAK88255.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 774

 Score =  567 bits (1462), Expect = e-159,   Method: Composition-based stats.
 Identities = 219/773 (28%), Positives = 366/773 (47%), Gaps = 87/773 (11%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+P++                V+ DPI+S + +YY + I  + ++D F+KD +L+SYA+K
Sbjct: 1   MLPAYTTYALYNRNMESSLKRVANDPIISRDAKYYADNIGKVKSLDAFLKDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP--PPKVIQSDIQ 118
           A GL +M++A  F+KK+LES+L DP S VN+L   +Y+ FA ++DF      K +Q+  Q
Sbjct: 61  AHGLEEMTYATAFMKKVLESNLKDPNSFVNKLKDTRYRDFAAAFDFGTIKTEKTVQTKSQ 120

Query: 119 HKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYI 178
              ++  Y  + + + E   EE++Y+   I K+  VD +FK+ RL +YV +SF I P+  
Sbjct: 121 QDRLVTAYHDTDKQRNEEQKEETRYYNIVIDKVGQVDDIFKNTRLRNYVFKSFGIDPQTF 180

Query: 179 SLPFLKDVLTLGLANPKKYFIES------------------------------------- 201
               LK VLT  ++    Y   +                                     
Sbjct: 181 DYQHLKGVLTSDISKADSYVNSTYKPLLEEWQAKIADLRDQRTKIPSTDKTSLEKNDYLI 240

Query: 202 --------RDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPIV 251
                      +   +A  F F+ DG ++   K  T +Q      NY   N  +     +
Sbjct: 241 NQYNKRINGAAKLFELAATFNFRADGLVNDGTKAQTAVQKRLTNENYVLANPRVTQTGAI 300

Query: 252 SDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEN--DPIVSQ 309
            +++++  A+  V+       + +L  ML ++    +   T  K    ++EN  DP    
Sbjct: 301 LNRDFFVQAMKDVTDAGQLTANSRLRTMLIVAFNLEDNSGTDQKIQWALRENPADPQSGL 360

Query: 310 --------VKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKD 359
                   +      NF  D   ++   +Q D Q+  +++LY        +   +  IKD
Sbjct: 361 YREKDKGFIDLAKAFNFGTDGKVAAGKAVQSDGQLSTIMNLYFSRYDDKQEAADEKTIKD 420

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +G  K++D+ LS         +A   +    FAL A+N+  ++    +L+ V TS+
Sbjct: 421 YRRYIGLTKNLDDFLS---------AAPAAVAIRNFALKAFNIGTEESSTFKLKKVFTSD 471

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            S+P SY    KDDR ++L  AFNF+A G IG     Q+   I    ++Y          
Sbjct: 472 LSNPKSYVYTLKDDRFLRLAKAFNFDAQGKIGSPRFAQAENEIARISRNY---------- 521

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
                  + +    K+I  +   EV YY   + T+ + ++LLA++R+L+F+L ++ ID +
Sbjct: 522 ----LKEVTRWDKDKKIREKGEKEVGYYREKMGTLETADQLLADRRLLDFMLVAERIDPK 577

Query: 540 KVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHID 599
            +  D+L +IFKSDLKDPKSFANT KD R++ +  SFNFD  G +S      +Q+N  + 
Sbjct: 578 SITTDYLKKIFKSDLKDPKSFANTEKDPRFRALAGSFNFDAKGNISATTRQPIQNNRSLM 637

Query: 600 DTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPY 659
           +T D Y  Q +E++  E++  + LALYFKR    I + Y+IL D  L +V    L +   
Sbjct: 638 ETRDKYVRQKLEERAGEENSGVRLALYFKRMAGGISSAYDILADKALSEVTRTALGIPAE 697

Query: 660 FAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM---DHQSIDYKKALF 709
            A      + ++++K +KI D +D KKVE  +         ++   D + ALF
Sbjct: 698 TANAKVDAQAKMIEKRLKIKDLQDPKKVEKLVNRFLMTFEANNSGSDPRIALF 750


>gi|325293876|ref|YP_004279740.1| hypothetical protein AGROH133_08567 [Agrobacterium sp. H13-3]
 gi|325061729|gb|ADY65420.1| hypothetical protein AGROH133_08567 [Agrobacterium sp. H13-3]
          Length = 775

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 224/776 (28%), Positives = 373/776 (48%), Gaps = 89/776 (11%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           ++P++      ++D++  L   V+ DP+VS + +YY + I  +  +D F+KD RL+SYA+
Sbjct: 2   VLPAYTTYALYNRDMELSL-KRVANDPVVSRDAKYYADNIGTVKNLDAFLKDFRLYSYAM 60

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP--PPKVIQSDI 117
           KA GL +M +A  F+KK+LES+L+DP S  N+L   +Y+ FA S+DF      K +Q+  
Sbjct: 61  KAHGLEEMIYATAFMKKVLESNLNDPNSFANKLKDTRYRDFAASFDFGTIKAEKSVQTKS 120

Query: 118 QHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           Q   +I  Y  + + +     EE++++   I K+  VD +FK+ R+ DY+ +SF I P+ 
Sbjct: 121 QQDRLIATYHATIEQEGAELKEETRFYNIAIEKVGHVDDIFKNTRVRDYIFKSFGIDPET 180

Query: 178 ISLPFLKDVLTLGLANPKKYFIES------------------------------------ 201
            S   +K+VLT  ++N   Y  ++                                    
Sbjct: 181 FSYKHVKNVLTSDISNADSYINKTYKSLIPEWKAKAADLRIERAGVASTDKPALAKIDYL 240

Query: 202 ---------RDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPI 250
                      N+   MA  F F+ DG +       T  Q   I   Y   N  +     
Sbjct: 241 ISQYNKRINDANKLFEMAAAFNFRDDGRVDDGMPAQTAAQRRLINETYVLSNPRLTQAGA 300

Query: 251 VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE--NDP--- 305
           V ++ Y+   + +++  S   +  +L  ML +S    + + T  K    + +  NDP   
Sbjct: 301 VLNREYFVDKMKTITEASQMTQFARLRTMLIVSFNLTDNDETDKKIGWAVLQDPNDPQSP 360

Query: 306 -----IVSQVKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK 358
                    V      NF  D    +    Q   Q+  M++LY        +   +  IK
Sbjct: 361 IHKEKDKGLVDLARAFNFGADGKIKTGKVAQTAEQLNTMMNLYFSRYDDKDEAADEKAIK 420

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
           +YQ  +G  K++++ LS         +A+  +I   FAL A+++  ++     L+ V TS
Sbjct: 421 NYQRYIGLTKNLEDFLS---------NAQGAVIIRNFALKAFDITAEEASSFTLKRVFTS 471

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
           + SDP SY    KD+R ++L  AFNF+A+G IG   + QS   I    ++Y         
Sbjct: 472 DLSDPKSYVYTLKDERFVRLAKAFNFDAEGKIGSPRLAQSENEITRISRNY--------- 522

Query: 479 AENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDS 538
                   + +    K++  +   EV YY   + TI + ++LL+++R+L+F+L ++ ID 
Sbjct: 523 -----LKEVTRWDKDKKVREKGEKEVAYYRQKMETIETVDQLLSDRRLLDFMLIAQRIDP 577

Query: 539 QKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHI 598
           + V  D+L +IFKSDLKDPKSFANT KD R++ +  SFNFD  G +  K    VQ+   +
Sbjct: 578 KTVTTDYLKKIFKSDLKDPKSFANTEKDARFRALAGSFNFDAKGNIVAKAGQSVQNTRSL 637

Query: 599 DDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
            +T D Y  Q +E++  E++  + LALYFKR   +I N Y+IL D+ L +     L +  
Sbjct: 638 METRDKYVRQTLEQRVGEENSGVRLALYFKRMAASISNPYDILADNALAEFTRTALGIPA 697

Query: 659 YFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM---DHQSIDYKKALFSS 711
             A      + ++++K +KI D +D KKVE  +         ++ + D + ALF S
Sbjct: 698 ETANSKVDAQAKMIEKKLKIKDLQDPKKVEKLVNRFLLTFEANNATSDPRLALFGS 753


>gi|327192290|gb|EGE59255.1| hypothetical protein RHECNPAF_2330071 [Rhizobium etli CNPAF512]
          Length = 773

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 207/735 (28%), Positives = 358/735 (48%), Gaps = 31/735 (4%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           ++ ++V+        S   S V+    V+ +  YY++ I  ++T+DEF+ D +L+SYA+K
Sbjct: 47  LVSTYVSYLAVARNLSTSLSNVASQATVARDSAYYKDNIGKVTTVDEFMGDYKLYSYAMK 106

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ FS   K  QSD+Q  
Sbjct: 107 AYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGETKTAQSDVQRD 166

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            ++  Y+ S + + +   +E+ YF +NI  I SVD      RL  YVL +F ++ +Y S 
Sbjct: 167 NLLDAYEASFETEADTIEDETDYFEENIASITSVDDFLSSSRLKSYVLTAFGLSTEYTSS 226

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLKDVLT  L +   +  +  D+ + ++A+ F F  DGS+     ++++ QI  + S Y
Sbjct: 227 SFLKDVLTSDLDDADSFVNQLDDDVYVSLAKAFNFNEDGSVD--GDLMSEDQISLVTSAY 284

Query: 241 FNNTIDCVPIVSDQN---YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
              +       + +    Y+   I +++S    + D KL   L+ +    + E  +D F+
Sbjct: 285 AVASATIASTQTGEAYDSYFAAEIGNITSVDQLMSDDKLVSYLRTAYGLTDDE--SDTFI 342

Query: 298 TLMQENDPIVSQVK---YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HDD 351
           +   ++  I   +         NF  D   +     Q   Q       + +N Q+L  + 
Sbjct: 343 SAALKSADIAEAIGLSDLHDAFNFDEDGALADGDSAQTSDQTAATTAAFDENYQVLIANT 402

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
             +  + +Y   +  + SID+ L      +  ++ + P    + AL A+ ++   + + Q
Sbjct: 403 DTEVAVDNYTTRIASVTSIDDFLVSNADDDDDDNDDLPE-MWEMALRAFGIDPDSVSKSQ 461

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
           +R +L S+P+D  SY N   DDR +    AFNF++DG +       S   + D   +Y  
Sbjct: 462 VRKILESDPTDSKSYVNSLNDDRFVAFRKAFNFDSDGDVTVPLQAMSESVVDDYAAYYKQ 521

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
            K    D +  +                 + E+ Y+   + TI +  E LA+ R+++F+L
Sbjct: 522 NKIRYLDGDELT-----------EATDAADDEITYFREQMATITTASEFLADDRLVSFVL 570

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           E+KG+D   V  D L ++F SDL D  S+ N   DNR+ E++ +FNFD  G +S +  G+
Sbjct: 571 EAKGLDPDDVTSDQLKKMFSSDLDDEDSYVNKLDDNRFAELVGAFNFDQDGNISAEPTGE 630

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
           VQ    + +T D Y    +E ++ + +  + LALYF+R    I + Y+ILGDS LF+  +
Sbjct: 631 VQQRGDVLETVDAYVRLTLEDEQGDSNTGVRLALYFQRKASEISSAYDILGDSALFEFFT 690

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM------DHQSIDYK 705
               +S Y + +   K+  +++  I I D  D  KV+D +    AM         +    
Sbjct: 691 TSFNISSYVSNMDVDKQAEMVENFIDIKDLSDPDKVDDLIKRFTAMYDMANGTGTTSTAL 750

Query: 706 KALFSSPNQNKDPWN 720
             L  S   + D   
Sbjct: 751 SILTGSAAISADTLL 765



 Score =  117 bits (293), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 53/298 (17%), Positives = 111/298 (37%), Gaps = 32/298 (10%)

Query: 443 NFNADGSIGPIPMMQSRLTIRDNVKHYANRKR-----SIHDAENKSFNSMEQISTQKRIN 497
           +F+ DG            + +     +  R R     S + +      ++    +     
Sbjct: 12  SFSRDGRRLSRGTAAPSKSAKRVADLHKTRVRGQALVSTYVSYLAVARNLSTSLSNVASQ 71

Query: 498 LEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDP 557
             +  +  YY  NI  + + +E + + ++ ++ +++ G++     + F+ ++ +SDL D 
Sbjct: 72  ATVARDSAYYKDNIGKVTTVDEFMGDYKLYSYAMKAYGLEDMTYAKAFMKKVLESDLSDS 131

Query: 558 KSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEK 617
            SFAN+  D+RY E  ++F F              Q +   D+  D Y+     + +  +
Sbjct: 132 SSFANSLSDSRYAEFAAAFKFSGE-------TKTAQSDVQRDNLLDAYEASFETEADTIE 184

Query: 618 DPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK 677
           D       YF+  I +I +  + L  S+L   V     LS  +      K   +L   + 
Sbjct: 185 DETD----YFEENIASITSVDDFLSSSRLKSYVLTAFGLSTEYTSSSFLK--DVLTSDLD 238

Query: 678 INDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLS 735
             D                ++    D   +L  + N N+D   +     ++ +SL  S
Sbjct: 239 DAD--------------SFVNQLDDDVYVSLAKAFNFNEDGSVDGDLMSEDQISLVTS 282


>gi|209547533|ref|YP_002279451.1| hypothetical protein Rleg2_5534 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538777|gb|ACI58711.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 738

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 209/735 (28%), Positives = 352/735 (47%), Gaps = 31/735 (4%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           ++ ++V+        +   S+V+    VS +  YY+E I  ++T+DEF+ D +L+SYA+K
Sbjct: 12  LVSTYVSYLAVARNLNASLSSVASQGTVSRDSAYYKENIGKVTTVDEFMGDYKLYSYAMK 71

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ F    K  QSD+Q +
Sbjct: 72  AYGLDDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFGGETKTAQSDVQRE 131

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
           T++  Y+ S   + E   +E+ YF +NI  I SVD      RL +Y L +F ++  Y S 
Sbjct: 132 TLLDAYESSFDTEAEDIADETDYFEENISSITSVDDFLSSSRLKNYALTAFGLSTDYTSS 191

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLK VLT  L +   +  +  D+ + ++A+ F F  DGS      ++++ QI  + S Y
Sbjct: 192 SFLKQVLTSDLDDSDSFVNQLGDDVYVSLAKAFNFNEDGSTD--GDVMSEDQISLVTSGY 249

Query: 241 F---NNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
               +         +   Y+   I +++S    + D KL   L+++    + E  +D F+
Sbjct: 250 AVASSTVASSDTGEAYDTYFAAEIGNITSVDQLMNDDKLVGYLRIAYGLTDDE--SDTFI 307

Query: 298 TLMQENDPIVSQVK---YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HDD 351
           +   ++  I   +         NF  D   +     Q   Q       + +N Q+L  + 
Sbjct: 308 SAALKSADIADAIGLSDLHDAFNFDEDGALADGDTAQTSEQTATTTAAFDENYQVLIANT 367

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
             +  + +Y   +  + SID+ L      +   + + P    + AL A++++   + R Q
Sbjct: 368 DSEDAVDNYTTRIASVTSIDDFLVSNADDDVDGNDDLPE-MWEMALRAFDIDPDSVSRSQ 426

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
           +R +L S+P+D  SY N   DDR +    AFNF++DG +       S   + D   +Y  
Sbjct: 427 VRKILESDPTDSKSYVNSLDDDRFVAFRKAFNFDSDGDVTVPLQAMSESVVDDYAAYYKQ 486

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
            K    D ++ +                 + E+ Y+   + TI +  E LA+ R+++  L
Sbjct: 487 NKIRYLDGDDLT-----------EATDAADDEISYFREQMATITTASEFLADDRLVSLAL 535

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           E+KG+D   V  D L ++F SDL D  S+ N   D+R+ E++ SFNFD  G +S    G 
Sbjct: 536 EAKGLDPDDVTSDQLKKMFSSDLDDEDSYVNKLDDSRFAELVGSFNFDQDGNISADPTGT 595

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
           VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y ILGDS LF+  +
Sbjct: 596 VQQRGDVLETIDSYVRLTLEDDQGDSNTGVRLALYFQRKAPEISSAYGILGDSALFQFFT 655

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM------DHQSIDYK 705
               LS Y + +   K+  ++   I I D  D  KV+D +    AM         +    
Sbjct: 656 TTFNLSSYVSNMDVDKQAEMVNNFIDIKDLADPDKVDDLIKRFTAMYDVANGTGTTSSAL 715

Query: 706 KALFSSPNQNKDPWN 720
             L  S + + D   
Sbjct: 716 SILTGSASISADTLL 730



 Score =  116 bits (290), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/244 (19%), Positives = 96/244 (39%), Gaps = 27/244 (11%)

Query: 492 TQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
           +       ++ +  YY  NI  + + +E + + ++ ++ +++ G+D     + F+ ++ +
Sbjct: 31  SSVASQGTVSRDSAYYKENIGKVTTVDEFMGDYKLYSYAMKAYGLDDMTYAKAFMKKVLE 90

Query: 552 SDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIE 611
           SDL D  SFAN+  D RY E  ++F F              Q +   +   D Y+     
Sbjct: 91  SDLSDSSSFANSLSDGRYAEFAAAFKFGGE-------TKTAQSDVQRETLLDAYESSFDT 143

Query: 612 KKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRI 671
           + E+  D       YF+  I +I +  + L  S+L         LS  +      K++  
Sbjct: 144 EAEDIADETD----YFEENISSITSVDDFLSSSRLKNYALTAFGLSTDYTSSSFLKQVLT 199

Query: 672 LKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVS 731
                  +D  DS            ++    D   +L  + N N+D   +     ++ +S
Sbjct: 200 -------SDLDDSD---------SFVNQLGDDVYVSLAKAFNFNEDGSTDGDVMSEDQIS 243

Query: 732 LQLS 735
           L  S
Sbjct: 244 LVTS 247


>gi|307309365|ref|ZP_07589028.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
 gi|307320101|ref|ZP_07599522.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
 gi|306894316|gb|EFN25081.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
 gi|306900234|gb|EFN30852.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
          Length = 769

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 200/796 (25%), Positives = 346/796 (43%), Gaps = 106/796 (13%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +++               VS+  IV+ + +YYRE I  ++++DEF+ D RL+SYA+K
Sbjct: 1   MVSTYLDYNLIARDMKLSLRRVSEQTIVARDTQYYRENIGSVASVDEFLADYRLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL+DM  +  F++K+LESDLSD  S  N+L   +Y+ F  ++ FS    V Q++ Q  
Sbjct: 61  AYGLADMIESVAFMRKVLESDLSDDNSFANKLTDERYRDFTMAFSFSGGTAVSQTEAQLD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  Y  S     E   EE++Y+   I K+ SVDQL  + RL  YV   F I     S 
Sbjct: 121 EMIGLYNTSIASIGETQKEETRYYNVMIDKVTSVDQLLNNDRLRTYVFTVFGIDESTYSR 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNR----------------------------------- 205
             L+ VL+    +P  Y     + R                                   
Sbjct: 181 ETLRKVLSSNADDPDSYENTVLEPRLSELEAARADAQAKLQQSGTTQAEKLELQAKIATY 240

Query: 206 ---------FRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPIVSDQ 254
                    + AMA  F+F+ DG+++      T    + +   Y   N+ +     + ++
Sbjct: 241 NKSISTVSNYLAMAAAFQFEADGTVAAGS-AQTAAHKKTMNELYVSSNSRVTPQAALLNK 299

Query: 255 NYYKLAINSVSSFSDFLKDPKLFKMLQLSL---------------FPLNPEITADKFLTL 299
            Y++  I S+++ S+ + D +L+  ++ +                   +P+       T+
Sbjct: 300 AYFEEKIASITTVSELVADTRLYNYIRTAFDLNEVTIVPATIKNILTSDPDDPNSYINTI 359

Query: 300 MQENDPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLI 357
            + N+   +  + F   NF  D +  +    Q   Q       Y        D   +  I
Sbjct: 360 GKGNENYKALARAF---NFQADGTLAAGDAAQTAEQTTLTSSRYMTRYNDKDDAADEKAI 416

Query: 358 KDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
             Y+L + K+ S+ + +             E      FAL A  L+        ++ VLT
Sbjct: 417 GAYKLAVEKMTSVSDFI-------------ETASIYDFALQAVGLDPDSESARTIKRVLT 463

Query: 418 SNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIH 477
           S+ +DP+S+    KD+R +KL   FNF   G IG   + QS   I++  K Y   K    
Sbjct: 464 SDLTDPESFVYTLKDERYLKLAQLFNFTTSGDIGVPALAQSETLIQETAKTYIVNKSRFG 523

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
             E+K+               +  +E +YYT  +  + S +E LA+ R+++F LE+ GID
Sbjct: 524 SEEDKT---------------KAEAEAEYYTAEVAKLSSLDEFLADSRLVDFALEANGID 568

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNR-YKEIISSFNFDIHGELSHKKIGKVQDNF 596
            + V  DFL +IF SDL DPKSF N  +++  Y  +++SFNFD  G +  +    +    
Sbjct: 569 PENVTLDFLRDIFTSDLDDPKSFINQQQNSGAYIALVTSFNFDSGGNVLREDKSVIITRQ 628

Query: 597 HIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL 656
            + +T D Y HQ +E++  E +  + LALYF+R   ++ + Y++L D  L +V      L
Sbjct: 629 GLYETLDRYLHQSLEEQAGEDNAGVRLALYFERQAGSLVDAYDLLADDALAEVFRTIFSL 688

Query: 657 SPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNK 716
              F+ +   ++ +I++K++ +    D  +++  L     +               N   
Sbjct: 689 PDEFSSMDIDQQAKIVEKNLDLEKLSDPAELKKLLARFTVLYDLEN----------NMEV 738

Query: 717 DPWNNSFDDPQNNVSL 732
           DP         +N+ +
Sbjct: 739 DPAVVVLSGSGSNIGI 754


>gi|15964619|ref|NP_384972.1| hypothetical protein SMc00986 [Sinorhizobium meliloti 1021]
 gi|15073797|emb|CAC45438.1| Hypothetical protein SMc00986 [Sinorhizobium meliloti 1021]
          Length = 769

 Score =  548 bits (1412), Expect = e-153,   Method: Composition-based stats.
 Identities = 199/796 (25%), Positives = 344/796 (43%), Gaps = 106/796 (13%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +++               VS+  IV+ + +YYRE I  ++++DEF+ D RL SYA+K
Sbjct: 1   MVSTYLDYNLIARDMKLSLRRVSEQTIVARDTQYYRENIGSVASVDEFLADYRLHSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL+DM  +  F++K+LESDLSD  S  N+L   +Y+ F  ++ FS    V Q++ Q  
Sbjct: 61  AYGLADMIESVAFMRKVLESDLSDDNSFANKLTDERYRDFTMAFSFSGGTAVSQTEAQLD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  Y  S     E   EE++Y+   I K+ SVDQL  + RL  YV   F I     S 
Sbjct: 121 EMIGLYNTSIASIGETQKEETRYYNVMIDKVTSVDQLLNNDRLRTYVFTVFGIDESTYSR 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNR----------------------------------- 205
             L+ VL+    +P  Y     + R                                   
Sbjct: 181 ETLRKVLSSNADDPDSYENTVLEPRLSELEAARADAQAKLQQSGTTQAEKLELQAKIATY 240

Query: 206 ---------FRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPIVSDQ 254
                    + AMA  F+F+ DG+++      T    + +   Y   N+ +     + ++
Sbjct: 241 NKSISTVSNYLAMAAAFQFEADGTVAAGS-AQTAAHKKTMNELYVSSNSRVTPQAALLNK 299

Query: 255 NYYKLAINSVSSFSDFLKDPKLFKMLQLSL---------------FPLNPEITADKFLTL 299
             ++  I S+++ S+ + D +L+  ++ +                   +P+       T+
Sbjct: 300 ADFEEKIASITTVSELVADTRLYNYIRTAFDLNEVTIVPATIKNILTSDPDDPNSYINTI 359

Query: 300 MQENDPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLI 357
            + N+   +  + F   NF  D +  +    Q   Q       Y        D   +  I
Sbjct: 360 GKGNENYKALARAF---NFQADGTLAAGDAAQTAEQTTLTSSRYMTRYNDKDDAADEKAI 416

Query: 358 KDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
             Y+L + K+ S+ + +             E      FAL A  L+        ++ VLT
Sbjct: 417 GAYKLAVEKMTSVSDFI-------------ETASIYDFALQAVGLDPDSESARTIKRVLT 463

Query: 418 SNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIH 477
           S+ +DP+S+    KD+R +KL   FNF   G IG   + QS   I++  K Y   K    
Sbjct: 464 SDLTDPESFVYTLKDERYLKLAQLFNFTTSGDIGVPALAQSETLIQETAKTYIVNKSRFG 523

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
             E+K+               +  +E +YYT  +  + S +E LA+ R+++F LE+ GID
Sbjct: 524 SEEDKT---------------KAEAEAEYYTAEVAKLSSLDEFLADSRLVDFALEANGID 568

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNR-YKEIISSFNFDIHGELSHKKIGKVQDNF 596
            + V  DFL +IF SDL DPKSF N  +++  Y  +++SFNFD  G +  +    +    
Sbjct: 569 PENVTLDFLRDIFTSDLDDPKSFINQQQNSGAYIALVTSFNFDSGGNVLREDKSVIITRQ 628

Query: 597 HIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL 656
            + +T D Y HQ +E++  E +  + LALYF+R   ++ + Y++L D  L +V      L
Sbjct: 629 GLYETLDRYLHQSLEEQAGEDNAGVRLALYFERQAGSLVDAYDLLADDALAEVFRTIFSL 688

Query: 657 SPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNK 716
              F+ +   ++ +I++K++ +    D  +++  L     +               N   
Sbjct: 689 PDEFSSMDIDQQAKIVEKNLDLEKLSDPAELKKLLARFTVLYDLEN----------NMEV 738

Query: 717 DPWNNSFDDPQNNVSL 732
           DP         +N+ +
Sbjct: 739 DPAVVVLSGSGSNIGI 754


>gi|86360899|ref|YP_472786.1| hypothetical protein RHE_PF00168 [Rhizobium etli CFN 42]
 gi|86285001|gb|ABC94059.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 727

 Score =  545 bits (1403), Expect = e-152,   Method: Composition-based stats.
 Identities = 209/706 (29%), Positives = 354/706 (50%), Gaps = 25/706 (3%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ ++V+        +   S+V+    V+ +  YY+E I  ++T+DEF+ D +L+SYA+K
Sbjct: 1   MVSTYVSYLAVARNLNASLSSVASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ F+   K  QSD Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFAGETKTAQSDEQRD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
           +++  Y+ S   + E   +E+ YF +NI  I SVD L    RL +YVL +F ++ +Y S 
Sbjct: 121 SLLDAYEDSFDTEAENIEDETDYFEENISSITSVDDLLSSSRLKNYVLTAFGLSTEYTST 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLKDVLT  L + + +  +  D+ + ++A+ F    DGS      ++++ Q+  + S Y
Sbjct: 181 SFLKDVLTSDLDDSESFVNQLDDDVYVSLAKAFNVSEDGSTD--GDVMSEDQLSLVTSAY 238

Query: 241 FNNT---IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
              +          +   Y+   I +++S    + D KL   L+ +    + E   D F+
Sbjct: 239 AVASSTLASTETGEAYDTYFAAQIGNITSVDQLMSDDKLVSYLRTAYGLSDTET--DNFI 296

Query: 298 TLMQENDPIVSQVK---YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HDD 351
           +   ++  I   +         NF  D   +     Q   Q       + +N Q+L  + 
Sbjct: 297 SAALKSADIADAIGLSDLHDAFNFDEDGALADGETAQTSEQTAATTAAFDENYQVLIANT 356

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
           + +  + +Y   +  I SID+ L      +  ++ + P    + AL A+ ++  ++ + +
Sbjct: 357 ETEDAVDNYTTRIASITSIDDFLVSNADDDDDDNDDLPE-LWEMALRAFGIDSGEVSKSE 415

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
           +R +L S+P DP SY N  KDDR     +AFNF++DG +       S   + D   +Y  
Sbjct: 416 VRKILESDPGDPKSYVNSLKDDRFEAFRNAFNFDSDGDVTVPLQAMSESVVDDYAAYYKQ 475

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
            K    + +  +                 + E++Y+   + TI S  E LA+ R++ F L
Sbjct: 476 NKIRYLEGDELT-----------EATDAADEEIEYFRDQMATITSASEFLADDRLVAFAL 524

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           E+KG+D + V  D L +IF SDL D  S+ N  +D+R+ E++ SFNFD  G +S    G 
Sbjct: 525 EAKGLDPEDVTSDDLEKIFSSDLDDEDSYVNKLEDSRFAELVGSFNFDRDGNISADPTGT 584

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
           VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y+ILGDS LF+  +
Sbjct: 585 VQQRGDVLETVDAYVRLTLEDDQGDSNTGVRLALYFEREAPEISSAYDILGDSALFEFFT 644

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
               LS Y + +   K+  +++  I I D  D  KV+D +    AM
Sbjct: 645 TSFNLSSYVSNMDVDKQAEMIENFIDIKDLADPDKVDDLIKRFTAM 690


>gi|222147731|ref|YP_002548688.1| hypothetical protein Avi_0969 [Agrobacterium vitis S4]
 gi|221734719|gb|ACM35682.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 727

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 212/720 (29%), Positives = 354/720 (49%), Gaps = 42/720 (5%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +++               VS++P V+ E++YY+E I  + T+D+F+ D RL+ Y +K
Sbjct: 1   MVSTYIGYDLVNRDMKASLKRVSQEPEVAREQKYYQENIGKVKTVDDFMNDDRLYQYTMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A GL DM++A+ F+KK+LESDLSD  S  N+L   +Y+ FARS++FS     IQ+D Q +
Sbjct: 61  ANGLEDMTYAKAFMKKVLESDLSDEDSYANKLADDRYRDFARSFNFSAETADIQTDKQEE 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  YKQS   + + A EE +Y+   I K+ +VD L K+ RL  +VL+S+ +  KY S 
Sbjct: 121 DVIGLYKQSLVTEGDDAKEEVQYYDSAIDKVTNVDDLLKNSRLTKFVLESYGLDTKYYST 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNR--FRAMAENFRFQPDGSLSKRDKILTDMQ--IEKI 236
             LK VLT  + +   Y      N+  +  +A+ F F  DGSL       +D +  +E +
Sbjct: 181 DHLKKVLTSDVNDSTSYVNTLTTNKSDYVNIAKAFSFNTDGSLKNATAQTSDQKTAMEDL 240

Query: 237 VSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFP---------- 286
                 +T        +  YYK  I +V+  SD   D +LF  ++ +L            
Sbjct: 241 YLEEVPSTETAYQAEREAAYYKEKIATVTKASDITGDSRLFSYVKTALGMDKNTLKSTFE 300

Query: 287 ---LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
               +    A+ +     +     +++   F  +    N+++   Q ++Q+ +    Y  
Sbjct: 301 NIVTSDLNDANSYANTQGKVKGEYAKIAAMFNFD-TSGNATAGNAQSETQLSQTATAYMT 359

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
           N        + SL   Y   +  I  +D+LL  +                   + AY + 
Sbjct: 360 NYDDEDQANLSSLTTYYSTQMKSITKVDDLLGNEK-------------IYDMVMKAYGIE 406

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
             +  +  L+ VLTS+ +DP SYANK++D+RLI L  AFNF  DG+     + QS  TI 
Sbjct: 407 TDEFSKADLKKVLTSDMNDPKSYANKTRDERLISLASAFNFKEDGTADVPLLAQSERTIT 466

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
           +  K Y  +K    + +            Q         +  YY  NI  + S  +LL +
Sbjct: 467 EVAKDYIVQKTRFLEGKE-----------QTDAKTAAEEDSKYYQENIVKVSSVTDLLKD 515

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
           +++++F L ++G+D + V +D L ++F SDL DPKSFANT  D  Y + ++S+NFD  G+
Sbjct: 516 RKLVDFALTAQGLDPKDVSDDMLKQLFSSDLTDPKSFANTQADEGYAKFVASYNFDSSGK 575

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
           +S +    VQ+     +T +LY HQ +E ++ E D  + LALY+ R    I + Y+ILGD
Sbjct: 576 ISQENADGVQNRSETFNTENLYLHQTLENEQGESDQGVRLALYWDRMSSTITSAYDILGD 635

Query: 644 SKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSID 703
           + L +V      L    + +   ++ ++++K + + D  D +K + FL    AM     +
Sbjct: 636 TALLEVFRTAYSLPSDMSNMDIEQQKKVIEKKMDLKDLSDPEKQKKFLQRFTAMYDLENN 695


>gi|150395704|ref|YP_001326171.1| hypothetical protein Smed_0479 [Sinorhizobium medicae WSM419]
 gi|150027219|gb|ABR59336.1| protein of unknown function DUF1217 [Sinorhizobium medicae WSM419]
          Length = 822

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 190/771 (24%), Positives = 334/771 (43%), Gaps = 98/771 (12%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +++     ++D++  L   VS+  IV+ + +YYRE I  ++++D F+ D RL+SYA+
Sbjct: 54  MVSTYLDYNLIARDMKLSL-RRVSEQTIVARDTQYYRENIASVASVDAFLADYRLYSYAM 112

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM  +  F++K+LESDL+D  S  N+L   +Y+ FA ++ FS    V Q++ Q 
Sbjct: 113 KAYGLGDMIDSVAFMRKVLESDLADDNSFANKLTDERYREFAMAFSFSGGTAVSQTEAQL 172

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y  S     E   EE++Y+   + K+ SVDQL  + RL  Y+   F I     S
Sbjct: 173 DEMIGLYNTSIASIGETQKEETRYYNLMVDKVTSVDQLLNNDRLRAYIFTVFGIDESTYS 232

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNR---------------------------------- 205
              L++VL+    +P  Y     + R                                  
Sbjct: 233 RETLRNVLSSNADDPDSYENTVLEPRLTELQTARADAQAKLQQSGTTQAEKLELQAKIAT 292

Query: 206 ----------FRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPIVSD 253
                     + AMA  F+F  DG+++      T    + +   Y   N  I     + +
Sbjct: 293 YNKSISTVSNYLAMAAAFQFSADGTVAAGS-AQTAAHKKTMNELYVSSNPRITPQAALLN 351

Query: 254 QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI------- 306
           + Y++  I S+++ S+ + D +++  ++ + F LN        +  +  +DP        
Sbjct: 352 KAYFEEKIASITNVSELVADTRIYNYIRTA-FDLNEVTIVPATIKNILTSDPDDPDSYIN 410

Query: 307 ------VSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK 358
                  +        NF  D +  +    Q   Q       Y        D   +  I 
Sbjct: 411 TIGKGNENYKALARAFNFQADGTLAAGDAAQTAEQTTLTSSRYMTRYNDKDDAADEKAIG 470

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
            Y+L + K+ S+ + +             E      FAL A  L+        ++ VL S
Sbjct: 471 AYKLAVEKMVSVGDFI-------------ETASIYDFALKAVGLDPDAESTRTIKRVLMS 517

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
           + +DP S+    KD+R +KL   FNF   G IG   + Q    I++  K Y   K     
Sbjct: 518 DLTDPGSFVYTLKDERYLKLAQLFNFTTSGDIGVPALAQPETLIQETAKTYIVNKSRFGS 577

Query: 479 AENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDS 538
            E+K+    E                      +  + S +  LA+ R++ F LE+ GID 
Sbjct: 578 EEDKAEAEAEAEYYTAE---------------VAKLASLDAFLADSRLVAFALEANGIDP 622

Query: 539 QKVREDFLCEIFKSDLKDPKSFANTYKDNR-YKEIISSFNFDIHGELSHKKIGKVQDNFH 597
           + V  DFL EIF SDL DPKSF N  +++  Y  +++S+NFD  G +  +    +     
Sbjct: 623 ENVTIDFLREIFTSDLDDPKSFINQQQNSGSYIALVTSYNFDRSGNILREDKSVIITRQG 682

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLS 657
           + +T D Y HQ +E++  E +  + LALYF+R   ++ + Y++L D  L +V      L 
Sbjct: 683 LYETFDRYLHQTLEEQAGEDNAGVRLALYFERQAGSLVDAYDLLADDALAEVFRTIFSLP 742

Query: 658 PYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM----DHQSIDY 704
             F+ +   ++ +I++K++ +    +  +++  L     +    ++  +D 
Sbjct: 743 DEFSSMDIDQQAKIVEKNLDLEKLSEPAELKKLLARFTVLYDLENNTEVDP 793


>gi|116248743|ref|YP_764584.1| putative flagella associated protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115253393|emb|CAK11781.1| putative flagella associated protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 727

 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 204/735 (27%), Positives = 347/735 (47%), Gaps = 31/735 (4%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ ++V+        +   S V+    V+ +  YY+E I  ++T+DEF+ D +L+SYA+K
Sbjct: 1   MVSTYVSYLTVARNLNASLSNVASQATVARDSAYYKENIDKVTTVDEFMSDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ F+   K  QSD+Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDTRYAEFAAAFKFAGETKTAQSDVQRD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            ++  Y++S   +     + + YF  NI  I SVD L    +L +YVL +F ++ +Y S 
Sbjct: 121 NLLDAYEESFDTEAGDIADATDYFEDNISSITSVDDLLSSSKLKNYVLTAFGLSTEYTSS 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLK VLT  L     +  +  D  +  +++ F F  DG       ++++ QI  + S Y
Sbjct: 181 SFLKSVLTSDLDETDSFVNQLDDEVYVNLSKAFNFNEDGLTD--GDVMSEDQISLVTSAY 238

Query: 241 FNNTID---CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
              +          +   Y+   I +++S  + + D KL   L+ +    + E   D F+
Sbjct: 239 AVASATIASSETGEAYDTYFAAQIGNITSVDELMSDDKLVSYLRTAYGLTDSET--DNFI 296

Query: 298 TLMQENDPIVSQVK---YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HDD 351
           +   ++  I   +         NF  D   +     Q   Q       + +N ++L  + 
Sbjct: 297 SAALKSADIADAIGLSELHDAFNFDEDGALADGDTAQTSEQTAATTAAFDENYEVLIANT 356

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
             +  + +Y   +  + SID+ L      +  ++ + P    + AL AY+++   + R +
Sbjct: 357 DTEDAVDNYTTRIASVTSIDDFLVSNDDDDDDDNDDLPE-LWEMALRAYDIDPDSVSRSE 415

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
           +R +L S+PSD  SY N   DDR +    AFNF+ +G +       S   + D   +Y  
Sbjct: 416 VRKILESDPSDSKSYVNSLDDDRFVAFRKAFNFDDNGDVTVPLQAMSESVVDDYATYYKQ 475

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
            K    + +  +                 +  + Y+   + TI +  E LA+ R+++F+L
Sbjct: 476 NKIRYLEGDEMT-----------EATDAADEGITYFREQMATITTASEFLADDRLVSFVL 524

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           E+KG+D   V  D L E+F SDL D  S+ N   DNR+ E++ +FNFD  G +S +  G 
Sbjct: 525 EAKGLDPDDVTSDALEEMFASDLDDEDSYVNKLDDNRFAELVGAFNFDQDGNISAEPTGT 584

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
           VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y+ILGDS LF+  +
Sbjct: 585 VQQRGDVLETIDAYVRLTLEDDQGDSNTGVRLALYFQRKAPEISSAYDILGDSALFEFFT 644

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM------DHQSIDYK 705
               LS Y + +   K+  ++   I I D  D  KV+D +    AM         +    
Sbjct: 645 TSFNLSSYVSNMDVDKQAEMIDNFIDIEDLSDPDKVDDLIKRFTAMYDMANGTGTTSTAL 704

Query: 706 KALFSSPNQNKDPWN 720
             L  S   + D   
Sbjct: 705 SILTGSATISADTLL 719


>gi|241113587|ref|YP_002973422.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861795|gb|ACS59461.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 727

 Score =  531 bits (1368), Expect = e-148,   Method: Composition-based stats.
 Identities = 202/706 (28%), Positives = 342/706 (48%), Gaps = 25/706 (3%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ ++V+        +   S+V+    VS +  YY+E I  ++T+DEF+ D +L+SYA+K
Sbjct: 1   MVSTYVSYLSVARNLNASLSSVASQATVSRDSAYYKENIDKVTTVDEFMSDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+ K+LESDLSD  S  N L+  +Y  FA ++ F+   K  QSD+Q  
Sbjct: 61  AYGLEDMTYAKAFMTKVLESDLSDSSSFANSLSDTRYAEFAAAFKFAGETKTAQSDVQRD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            ++  Y++S   + +   + + YF +NI  I SVD L    +L +YVL +F ++ +Y S 
Sbjct: 121 NLLDAYEESFDTEADDIADATDYFEENISSITSVDDLLSSSKLKNYVLTAFGLSTEYTST 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLK VLT  L +   +  +  D  +  +A+ F F  DGS      ++++ QI  + S Y
Sbjct: 181 SFLKSVLTSDLEDADSFVNQLDDAVYVNLAKAFNFNEDGSTD--GDVMSEDQISLVTSAY 238

Query: 241 FNNTID---CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
              +          +   Y+   I +++S  + + D KL   L+ +    + E   D F+
Sbjct: 239 AVASATIASSETGEAYDTYFAAQIGNITSVDELMSDDKLVSYLRTAYGLTDSET--DNFI 296

Query: 298 TLMQENDPIVSQVK---YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HDD 351
           +   ++  +   +         NF  D   +     Q   Q       + +N Q+L  + 
Sbjct: 297 SAALKSADVADAIGLSDLHDAFNFDEDGDLADGDTAQTSDQTATTTAAFDENYQVLVANA 356

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
             +    +Y   +  + SID+ L      +  ++ + P    + AL AY+++   + R +
Sbjct: 357 STEDATDNYTTRIASVTSIDDFLVSNDDDDDDDNDDLPE-LWEMALRAYDIDPDSVSRSE 415

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
           +R +L S+P+D  SY N   DDR +    AFNF+ +G +       S   + D   +Y  
Sbjct: 416 VRKILESDPADSKSYVNSLDDDRFVAFRKAFNFDDNGDVTVPLQAMSESVVDDYAAYYKQ 475

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
            K    +    +                 N E+ Y+   + TI +  E LA+ R+++F L
Sbjct: 476 NKIRYLEGAELT-----------EATDAANDEITYFREQMATITTASEFLADDRLVSFAL 524

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           E+KG+D   V  D L ++F SDL D  S+ N   DNR+ E++ +FNFD  G +S    G 
Sbjct: 525 EAKGLDPDDVTSDELEKMFSSDLDDEDSYVNKLDDNRFAELVGAFNFDQDGNISADPTGT 584

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
           VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y ILGDS LF+  +
Sbjct: 585 VQQRGDVLETIDAYVRLTLEDDQGDSNTGVRLALYFQRKAPEISSAYNILGDSALFEFFT 644

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
               LS Y + +   K+  ++   I + D  D  KV+D +    AM
Sbjct: 645 TTFNLSSYVSNMDVDKQAEMVDNFIDMKDLSDPDKVDDLIKRFTAM 690


>gi|227821060|ref|YP_002825030.1| putative flagella associated protein [Sinorhizobium fredii NGR234]
 gi|227340059|gb|ACP24277.1| putative flagella associated protein [Sinorhizobium fredii NGR234]
          Length = 769

 Score =  530 bits (1364), Expect = e-148,   Method: Composition-based stats.
 Identities = 188/781 (24%), Positives = 338/781 (43%), Gaps = 96/781 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +++               VS+  +V+ + +YY+E I ++S++D F+ D RL+SYA+ 
Sbjct: 1   MVSTYLDYNLIARDMKVSLKRVSEQTVVARDTQYYKENIGNVSSVDAFLDDYRLYSYAMT 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           AFGL DM  +  F++K+LESDLSD  S  N L   +Y+ FA +Y FS    V Q++ Q  
Sbjct: 61  AFGLGDMIDSVAFMRKVLESDLSDTSSFANSLTDDRYREFALAYSFSGATAVSQTEAQLD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            II  Y  S  +  E   EE++Y+   I KI SVDQL  + RL  YV  +F +     S 
Sbjct: 121 EIIGLYDTSILNIAETQEEETRYYNVMIDKITSVDQLLNNDRLRAYVFTAFGVDESTYSR 180

Query: 181 PFLKDVLTLGLANPKKYFIE---------------------------------------- 200
             ++ VL+    +   Y                                           
Sbjct: 181 QTIRSVLSSSSGDASSYENTVIAPKLSELETAKAAAEAQLTAGGLTDEEEAELESKITTY 240

Query: 201 ----SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPIVSDQ 254
               +  N +  +A  F F  DG+++      TD   E     Y   N+ +     + ++
Sbjct: 241 ANSIATLNNYIDLAAAFDFNSDGTVTAG-AAQTDENKETTNELYISSNSRVTSQAALLNK 299

Query: 255 NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI-------- 306
            Y++  I S+++ ++ L D +L+  ++ + F L+        +  +  +DP         
Sbjct: 300 AYFEETIASITTVTELLADTRLYNYIRTA-FDLDEVTIVSATIKNILTSDPDDPDSYVNT 358

Query: 307 -----VSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKD 359
                 + +      NF  D +       Q  +Q     + Y        D+  +  +  
Sbjct: 359 IGGGDANYLALANAFNFQEDGTLAVGDSAQTAAQTTLTSNRYMTRYNDKDDEADEKAVSA 418

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +  + S+D+ +                    FAL A  L+        ++ VLTS+
Sbjct: 419 YKTAVASMTSVDDFIGSAS-------------IYDFALKAVGLDPDTASTRTIKRVLTSD 465

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            +DP SY    KD+R + L   FNF  +G IGP  + QS   I++  K++   K      
Sbjct: 466 LTDPKSYVYSLKDERYVTLAKLFNFTTEGEIGPPALAQSETQIQETAKNHIVIKSRFGSE 525

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
           ++K+               +   E +YYT  +  + S +E LA+ R++   LE+ GID +
Sbjct: 526 DDKT---------------KAQEESEYYTAGVAKLSSLDEFLADDRLVTIALEANGIDPE 570

Query: 540 KVREDFLCEIFKSDLKDPKSFANTYKDNR-YKEIISSFNFDIHGELSHKKIGKVQDNFHI 598
            V  D L +IF SDL DP+S  N  +++  Y  +++SFNFD  G +  +    +     +
Sbjct: 571 GVTADVLRQIFNSDLDDPESVINEQENSAAYVSLVTSFNFDSEGNVLREDRDSIVTRQGL 630

Query: 599 DDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
            +T D Y  Q +E++  E +  + LALYF+R   ++ + Y++L D  L +V      L  
Sbjct: 631 YETLDQYLRQTLEEQAGESNEGVRLALYFERKAGSLVDAYDLLADDALAEVFRTIFSLPD 690

Query: 659 YFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM----DHQSIDYKKALFSSPNQ 714
            F+ +   ++ +I++K++ +    D  +++  L     +    ++  +D   ++ +S   
Sbjct: 691 EFSTMDIDQQAKIVEKNLDLEKLSDPAELKKLLARFAVLYDLENNTEVDPAVSVLTSTGS 750

Query: 715 N 715
           +
Sbjct: 751 S 751



 Score = 89.2 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/251 (17%), Positives = 88/251 (35%), Gaps = 14/251 (5%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
              F +         E  YY   +  +S++DEF+ D RL + AL+A G+         ++
Sbjct: 519 KSRFGSEDDKTKAQEESEYYTAGVAKLSSLDEFLADDRLVTIALEANGIDPEGVTADVLR 578

Query: 76  KILESDLSDPKSLVN-QLNSLKYQYFARSYDFSPPPKVIQSDIQH-----------KTII 123
           +I  SDL DP+S++N Q NS  Y     S++F     V++ D                 +
Sbjct: 579 QIFNSDLDDPESVINEQENSAAYVSLVTSFNFDSEGNVLREDRDSIVTRQGLYETLDQYL 638

Query: 124 QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK--YISLP 181
           +   +    +    +  + YF +    +     L  D  L +     FS+  +   + + 
Sbjct: 639 RQTLEEQAGESNEGVRLALYFERKAGSLVDAYDLLADDALAEVFRTIFSLPDEFSTMDID 698

Query: 182 FLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF 241
               ++   L   K              A  +  + +  +     +LT       +S   
Sbjct: 699 QQAKIVEKNLDLEKLSDPAELKKLLARFAVLYDLENNTEVDPAVSVLTSTGSSVGISADT 758

Query: 242 NNTIDCVPIVS 252
             T+  + +  
Sbjct: 759 LYTLSQLRMGG 769


>gi|27379820|ref|NP_771349.1| hypothetical protein blr4709 [Bradyrhizobium japonicum USDA 110]
 gi|27352973|dbj|BAC49974.1| blr4709 [Bradyrhizobium japonicum USDA 110]
          Length = 687

 Score =  505 bits (1301), Expect = e-141,   Method: Composition-based stats.
 Identities = 197/737 (26%), Positives = 330/737 (44%), Gaps = 69/737 (9%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ ++ +         +  + V +   V+ E  YY+  I  + T+D+ +KD RL+ YALK
Sbjct: 1   MVSTYFSYNYISHHLKQSLTRVEQQTDVAREAAYYKANIGKVKTVDDLMKDYRLYHYALK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQH 119
           A+GL DM++A+ F++K+LESDLSD KS VN+L   +Y+ FA ++ F+     V QS+ Q 
Sbjct: 61  AYGLEDMAYAKAFMRKVLESDLSDAKSFVNKLVDKRYREFAAAFSFNGTATPVAQSENQT 120

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
              I  Y  + + + +   +++KY+   I  I+S DQL  + RL +YV  +F I      
Sbjct: 121 DETIGLYTATKKSQVDALADDTKYYSAQIGSISSADQLLNNDRLRNYVYSAFGIDQSKWP 180

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
              +  VL    ++P  Y   +  ++   +          + +K D   T+ +I    + 
Sbjct: 181 PDTISQVLRSDPSDPNSYVNTAFASQLTGLNAQL------AQAKSDVSATNTKIADYTAQ 234

Query: 240 YFNNTIDC----VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADK 295
                 D     V I+ ++ + +    S+SS +D +     F  L  +      E +AD 
Sbjct: 235 LSQPGADVAQLNVQILVEKYHLESYTKSISSLNDQIATIGGFVDLAGAF-----EFSADG 289

Query: 296 FLTLMQENDPIVSQVKYFFQINFHR-DNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQ 354
            L        + +Q      +   R D+S S      S + +     +    I   D +Q
Sbjct: 290 SLP-----SGVPAQTAANVTLTTKRFDDSKSDVYAAASPLNEAFATVQFRNAIGKIDSVQ 344

Query: 355 SLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRN 414
           + +                                     FAL A  L+  ++ +  ++ 
Sbjct: 345 AFVST------------------------------PAVYDFALGAVGLDPAEVSQATVKA 374

Query: 415 VLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKR 474
            L S+ SDP S+    KD+R ++L  AFNF+A+G++    + Q    +    K Y     
Sbjct: 375 ALESDLSDPKSFVYTLKDNRYVELARAFNFDANGNLTTPLVAQDSAKVLQTAKDYVIAVL 434

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
                E            QK +  +   +   Y   I  I S  ELLAN+++++F+L +K
Sbjct: 435 KQASPE-----------QQKAVREQAQKDATSYQEAIAGIDSVSELLANRKMVDFILVAK 483

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G+D +KV  ++L +IF SDL +PKSFANT  D+R+ EI +SFNFD    ++   +   Q 
Sbjct: 484 GLDPKKVSTEYLKKIFASDLNNPKSFANTESDHRFAEIAASFNFDSKDNVARLAMVGPQK 543

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
              + +T   Y  Q +E+++ + +P + LALYF+R    I + Y+IL D  L +V     
Sbjct: 544 QVQLRETQANYLQQSLEQQQGDTNPGVRLALYFQRKAGEITSAYDILADKALSEVFRTTF 603

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQ 714
            L    A +P  ++ + + K +KI D  D  KVE  L    AM     D K     S  Q
Sbjct: 604 NLPDSMAAMPIDQQAKFVDKFMKIKDLSDPAKVEKLLGRFSAM----YDVKNG--QSIGQ 657

Query: 715 NKDPWNNSFDDPQNNVS 731
            + P  N F    + +S
Sbjct: 658 GQSPLLNLFQGSGSGLS 674


>gi|300023907|ref|YP_003756518.1| hypothetical protein Hden_2400 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525728|gb|ADJ24197.1| protein of unknown function DUF1217 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 710

 Score =  501 bits (1290), Expect = e-139,   Method: Composition-based stats.
 Identities = 198/723 (27%), Positives = 316/723 (43%), Gaps = 60/723 (8%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +         S+  + VS    VS    YY   I  + ++D+F+ + RLFSYA+K
Sbjct: 1   MISTFLTYTSYASDMSRSLARVSGQAEVSSATAYYNANIGKVKSVDDFMNNHRLFSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDP----KSLVNQLNSLKYQYFARSYDFSPPPK----- 111
           A+GL DM++A+ F+KK+L SD+S      KS V +L   ++  FA+++ FS   K     
Sbjct: 61  AYGLEDMTYAKAFMKKVLTSDISTSTNLQKSFVGKLTDPRFLKFAQAFQFSADGKVATQP 120

Query: 112 -VIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
              Q       +I  Y Q   +K   A ++S Y++ NI  + SVD L  + RLL+Y L +
Sbjct: 121 VTAQQANDQSDLINLYTQQQVNKGATAADDSAYYQANIGNVASVDDLVGNTRLLNYALTA 180

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           + I     S   +K VLT  L++P  +  +   N ++ +AE F F  DGS++      +D
Sbjct: 181 YGIDASIASASAIKQVLTSDLSDPGSFANQMPGN-YKLLAEAFSFNTDGSINGASAQSSD 239

Query: 231 MQIEKIVSNY--FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFP-- 286
                +   Y                 YY+ AI  VSS  D L + +LF  L+ +     
Sbjct: 240 DVSFTVYRYYDASGTGGSAPAAAFKSQYYQDAIAGVSSVDDLLGNARLFIYLETAFGLDP 299

Query: 287 -----------LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSS-STKIQQDSQI 334
                      L  +++        Q ND   +    F   NF+ D S   ++ Q  SQ 
Sbjct: 300 SEQSTAILRNVLTSDLSDPNSYANQQTNDAYRALAAAF---NFNTDGSINGSEAQTASQT 356

Query: 335 QKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQ 394
              +  +  N     +    S I  Y+  + KI S+ + +                    
Sbjct: 357 DSTVSSFMTNNTTAVEKYQSSQINFYKTDIAKIASVSDFIKDT-------------GLYG 403

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
           F L A+ ++     +  +  VL S+ S+P SYAN S +    KL  AFNF+ADG      
Sbjct: 404 FVLSAFGIDPSKTSKLTIEKVLESDASNPSSYANMSHNSAYSKLAAAFNFDADGKAKTAS 463

Query: 455 MMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTI 514
             Q   ++   +K Y                   ++   K    + + E  YY   I TI
Sbjct: 464 SAQVNASLVSTIKLYN-----------------SEMGDAKAEKKQTSDEDTYYGNTIGTI 506

Query: 515 HSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
            S +E L NKR++ F L +  +  + +  D L +I  SD  DPKSF N  +++ Y+ +  
Sbjct: 507 KSVDEFLKNKRLVTFALTAFDLQDKALSNDTLRKILTSDPTDPKSFINKPENSAYRSMAV 566

Query: 575 SFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI 634
           +FNF   G+       +VQ    +  T D Y  Q +E+   +++    LALYF+R  P+I
Sbjct: 567 AFNFGTDGKDLTTPTQQVQTRSQMVATTDAYARQTLEENAGDQNEGARLALYFQRLAPSI 626

Query: 635 RNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAA 694
            + Y IL D  L +V    L L    +      +  ++ K +KI D +D +K++ FL   
Sbjct: 627 TSAYSILADKALLQVAQTALGLPTSMSNADIDVQANMITKKLKIADLQDPEKLKKFLARF 686

Query: 695 KAM 697
            AM
Sbjct: 687 SAM 689


>gi|90420304|ref|ZP_01228212.1| putative IMP dehydrogenase/GMP reductase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335638|gb|EAS49388.1| putative IMP dehydrogenase/GMP reductase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 725

 Score =  492 bits (1266), Expect = e-136,   Method: Composition-based stats.
 Identities = 191/746 (25%), Positives = 326/746 (43%), Gaps = 67/746 (8%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ + ++    ++D+ ++    ++ DP+V  E  YYR  I  +STIDEF+ D RL+SYA+
Sbjct: 11  MLSNTLSYQLYTRDM-TRTLDRIAADPVVKREAEYYRTNIHSVSTIDEFMADYRLYSYAM 69

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF----SPPPKVIQS 115
           KA GL +   ++  IKK+LESDLSD KSL N+L+  +Y+ FA+++ F     PP  V Q+
Sbjct: 70  KAHGLEEQIGSKALIKKVLESDLSDSKSLANKLSDERYRTFAKAFSFINTAEPPVLVAQT 129

Query: 116 DIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             Q   +++ Y        +V    +K +   I  I++VD+      L +  L S  I P
Sbjct: 130 VGQTDLVVEAYSDYRTRAGQVHATAAKAYMDGIGAISNVDEFLNSTHLFNVSLASVGIDP 189

Query: 176 KYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEK 235
              S  F++DVLT   A+       + DNR+  +A    F+PDGS+     + ++ +   
Sbjct: 190 SIASRSFIRDVLTGNAADGPA---ANGDNRYADLAAMLAFEPDGSIPAGG-LQSEKEANN 245

Query: 236 IVSNYFNN---TIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
            V  YF                +YY+  I  + +  + + DP+LF +   S+   + E+ 
Sbjct: 246 TVFEYFAKKGLATSEQAAAYQVSYYESEIAKIRTADELVNDPRLFGIALSSVGLSDSEMP 305

Query: 293 ADKF-------------LTLMQENDPIVSQVKYFF-----QINFHRDNS--SSTKIQQDS 332
           +  +             L  M E+ P     K  +     + NF    +       Q D+
Sbjct: 306 SYAWTLITSDPDDPNSDLNQMPEDTPASLARKEKYKLLNERFNFDTQGNLPVGEPAQSDA 365

Query: 333 QIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
             +  +D Y  N +       +     +++ +  + ++   +S                 
Sbjct: 366 AREATVDGYFANYRTATAGNDKIATSLFRVAVSGMSTVRQFVSSSA-------------V 412

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGP 452
             +AL A+ L+     R  +  VL S+PSDP SYAN   +DR +KL  AFNF+  G I  
Sbjct: 413 YDYALKAFGLDPATESRSSIMRVLRSDPSDPSSYANSLNNDRYVKLAAAFNFDDSGKIAA 472

Query: 453 IPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNIN 512
             + Q+     D    YA               S     T    +  I      Y   + 
Sbjct: 473 QRIAQTEANQIDTATRYA--------------GSFGDTPTTAE-SKAITEATTAYKKALL 517

Query: 513 TIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEI 572
           +I S  + ++NK ++NF L++ G+++ ++ +  L  I  SD  DP+SF N   D R  E 
Sbjct: 518 SIVSVNDFVSNKTVVNFALKAYGLEADRLSQKDLVSILTSDPSDPESFVNKSGDRRLIEF 577

Query: 573 ISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIP 632
            +++ F   G +    + ++Q       T D Y  Q +E++    + ++ LALYF+R  P
Sbjct: 578 AAAYAFTPDGGIER-GVHEIQSASDFLSTQDFYLRQTMEEEAGADNESVRLALYFRRLAP 636

Query: 633 NIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLY 692
            + + YEIL D  L  VV   + L    +      + R ++K + +   KD K +E F+ 
Sbjct: 637 ELTSIYEILADPALLTVVQTAVGLPAESSQSNLDLQKRTIEKKLDLETLKDPKGLERFIS 696

Query: 693 AAKAMD-----HQSIDYKKALFSSPN 713
              A+        +     A+  S  
Sbjct: 697 RYLALQEAQSTSTATSPALAILGSSG 722



 Score =  140 bits (353), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 85/463 (18%), Positives = 159/463 (34%), Gaps = 64/463 (13%)

Query: 219 GSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFK 278
           G+       L+     + ++   +       +  +  YY+  I+SVS+  +F+ D +L+ 
Sbjct: 7   GNAGMLSNTLSYQLYTRDMTRTLDRIAADPVVKREAEYYRTNIHSVSTIDEFMADYRLYS 66

Query: 279 MLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKI- 328
              +    L  +I +   +  + E+D   S+             F   F   N++   + 
Sbjct: 67  Y-AMKAHGLEEQIGSKALIKKVLESDLSDSKSLANKLSDERYRTFAKAFSFINTAEPPVL 125

Query: 329 --QQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSA 386
             Q   Q   +++ Y    +        +  K Y   +G I ++D  L+           
Sbjct: 126 VAQTVGQTDLVVEAYSD-YRTRAGQVHATAAKAYMDGIGAISNVDEFLNSTH-------- 176

Query: 387 EEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNA 446
                    +L +  ++     R  +R+VLT N +D       + D+R   L     F  
Sbjct: 177 -----LFNVSLASVGIDPSIASRSFIRDVLTGNAADGP---AANGDNRYADLAAMLAFEP 228

Query: 447 DGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDY 506
           DGSI P   +QS     + V  Y  +K      +  ++                  +V Y
Sbjct: 229 DGSI-PAGGLQSEKEANNTVFEYFAKKGLATSEQAAAY------------------QVSY 269

Query: 507 YTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKD 566
           Y   I  I + +EL+ + R+    L S G+   ++   +   +  SD  DP S  N   +
Sbjct: 270 YESEIAKIRTADELVNDPRLFGIALSSVGLSDSEM-PSYAWTLITSDPDDPNSDLNQMPE 328

Query: 567 N---------RYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEK 617
           +         +YK +   FNFD  G L        Q +   + T D Y            
Sbjct: 329 DTPASLARKEKYKLLNERFNFDTQGNL--PVGEPAQSDAAREATVDGYFANYRTATAGND 386

Query: 618 DPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660
               +L   F+  +  +    + +  S ++    K   L P  
Sbjct: 387 KIATSL---FRVAVSGMSTVRQFVSSSAVYDYALKAFGLDPAT 426


>gi|222085079|ref|YP_002543609.1| hypothetical protein Arad_1171 [Agrobacterium radiobacter K84]
 gi|221722527|gb|ACM25683.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 836

 Score =  445 bits (1145), Expect = e-122,   Method: Composition-based stats.
 Identities = 178/712 (25%), Positives = 305/712 (42%), Gaps = 69/712 (9%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
           S  ++      E  Y+ + I  + T+D+ + + RL +Y L+A+GL     +  F+K++L 
Sbjct: 130 SFTTEATNAQTETTYFSQNISSVKTVDDLLGNSRLKNYVLQAYGLDPTYTSNSFLKQMLT 189

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALE 139
           SDLSDP S VNQ  S   +     ++F+    V  S                        
Sbjct: 190 SDLSDPDSFVNQNGSAADKAIVAEFNFNADGTVKTSTADAD------------------- 230

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
            + Y+  +I  I SV QL  D +L +YV  +F I     +  F             K   
Sbjct: 231 -TTYYENHISTITSVSQLTADPKLFNYVKTAFDIPAYITATQF---------NAAAKDAS 280

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY------------------- 240
            +       +   F FQ DG+++   +  T  QI      Y                   
Sbjct: 281 VAATKGLTDVMAQFNFQSDGTVASGSQAQTSAQISATTDAYATNYKGGPQTLGQMADVMS 340

Query: 241 -----FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADK 295
                  +    V    +  YYK  I S+++  +   D +LF  ++ + + ++ +  A  
Sbjct: 341 AYNSAVPSYTTDVGANDNDLYYKEHIGSITTVDELTSDTRLFDYIKTA-YGIDADTPAVV 399

Query: 296 FLTLMQEND--PIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDD 351
                  +    I        Q NF  D +  S    Q  + I      Y KN Q     
Sbjct: 400 LKNAFSSSSTAAIFGLTDVVSQFNFQADGTLASGDTAQSQTAIDAASTAYMKNYQTSQTS 459

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
                + +YQ  +  +K+ID+  +     +   S +      Q A+ AY ++  ++ + Q
Sbjct: 460 LTTKAVSNYQTRIAAVKTIDDFFATNATADSDTSNDSLPELYQMAMRAYGISPDEMTKTQ 519

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
           ++ +L S+P DP SY N  KD R   L  AFNF++DG + P     S+  I   V  Y++
Sbjct: 520 MKKILESDPYDPKSYVNSLKDTRFTNLAKAFNFDSDGKLKPPVQALSQTQINSYVSEYSS 579

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
           R +        +           +   +      Y+  NI  + S  +LLA+ ++ +++L
Sbjct: 580 RSKIGLTGAELT-----------KATSDAKDAGTYFATNIVKVTSVTDLLADSKLTDYIL 628

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           ++ GID + V    L + F SD  D KSF NT    ++K I+++FNFD  G L++ K+G 
Sbjct: 629 KANGIDPKTVDTATLKKAFASDPSDSKSFINTDDGAQFKSIVNAFNFDTDGNLTNTKLGT 688

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
            Q+   I DT DL+ HQ +E +E E +  + LALYF+R  P+I + Y+I+GD+ L++V++
Sbjct: 689 AQNQGTIADTNDLFLHQTLEDQEGETNTGVQLALYFQRKAPDISSIYDIMGDTALYQVIT 748

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSID 703
               L    + +    + ++L K + ++D +D  KV   L    AM   + +
Sbjct: 749 TTYSLPSSMSSMDVDTQAKLLAKFVDVSDLQDPTKVNKLLQRFSAMYDLANN 800



 Score =  329 bits (843), Expect = 1e-87,   Method: Composition-based stats.
 Identities = 155/690 (22%), Positives = 270/690 (39%), Gaps = 87/690 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI +++    +    +   + V+       +  YY   I  ++ +D+F+ D +L+SYA++
Sbjct: 1   MISTYLGYTVATRNMATTLNQVASQSQSKRQIDYYNANIGKVTNVDDFMGDYQLYSYAME 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP-PKVIQSDIQH 119
           A+GLSDM++A+ F+K++L SDLSD  S  N+L   +Y+ FA +++F        QS  Q 
Sbjct: 61  AYGLSDMTYAKAFMKQVLTSDLSDSTSFANKLTDPRYKEFAAAFNFGTGSSSTAQSSTQE 120

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y QS   +   A  E+ YF +NI  + +VD L  + RL +YVLQ++ + P Y S
Sbjct: 121 DDLIGLYNQSFTTEATNAQTETTYFSQNISSVKTVDDLLGNSRLKNYVLQAYGLDPTYTS 180

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLK +LT  L++P  +  ++     +A+   F F  DG++                  
Sbjct: 181 NSFLKQMLTSDLSDPDSFVNQNGSAADKAIVAEFNFNADGTVKTS--------------- 225

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
                       +D  YY+  I++++S S    DPKLF  ++ + F +   ITA +F   
Sbjct: 226 ---------TADADTTYYENHISTITSVSQLTADPKLFNYVKTA-FDIPAYITATQFNAA 275

Query: 300 MQENDPIVSQ--VKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDD---- 351
            ++     ++       Q NF  D +  S ++ Q  +QI    D Y  N +         
Sbjct: 276 AKDASVAATKGLTDVMAQFNFQSDGTVASGSQAQTSAQISATTDAYATNYKGGPQTLGQM 335

Query: 352 -----KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
                   S +  Y   +G   +          +   +          +   AY ++   
Sbjct: 336 ADVMSAYNSAVPSYTTDVGANDNDLYYKEHIGSITTVDELTSDTRLFDYIKTAYGIDADT 395

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
                L+N  +S      +      D     +   FNF ADG++      QS+  I    
Sbjct: 396 -PAVVLKNAFSS---SSTAAIFGLTD-----VVSQFNFQADGTLASGDTAQSQTAIDAAS 446

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN--- 523
             Y                       Q          V  Y   I  + + ++  A    
Sbjct: 447 TAYMKN-------------------YQTSQTSLTTKAVSNYQTRIAAVKTIDDFFATNAT 487

Query: 524 ----------KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEII 573
                       +    + + GI   ++ +  + +I +SD  DPKS+ N+ KD R+  + 
Sbjct: 488 ADSDTSNDSLPELYQMAMRAYGISPDEMTKTQMKKILESDPYDPKSYVNSLKDTRFTNLA 547

Query: 574 SSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEK-----DPNIALALYFK 628
            +FNFD  G+L  K   +      I+     Y  +        +             YF 
Sbjct: 548 KAFNFDSDGKL--KPPVQALSQTQINSYVSEYSSRSKIGLTGAELTKATSDAKDAGTYFA 605

Query: 629 RTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
             I  + +  ++L DSKL   + K   + P
Sbjct: 606 TNIVKVTSVTDLLADSKLTDYILKANGIDP 635


>gi|15887995|ref|NP_353676.1| hypothetical protein Atu0653 [Agrobacterium tumefaciens str. C58]
 gi|15155605|gb|AAK86461.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 812

 Score =  431 bits (1109), Expect = e-118,   Method: Composition-based stats.
 Identities = 147/718 (20%), Positives = 290/718 (40%), Gaps = 76/718 (10%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           ++ E RYY+  I  ++  D+ +++ R  +Y  + F + + +++   IK ++ SD++DP S
Sbjct: 137 LAEETRYYKAIIGTVTNADQLLRNDRTRAYIFQVFNIDEKTYSYAHIKGLMTSDVNDPNS 196

Query: 88  LVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRK 146
            +NQ     Y                 Q   +   I  D   +    EE    E++   +
Sbjct: 197 YINQNYGAAYNDAVEKLTMKGNIELHAQVTARITAIDTDLAGTGLTAEERTKLEAEKVTR 256

Query: 147 NIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRF 206
             +++  ++ +   +   D  L +       +S                     ++ N+ 
Sbjct: 257 Q-NQLTQLEAVLPPKDQWDAKLAAIKAEQTTLSNAV------------------TQYNKM 297

Query: 207 RAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS--DQNYYKLAINSV 264
             +A  F F+ DG++       T  +++ I  +Y  +     P V+  +++Y++  I S+
Sbjct: 298 AQIANAFEFKNDGTVDAGG-AQTADKLKAITDSYIGSAPRVTPTVATLNRDYFESKIGSI 356

Query: 265 SSFSDFLKDPKLFKMLQLSL--------------FPLNPEITADKFLTLMQENDPIVSQV 310
           ++  + + D +L   ++ +                  +     + ++  M +ND     +
Sbjct: 357 TTVEELMSDARLLNYVRTAFDLNDLTIVPATIKNILTSDLSDPNNYIATMGKNDKRYLAL 416

Query: 311 KYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSI 370
           K  F        ++ T  Q  +Q       Y  +     D      +  ++  + K+ S+
Sbjct: 417 KNAFNFLPDGTLAAGTTPQTTTQTATTTSGYMTHYNDADDAADAKALSLFKSSISKVTSV 476

Query: 371 DNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKS 430
           ++ L                    +AL A  L+   ++   ++ VLTS+  D  SY    
Sbjct: 477 NDFLGTNA-------------VYTYALRAVGLDPAKVNISDIQRVLTSDLQDKKSYVYTL 523

Query: 431 KDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQI 490
           KDDR +KL   FNF  DGS+G   + QS + ++     Y  +K +    ++K        
Sbjct: 524 KDDRYVKLAELFNFTKDGSVGSPILAQSEIELQTMSADYIKKKSAFGTEKDK-------- 575

Query: 491 STQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIF 550
                      +E  Y++  +  I +  E LAN R+  F +ES GID + V ++ L +IF
Sbjct: 576 -------EAAQTEAKYFSGEMQKIKTLSEFLANDRLTKFAMESLGIDPKSVTKEQLQKIF 628

Query: 551 KSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMI 610
            S+L D  S+ N   D  ++ ++++FNFD  G+L H+    +Q    + +T D Y  Q +
Sbjct: 629 TSNLDDKNSYVNKEMDPVFRRLVTAFNFDTEGKLLHEDRSAIQTRRGLYETLDNYLTQTL 688

Query: 611 EKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIR 670
           E +  E++  + LALYFKR      ++Y IL D+ +   +     +           ++ 
Sbjct: 689 ESQAGEENAGVRLALYFKRMAAGTTSYYSILADTAIQNFIKTTFGIPDELGNANVDTQVA 748

Query: 671 ILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQN 728
           ++KK+  I DF+D  KV+  +     M     +             DP    F+   +
Sbjct: 749 MMKKYFDIKDFQDPDKVKKLIARFTIMYDNKQNV-----------ADPIMTLFNGSGS 795



 Score =  371 bits (952), Expect = e-100,   Method: Composition-based stats.
 Identities = 149/682 (21%), Positives = 294/682 (43%), Gaps = 54/682 (7%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ + ++    ++D++S + S VS+  +V  + +YY+E I ++ ++DEF+ + +L+SYA+
Sbjct: 1   MVSTFLSYDLINRDMKSSI-SRVSQQGLVERQTKYYKENIGNVKSVDEFLGNYQLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
            AFGL +M++A+ F+KK+LESDL+D  S  N+L   +Y+ FA S++F+   K +Q+D Q 
Sbjct: 60  DAFGLGEMTYAKAFMKKVLESDLNDQNSFANKLTDERYREFAASFNFTASTKTVQTDAQL 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y  S  +      EE++Y++  I  + + DQL ++ R   Y+ Q F+I  K  S
Sbjct: 120 DKMIGLYDTSITNLNGSLAEETRYYKAIIGTVTNADQLLRNDRTRAYIFQVFNIDEKTYS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
              +K ++T  + +P  Y  ++    +    E    + +  L          +I  I ++
Sbjct: 180 YAHIKGLMTSDVNDPNSYINQNYGAAYNDAVEKLTMKGNIEL----HAQVTARITAIDTD 235

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
                +        +       N ++     L     +     ++      ++      +
Sbjct: 236 LAGTGLTAEERTKLEAEKVTRQNQLTQLEAVLPPKDQWDAKLAAIKAEQTTLSN----AV 291

Query: 300 MQENDPIVSQVKYFFQINFHRDNS-SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK 358
            Q N   ++Q+   F+  F  D +  +   Q   +++ + D Y           + +L +
Sbjct: 292 TQYNK--MAQIANAFE--FKNDGTVDAGGAQTADKLKAITDSY-IGSAPRVTPTVATLNR 346

Query: 359 DY-QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
           DY +  +G I +++ L+S                 L +   A++LN   +    ++N+LT
Sbjct: 347 DYFESKIGSITTVEELMSDAR-------------LLNYVRTAFDLNDLTIVPATIKNILT 393

Query: 418 SNPSDPDSYANKSK--DDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRS 475
           S+ SDP++Y       D R + L +AFNF  DG++      Q+          Y      
Sbjct: 394 SDLSDPNNYIATMGKNDKRYLALKNAFNFLPDGTLAAGTTPQTTTQTATTTSGYMTH--- 450

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
                                +      +  +  +I+ + S  + L    +  + L + G
Sbjct: 451 ----------------YNDADDAADAKALSLFKSSISKVTSVNDFLGTNAVYTYALRAVG 494

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           +D  KV    +  +  SDL+D KS+  T KD+RY ++   FNF   G +    + + +  
Sbjct: 495 LDPAKVNISDIQRVLTSDLQDKKSYVYTLKDDRYVKLAELFNFTKDGSVGSPILAQSEIE 554

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
                  D  K +     E++K+     A YF   +  I+   E L + +L K   + L 
Sbjct: 555 LQTMS-ADYIKKKSAFGTEKDKEAAQTEAKYFSGEMQKIKTLSEFLANDRLTKFAMESLG 613

Query: 656 LSPYFAVLPERKKIRILKKHIK 677
           + P    + + +  +I   ++ 
Sbjct: 614 IDPK--SVTKEQLQKIFTSNLD 633



 Score =   99 bits (247), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 89/227 (39%), Gaps = 15/227 (6%)

Query: 15  QSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFI 74
           +   F T         E +Y+   ++ I T+ EF+ + RL  +A+++ G+   S  ++ +
Sbjct: 565 KKSAFGTEKDKEAAQTEAKYFSGEMQKIKTLSEFLANDRLTKFAMESLGIDPKSVTKEQL 624

Query: 75  KKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH-----------KTII 123
           +KI  S+L D  S VN+     ++    +++F    K++  D                 +
Sbjct: 625 QKIFTSNLDDKNSYVNKEMDPVFRRLVTAFNFDTEGKLLHEDRSAIQTRRGLYETLDNYL 684

Query: 124 QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
               +S   +E   +  + YF++      S   +  D  + +++  +F I  +  +    
Sbjct: 685 TQTLESQAGEENAGVRLALYFKRMAAGTTSYYSILADTAIQNFIKTTFGIPDELGNANVD 744

Query: 184 KDV-LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
             V +     + K +      ++ + +   F    D   +  D I+T
Sbjct: 745 TQVAMMKKYFDIKDF---QDPDKVKKLIARFTIMYDNKQNVADPIMT 788


>gi|115524603|ref|YP_781514.1| hypothetical protein RPE_2596 [Rhodopseudomonas palustris BisA53]
 gi|115518550|gb|ABJ06534.1| protein of unknown function DUF1217 [Rhodopseudomonas palustris
           BisA53]
          Length = 799

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 171/729 (23%), Positives = 292/729 (40%), Gaps = 91/729 (12%)

Query: 7   APFPSKDIQSKLFSTVSKDPI-VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLS 65
             + + ++     +T+ +    V  + RYY  +I  I+T+D+ + + RL +Y   AFG+ 
Sbjct: 116 TSYQTDEMVGLYTATLQQQADAVGEDTRYYNAKIGSIATVDQLLNNDRLRTYVFSAFGID 175

Query: 66  DMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQD 125
           D + +   +K IL SD SDP S +N +             + PP             I  
Sbjct: 176 DGTWSRATMKNILGSDPSDPGSYINTV-------------WGPP---------LDDAIAS 213

Query: 126 YKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
           +  +     + + +   Y  +       +  L     L    +   S      +   +  
Sbjct: 214 FNLAQAESTDASSKIDDYTAQMAQPGADLADLKAKIALEQGRVAKASSDMSGFNKTII-- 271

Query: 186 VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI 245
                               +  +A  F F  DG+L+      TD   +     +  +  
Sbjct: 272 ----------------AIGHYFELASAFEFSTDGTLASGVAAQTDENRKITNEKFIADQP 315

Query: 246 DCVPIVS--DQNYYKLAINSVSSFSDFLKDPKL---------FKMLQLSLFPLNPEITAD 294
              P  +  ++ Y++   +S  +  +   D            F +  L L  L   +T+D
Sbjct: 316 RTSPAAALVEKAYFEQQASSARTVDELFADDAFRMAKFIGVAFGVGTLPLSTLKSILTSD 375

Query: 295 K-------FLTLMQENDPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNC 345
           +       F+ L   N    +++   F  NF +D +  +    Q  +Q    +  Y    
Sbjct: 376 RDVNNASSFVNLAGSNKDAYTRLMNAF--NFKQDGTLDAGVDAQSATQSSATIGRYMTAY 433

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
               +   +   + ++  +  I SI+  +S                   FAL+A  L+  
Sbjct: 434 NDADEASEKLAKQMFKSGVYGITSIEKFVSTPS-------------VYNFALEAVGLDPD 480

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
            +    ++  L S+ SDP SY    KDDR ++L   FNF++ G +    + Q    + + 
Sbjct: 481 SVSATTVKAALKSDLSDPKSYVYTLKDDRYVQLARYFNFDSKGQLTTPLVAQDAAEVTNI 540

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
            K Y   K     A  K+            +      +  YY   I  + S  ELLA+K+
Sbjct: 541 AKDYVIAKTKFASAAEKA-----------GLQEAAEKDALYYKNAIAGVDSVSELLADKK 589

Query: 526 ILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELS 585
           ++NF+L +KG+D +KV  D+L +IF SDL D KSFAN   D R+ EI +SFNFD  G+++
Sbjct: 590 LVNFILVAKGLDPKKVTNDYLRKIFSSDLSDAKSFANKESDLRFAEIAASFNFDKKGKVT 649

Query: 586 HKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSK 645
                  Q    + +T + Y  Q +E ++   +P + LALYF+R  P I + Y+IL D  
Sbjct: 650 RIAATGPQSREQLLETQNNYLQQSLESQQGNTNPGVRLALYFQRKAPEITSAYQILADKA 709

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYK 705
           LF+V      L    A  P  K+ +I++KH+K+ D  D  K+   L     M     D K
Sbjct: 710 LFEVFRTTYSLPDTMANAPIEKQAKIVEKHLKLKDLGDPAKLGRVLSRFAVM----YDLK 765

Query: 706 KALFSSPNQ 714
            +  SSP  
Sbjct: 766 NSQVSSPAL 774


>gi|90423974|ref|YP_532344.1| hypothetical protein RPC_2474 [Rhodopseudomonas palustris BisB18]
 gi|90105988|gb|ABD88025.1| protein of unknown function DUF1217 [Rhodopseudomonas palustris
           BisB18]
          Length = 801

 Score =  413 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 162/746 (21%), Positives = 299/746 (40%), Gaps = 95/746 (12%)

Query: 7   APFPSKDIQSKLFSTVSKDPI-VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLS 65
           + + + ++     +T+ +    V  + RYY  +I  ++T+D+ + D RL  Y   AFG+ 
Sbjct: 116 SSYQTDEMVGLYTATLQRQADAVGEDTRYYNAKIGSVTTVDQLLNDDRLRGYVFSAFGID 175

Query: 66  DMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQD 125
           +   +   ++K+L SD SDP S VN +             + PP            +I  
Sbjct: 176 EDHWSRDTLRKVLSSDSSDPNSYVNAV-------------WGPP---------LDDLIAK 213

Query: 126 YKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
             Q+     +   +   Y  +    +        D                   +   + 
Sbjct: 214 LDQAQLDSSDAKSKIVDYTTQ----LTQPGADLADLN---------------AKIAEQRT 254

Query: 186 VLTLGLANPKKYFIE-SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNT 244
            L    A+   Y    +  + +  +A  F F PDG+L+      TD   +     +  + 
Sbjct: 255 RLGKTAADISSYTGSITAISHYFDLAGAFEFSPDGTLAAGVSAQTDASRKTTNERFITSQ 314

Query: 245 IDCVP--IVSDQNYYKLAINSVSSFSDFLKDP----------KLFKMLQLSLFPLNPEIT 292
               P   + ++ +++  I    +    L  P            F +  L L  +   +T
Sbjct: 315 PRTSPSTALLEKQFFQQKIAGARTVDQLLAAPDAARVASFIGTAFGLGTLPLSTIKSILT 374

Query: 293 ADK-------FLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNC 345
           +D+       ++          +++   F  N      +    Q ++Q    +  Y    
Sbjct: 375 SDRDPNNPNSYVNSAGSKKDAYTRLMKAFNFNQDGTLDAGVDAQSETQTATTVGYYMVAY 434

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
               +   +  I+ ++  +  I SI+  +S                   FAL +  L+  
Sbjct: 435 NDADEASDKLAIQRFRNGVYSITSIEKFVSTPA-------------VYNFALKSVGLDPD 481

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
            +    ++  L S+ S+P SY    KD+R ++L  +FNF++ G +    + Q    + + 
Sbjct: 482 SVSAITVKAALESDLSNPRSYVYTLKDERYVQLARSFNFDSKGHLTTPLVAQDTAEVGNI 541

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
            K Y   K     A +K+            +     ++   Y   I  + S  ELL++K+
Sbjct: 542 AKDYVIAKTKFATAADKA-----------TLQKTAENDAVEYRSKIAGVDSVAELLSDKK 590

Query: 526 ILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELS 585
           ++NF+L +KG+D +KV  D L +I  SDL DPKSFANT  D R+ E+ +SFNFD  G+++
Sbjct: 591 LVNFILVAKGLDPKKVTPDTLKKILSSDLSDPKSFANTASDTRFAELAASFNFDKTGKVA 650

Query: 586 HKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSK 645
              +   Q+   + +T   Y  Q +E ++   +P + LALYF+R  P+I + Y+IL D  
Sbjct: 651 RFVVAGPQNREQLLETQTKYLQQSLEAQQGGANPGVRLALYFQRKAPDITSAYDILADKA 710

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYK 705
           L +VV     L    A  P  ++ +I++K++K+ D  D  ++   L     M     D K
Sbjct: 711 LSEVVRTTYNLPDSMANAPIEQQAKIVEKYLKLKDLSDPAQLAKILSRFSVM----YDVK 766

Query: 706 KALFSSPNQNKDPWNNSFDDPQNNVS 731
            A     +QN+ P          ++S
Sbjct: 767 NA-----SQNQSPALAILTGSGASIS 787


>gi|325292035|ref|YP_004277899.1| hypothetical protein AGROH133_04160 [Agrobacterium sp. H13-3]
 gi|325059888|gb|ADY63579.1| hypothetical protein AGROH133_04160 [Agrobacterium sp. H13-3]
          Length = 812

 Score =  405 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 145/706 (20%), Positives = 278/706 (39%), Gaps = 65/706 (9%)

Query: 25  DPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSD 84
           D  +S E RYY+  I  ++ +D+ +++ R  +Y  + F + + +++   IK ++ SD+ D
Sbjct: 134 DDSLSEETRYYKAIIGTVTNVDQLLQNDRTRAYIFEVFSIDEKTYSYSHIKGLMTSDIDD 193

Query: 85  PKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYF 144
           P S +NQ     Y             ++        T I           E         
Sbjct: 194 PNSYLNQKFGAAYSAAVEKLTTKGNIELHGDVTDRITAIDTALADTTLTAEQRTALETEK 253

Query: 145 RKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDN 204
                ++  ++ +   +      L S +     +S                     S+ N
Sbjct: 254 TTRQDQLTQLEAVLPPKDQWAATLASITAEQTQLSNTV------------------SQYN 295

Query: 205 RFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS--DQNYYKLAIN 262
               MA+ F F  DG+++   +  T   ++ +   Y  +     P V+  +++Y++  I 
Sbjct: 296 TMAQMAQAFEFANDGTVAAG-QAQTADNVKILTQAYVGSAPRVTPTVATLNRDYFESKIG 354

Query: 263 SVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI-------------VSQ 309
           S+ +  + + DP+L   ++++ F LN     +  +  +  +D                  
Sbjct: 355 SIKTVDELMADPRLVNYIKVA-FDLNDLTIVNATIENILTSDLSDPNNYIAKFGNGDKRY 413

Query: 310 VKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKI 367
           +      NF  D +    T  Q  +Q     + Y  +     +   ++ +K ++  +  +
Sbjct: 414 IALREAFNFKADGTLPDGTAPQTTTQTVTTTNGYMNHYNDKDEAADENALKLFKSDIANV 473

Query: 368 KSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYA 427
           KS+ + L                    +AL A  L+   ++   +R  LTS+  D  SY 
Sbjct: 474 KSVADFLESSA-------------VYTYALKAVGLDPTKVNIADVRRALTSDLLDKKSYV 520

Query: 428 NKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSM 487
              KDDR +KL   FNF +DGS G   + QS L I+     Y  +K +    + K     
Sbjct: 521 YALKDDRYVKLAELFNFKSDGSPGSPVLAQSELEIQSMSVDYIKKKSAFGTDQEKEAAKK 580

Query: 488 EQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC 547
           E                 ++   +  + +  + L N R+  F +ES GID  KV +D L 
Sbjct: 581 EAE---------------FFRSELQKVKTLSDFLGNDRLTKFAMESLGIDPTKVTKDQLQ 625

Query: 548 EIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKH 607
           ++F S+L D  S+ N   D  ++ ++++FNFD  G +  +    +Q    + +T D Y  
Sbjct: 626 KMFTSNLDDKDSYLNKEMDPAFRRLVTAFNFDTDGNILREDRSSIQTRRGLYETLDNYLT 685

Query: 608 QMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERK 667
           Q +E +  E++  + LALYFKR      ++Y IL D+ +   ++    +           
Sbjct: 686 QTLETQAGEENAGVRLALYFKRMAAGTTSYYSILADTAIQNFITTTFGIPDELGNAGVDT 745

Query: 668 KIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPN 713
           ++ ++KK+  I DF+D  KV+  +     M     +    +    N
Sbjct: 746 QVAMMKKYFDIEDFQDPDKVKKLIARFTIMYDDKQNTTNPIMMLFN 791



 Score =  380 bits (976), Expect = e-103,   Method: Composition-based stats.
 Identities = 157/688 (22%), Positives = 309/688 (44%), Gaps = 60/688 (8%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ + ++    ++D+++ + S VS+  IV  + +YY+E I ++ ++DEF+ + +L+SYA+
Sbjct: 1   MVSTFLSYDLINRDMKASI-SRVSQQGIVERQTKYYKENIGNVKSVDEFLNNYQLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
            AFGL +M++A+ F+KK+LESDL+D  S  N+L   +Y+ FA S++F+     +Q++ Q 
Sbjct: 60  DAFGLGEMTYAKAFMKKVLESDLNDQNSFANKLTDERYREFAASFNFTQSTTTVQTEAQL 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y  S  + ++   EE++Y++  I  + +VDQL ++ R   Y+ + FSI  K  S
Sbjct: 120 DKMIGLYDTSITNLDDSLSEETRYYKAIIGTVTNVDQLLQNDRTRAYIFEVFSIDEKTYS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
              +K ++T  + +P  Y  +     + A  E  +    G++     +    +I  I + 
Sbjct: 180 YSHIKGLMTSDIDDPNSYLNQKFGAAYSAAVE--KLTTKGNIELHGDVT--DRITAIDTA 235

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
             + T+      + +       + ++     L     +     S+     +++     T+
Sbjct: 236 LADTTLTAEQRTALETEKTTRQDQLTQLEAVLPPKDQWAATLASITAEQTQLSN----TV 291

Query: 300 MQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKD 359
            Q N   ++Q+   F+  F  D + +    Q +   K+L              + +L +D
Sbjct: 292 SQYN--TMAQMAQAFE--FANDGTVAAGQAQTADNVKILTQAYVGSAPRVTPTVATLNRD 347

Query: 360 Y-QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
           Y +  +G IK++D L++                 + +   A++LN   +    + N+LTS
Sbjct: 348 YFESKIGSIKTVDELMADPR-------------LVNYIKVAFDLNDLTIVNATIENILTS 394

Query: 419 NPSDPDSYANKS--KDDRLIKLNHAFNFNADGSI----GPIPMMQSRLTIRDNVKHYANR 472
           + SDP++Y  K    D R I L  AFNF ADG++     P    Q+  T    + HY ++
Sbjct: 395 DLSDPNNYIAKFGNGDKRYIALREAFNFKADGTLPDGTAPQTTTQTVTTTNGYMNHYNDK 454

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             +  +   K F S                       +I  + S  + L +  +  + L+
Sbjct: 455 DEAADENALKLFKS-----------------------DIANVKSVADFLESSAVYTYALK 491

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G+D  KV    +     SDL D KS+    KD+RY ++   FNF   G      + + 
Sbjct: 492 AVGLDPTKVNIADVRRALTSDLLDKKSYVYALKDDRYVKLAELFNFKSDGSPGSPVLAQS 551

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           +         D  K +     ++EK+     A +F+  +  ++   + LG+ +L K   +
Sbjct: 552 ELEIQSMS-VDYIKKKSAFGTDQEKEAAKKEAEFFRSELQKVKTLSDFLGNDRLTKFAME 610

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKIND 680
            L + P    + + +  ++   ++   D
Sbjct: 611 SLGIDPT--KVTKDQLQKMFTSNLDDKD 636



 Score = 92.6 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/183 (14%), Positives = 73/183 (39%), Gaps = 11/183 (6%)

Query: 15  QSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFI 74
           +   F T  +      E  ++R  ++ + T+ +F+ + RL  +A+++ G+      +  +
Sbjct: 565 KKSAFGTDQEKEAAKKEAEFFRSELQKVKTLSDFLGNDRLTKFAMESLGIDPTKVTKDQL 624

Query: 75  KKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH-----------KTII 123
           +K+  S+L D  S +N+     ++    +++F     +++ D                 +
Sbjct: 625 QKMFTSNLDDKDSYLNKEMDPAFRRLVTAFNFDTDGNILREDRSSIQTRRGLYETLDNYL 684

Query: 124 QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
               ++   +E   +  + YF++      S   +  D  + +++  +F I  +  +    
Sbjct: 685 TQTLETQAGEENAGVRLALYFKRMAAGTTSYYSILADTAIQNFITTTFGIPDELGNAGVD 744

Query: 184 KDV 186
             V
Sbjct: 745 TQV 747


>gi|319781688|ref|YP_004141164.1| hypothetical protein Mesci_1961 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167576|gb|ADV11114.1| protein of unknown function DUF1217 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 603

 Score =  391 bits (1003), Expect = e-106,   Method: Composition-based stats.
 Identities = 145/617 (23%), Positives = 243/617 (39%), Gaps = 66/617 (10%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               ++ V   ++KY+  NI K+ S+D   K+ RL  Y ++++ +     +  F+   L 
Sbjct: 20  DRIEQQPVVDRDTKYYLDNITKVKSIDDFVKNDRLFKYAMKAYGLEDMAYAKAFMVKALK 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+++P  +  +  D R+      F F  +G+ +     + +   + + SNY        
Sbjct: 80  EGVSDPNSFANKLTDKRYAEFVRAFNFAANGTSTT----VYNKAQQLVTSNYALQVQIGA 135

Query: 249 PI------VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
                    S+  YY   I  V S  D + D +L     ++ F L+        +  M E
Sbjct: 136 SQKGLPYYQSETAYYVTNIAKVKSVDDLMGDSRLLTY-AMAAFGLDAATEPAATVKAMLE 194

Query: 303 ND-----------PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDD 351
                        P  S  K+    +F +     T ++ D Q Q +   Y     +   +
Sbjct: 195 GGVSDPDSPANKLPDKSYAKFVAAFDFAQYG-DQTTMRDDVQ-QAVPKGYMAGAGLTLVE 252

Query: 352 KMQSLIKD----YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
                IK     Y   + K+ SIDNL++ K               L FA+ +Y L+    
Sbjct: 253 PSAQYIKGEADYYAANISKVTSIDNLMADKR-------------LLTFAMASYGLDASTE 299

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
              Q+R +L    SDP+S ANK  D R      AFNF   G              +D  K
Sbjct: 300 TPQQIRTMLEGGVSDPESPANKLTDKRYANFVTAFNFAQYGDQTTSR----DEVQKDTPK 355

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
            Y         A N  +               I SE  YY  N+  + S ++L+AN R+ 
Sbjct: 356 IYTTESALGLIAPNADY---------------IKSETAYYLANVTNVKSVDDLMANSRLY 400

Query: 528 NFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK 587
           N++L + G+D     +D +  +    ++D  S AN   +  Y  + ++FNF+ +GE +  
Sbjct: 401 NYVLSAYGLDPATESKDLIRNVLAGGIRDADSVANKMTNKAYAGLAAAFNFEQYGEAATT 460

Query: 588 KIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLF 647
                Q       T D Y  Q +E+   + +  + LALYF R  P I + Y++L D+ L 
Sbjct: 461 INPAQQP------TVDKYMRQTLEEDAGQTNQGVRLALYFDRKAPTITSWYDVLADTALA 514

Query: 648 KVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKA 707
            VV   L L   FA     K+ ++ ++ + I+DF D +K+  FL    +M   +     A
Sbjct: 515 SVVRTVLGLPDSFATADVDKQAQLFEQKLDISDFSDPEKLGKFLTRFTSMYEINNPTSSA 574

Query: 708 LFSSPNQNKDPWNNSFD 724
           + S       P      
Sbjct: 575 VTSVSVLFAQPLTVGIS 591



 Score =  291 bits (744), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 121/591 (20%), Positives = 223/591 (37%), Gaps = 66/591 (11%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +  +    ++DI SK    + + P+V  + +YY + I  + +ID+F+K+ RLF YA+
Sbjct: 1   MLNTFTSYQLITRDI-SKSIDRIEQQPVVDRDTKYYLDNITKVKSIDDFVKNDRLFKYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+ K L+  +SDP S  N+L   +Y  F R+++F+          + 
Sbjct: 60  KAYGLEDMAYAKAFMVKALKEGVSDPNSFANKLTDKRYAEFVRAFNFAANGTSTTVYNKA 119

Query: 120 KTIIQDYKQSHQHKEEVAL------EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
           + ++                      E+ Y+  NI K+ SVD L  D RLL Y + +F +
Sbjct: 120 QQLVTSNYALQVQIGASQKGLPYYQSETAYYVTNIAKVKSVDDLMGDSRLLTYAMAAFGL 179

Query: 174 TPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR--DKILTDM 231
                    +K +L  G+++P     +  D  +      F F   G  +    D      
Sbjct: 180 DAATEPAATVKAMLEGGVSDPDSPANKLPDKSYAKFVAAFDFAQYGDQTTMRDDVQQAVP 239

Query: 232 QIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEI 291
           +     +           I  + +YY   I+ V+S  + + D +L     ++ + L+   
Sbjct: 240 KGYMAGAGLTLVEPSAQYIKGEADYYAANISKVTSIDNLMADKRLLT-FAMASYGLDAST 298

Query: 292 TADKFLTLMQEND-----------PIVSQVKYFFQINFHRDN---SSSTKIQQDSQIQKM 337
              + +  M E                    +    NF +     +S  ++Q+D+     
Sbjct: 299 ETPQQIRTMLEGGVSDPESPANKLTDKRYANFVTAFNFAQYGDQTTSRDEVQKDTPKIYT 358

Query: 338 LDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFAL 397
            +           D ++S    Y   +  +KS+D+L++                   + L
Sbjct: 359 TESALGLIAPNA-DYIKSETAYYLANVTNVKSVDDLMANSR-------------LYNYVL 404

Query: 398 DAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQ 457
            AY L+     +D +RNVL     D DS ANK  +     L  AFNF   G         
Sbjct: 405 SAYGLDPATESKDLIRNVLAGGIRDADSVANKMTNKAYAGLAAAFNFEQYGEAATTINPA 464

Query: 458 SRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSF 517
            + T+   ++                               +      Y+     TI S+
Sbjct: 465 QQPTVDKYMRQTLEE--------------------DAGQTNQGVRLALYFDRKAPTITSW 504

Query: 518 EELLANKRILNFLLESKGIDS-------QKVREDFLCEIFKSDLKDPKSFA 561
            ++LA+  + + +    G+          K  + F  ++  SD  DP+   
Sbjct: 505 YDVLADTALASVVRTVLGLPDSFATADVDKQAQLFEQKLDISDFSDPEKLG 555


>gi|86356543|ref|YP_468435.1| hypothetical protein RHE_CH00897 [Rhizobium etli CFN 42]
 gi|86280645|gb|ABC89708.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 1110

 Score =  368 bits (945), Expect = 2e-99,   Method: Composition-based stats.
 Identities = 162/681 (23%), Positives = 284/681 (41%), Gaps = 58/681 (8%)

Query: 29   SCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSL 88
            +    ++   I +++ +D+ + D    SY   +  ++D           L S L DP + 
Sbjct: 453  AANAAHFNSMIGNVTNVDDIMSDPVAVSYLRTSMQIADSVSDAT-----LRSFLVDPAAA 507

Query: 89   VNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNI 148
              Q     Y      ++F     V                        A + + Y++  I
Sbjct: 508  SAQ----GYSDVHDLFNFKTDGSVAT------LYATQSAAQSASTASKADDAAVYYQATI 557

Query: 149  HKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRA 208
              I++VDQL  DRRL +++  ++ I P  +S   L+ +LT           +S    +  
Sbjct: 558  AGISNVDQLLSDRRLNNFIRNAYGI-PSTVSDVDLRAILTD----------QSGTGTYAD 606

Query: 209  MAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFS 268
            +A  F F+ DGSL       T  QI          T   +   +  + Y   +  +S+  
Sbjct: 607  VAAAFNFKADGSLEDGMAAQTAAQI----------TNTKIAATARTDDYSARVARISNVD 656

Query: 269  DFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS-- 325
            D + DP +   L+ +         AD K +                   NF  D S    
Sbjct: 657  DLIADPAITNFLKSTYNLPFDITDADLKSILTDATAAAAAGYSDLNADFNFAADGSLPVV 716

Query: 326  TKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL---------PLGKIKSIDNLLSG 376
            + IQ   Q Q   D Y        D+ ++ +  +Y+              +K++++ L  
Sbjct: 717  SSIQTADQAQTTNDNYMARYDDERDEAIEEVADNYKSMMADSSSLLNFSDVKTVNDFLRT 776

Query: 377  KCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLI 436
                +   S +        AL A+ L  QD+ R  +R +LTS+  DPD Y    KD+R+ 
Sbjct: 777  NRSADFTKSNDNLPDLYHVALQAFGLTDQDVPRSMMRKILTSDAYDPDGYIASLKDERIT 836

Query: 437  KLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRI 496
             L  AFNF  DG          + T+      Y      +  A             + + 
Sbjct: 837  NLARAFNFGPDGKAASPLQALPQATMAKYATDYKAHVTMLLKAGP----------VKDKA 886

Query: 497  NLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKD 556
            + +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  D
Sbjct: 887  SKDATAEVDYFAKGMAKVQSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDD 946

Query: 557  PKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEE 616
             KS+ NT  D R+K+I+++FNFD  G L+  KIG +Q+    ++T +LY  Q +E ++ E
Sbjct: 947  KKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGAIQNKAAEENTQELYIKQTLETQQGE 1006

Query: 617  KDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHI 676
             +  + LALYF R  P+I + Y ILGD  L++V++    L    + +   K+  ++ + +
Sbjct: 1007 SNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVAKQADLINRFV 1066

Query: 677  KINDFKDSKKVEDFLYAAKAM 697
            K++D +D KKV+  L    AM
Sbjct: 1067 KLDDLQDPKKVDKLLRRFTAM 1087



 Score =  363 bits (930), Expect = 1e-97,   Method: Composition-based stats.
 Identities = 164/723 (22%), Positives = 294/723 (40%), Gaps = 122/723 (16%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +A        +   + V+    V  + +YY + I  +  +D+F+ D RL+SYA+K
Sbjct: 1   MITASLAYTILSKDMTSSLNKVAAQATVKKDAQYYADNINKVKDVDDFLGDYRLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQED 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S 
Sbjct: 121 ELIGLYKQSFVDADKAAATESTYYSNNIDSVQTVDDLVDNARLRTYVLKAFKIDPTYASK 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   I+  Y
Sbjct: 181 DFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVN--GSAQTATQKASIIETY 238

Query: 241 FNNTIDCV---------------PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
             N+   +                   +Q YY   I ++++  D + D +L   ++ + +
Sbjct: 239 TLNSQSVIIDNSVGSDVVYVSKTAAEYNQAYYTAKIGTITNVDDLVADSRLTSYIKTA-Y 297

Query: 286 PLNPEITADKFLTLMQENDPIVSQVKYFFQ----INFHRDNSSSTK--IQQDSQIQKMLD 339
            +  + TA    T++   DP  +Q+  F       NF  D ++ST    Q   Q  K+ D
Sbjct: 298 SMGADFTAAALRTVL--TDPGYAQLMGFTNVYNAFNFKADGTTSTTARAQTIDQSNKLKD 355

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
                          +           I ++D+LL+               +  ++  DA
Sbjct: 356 AAASTANYYSVTSRST----------SITNVDDLLADS-------------VLARYIKDA 392

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           Y L        +L+++LT    D      +   D    LN  FNF ADGSI    +    
Sbjct: 393 YGLGT-SFSNAELKSILT----DSTYATAQGHAD----LNADFNFQADGSINGSMIQTD- 442

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                                          + +K    +  +   ++   I  + + ++
Sbjct: 443 -------------------------------AQRKSTTDKSAANAAHFNSMIGNVTNVDD 471

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
           ++++   +++L       S ++ +       +S L DP + +       Y ++   FNF 
Sbjct: 472 IMSDPVAVSYLRT-----SMQIADSVSDATLRSFLVDPAAASAQ----GYSDVHDLFNFK 522

Query: 580 IHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYE 639
             G ++                  LY  Q   +           A+Y++ TI  I N  +
Sbjct: 523 TDGSVAT-----------------LYATQSAAQSASTASKADDAAVYYQATIAGISNVDQ 565

Query: 640 ILGDSKLFKVVSKKLKLSPYFAVLPE------RKKIRILKKHIKINDFKDSKKVEDFLYA 693
           +L D +L   +     +    + +        +             +FK    +ED + A
Sbjct: 566 LLSDRRLNNFIRNAYGIPSTVSDVDLRAILTDQSGTGTYADVAAAFNFKADGSLEDGMAA 625

Query: 694 AKA 696
             A
Sbjct: 626 QTA 628


>gi|241203339|ref|YP_002974435.1| hypothetical protein Rleg_0592 [Rhizobium leguminosarum bv. trifolii
            WSM1325]
 gi|240857229|gb|ACS54896.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
            trifolii WSM1325]
          Length = 1111

 Score =  368 bits (943), Expect = 3e-99,   Method: Composition-based stats.
 Identities = 161/711 (22%), Positives = 284/711 (39%), Gaps = 62/711 (8%)

Query: 16   SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
                   S     +    ++   I +++ +D+ + D    SY   +  ++D   ++  ++
Sbjct: 440  QTAAQRKSTTDKSAANAAHFNSMIGNVTNVDDIMSDAVAVSYIRNSMQIADSV-SDATLR 498

Query: 76   KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEE 135
              L    +             Y      ++F     V                       
Sbjct: 499  TFLVDRTAASA--------QGYSDVHDLFNFKSDGSVPT------LYASQSATQSASTTS 544

Query: 136  VALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPK 195
             A + + Y++  I  I++VDQL  D++L ++V  +F I      +  L+++LT       
Sbjct: 545  KASDAAVYYQATIAGISNVDQLLADQKLNNFVRNAFGIPSTVTDVA-LRNILTD------ 597

Query: 196  KYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN 255
                +S    +  +A  F F+ DG+L    +  T  QI          T D         
Sbjct: 598  ----QSGTGTYADVAGAFNFKADGTLEDGLQAQTATQISSTKFAAEARTDD--------- 644

Query: 256  YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFF 314
             Y   + ++++  D L D  +   L+ +         AD K +                 
Sbjct: 645  -YSARMATIANVDDLLADSAITNFLKSTYNLPFDISDADLKSILTDATAAAAAGHADLNA 703

Query: 315  QINFHRDNSSS--TKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL---------P 363
              NF  D S    + +Q   Q Q   D Y        D+ +  +  +YQ           
Sbjct: 704  DFNFAADGSLPVVSSVQTADQAQTTNDNYAARYDDERDEALDEVASNYQKLMADSSSLLN 763

Query: 364  LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
               +KS+++ L      +   S +        AL A+ L  QD+ R  +R VLTS+  DP
Sbjct: 764  FSDVKSVNDFLRSNSAADFSKSNDNLPDLYHVALQAFGLTDQDVPRSMMRKVLTSDAYDP 823

Query: 424  DSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKS 483
            D Y    KD+R+  L  AFNF  DG            T+      Y +    +       
Sbjct: 824  DGYIASLKDERITNLARAFNFGPDGKAASPFQALPDATLAKYATDYKSHITML------- 876

Query: 484  FNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE 543
               M+    + +   +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +
Sbjct: 877  ---MKDGPVKDKAAKDATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDK 933

Query: 544  DFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
              L +IF SD  D KS+ NT  D R+++I+++FNFD  G L+  KIG +Q+    + T +
Sbjct: 934  ATLKKIFTSDPDDKKSYLNTKADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEEHTQE 993

Query: 604  LYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVL 663
            LY  Q +E ++ E +  + LALYF R  P+I + Y ILGD  L++V++    L    + +
Sbjct: 994  LYVQQTMEAQQGESNDGVRLALYFARKAPSITSIYSILGDKALYQVITTAYNLPSQISGM 1053

Query: 664  PERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQ 714
               K+  +L + +K+ D +D KKV+  L    AM     D + A   SP  
Sbjct: 1054 DVTKQRDLLSRFVKLEDLQDPKKVDKLLRRFTAM----YDVQNAAQQSPAL 1100



 Score =  361 bits (925), Expect = 3e-97,   Method: Composition-based stats.
 Identities = 161/731 (22%), Positives = 293/731 (40%), Gaps = 122/731 (16%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +A        +   + V+    V  + +YY + I  ++++D+F+ D +L+SYA+K
Sbjct: 1   MITASLAYTILSRDMTSSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNEPAKDVQTDAQED 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  YKQS    ++ A  ES Y+   I  + +VD L  + RL  YVL++F I P Y S 
Sbjct: 121 DLIGLYKQSFIDADKAASAESSYYGTAIDGVTTVDDLVNNTRLRTYVLKTFKIDPTYASK 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++  Y
Sbjct: 181 DFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFGFNADGTVN--GTAQTAAQKASVIETY 238

Query: 241 FNNTIDCV---------------PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
             N+   +                   ++ YY   I ++++  D + D +L   +  + +
Sbjct: 239 TLNSQSVIIDNSVGSDVYYVGKTAADYNKAYYTAKIGTITNVDDLVADKRLTSYITTA-Y 297

Query: 286 PLNPEITADKFLTLMQENDPIVSQVKYFFQ----INFHRDNSSSTK--IQQDSQIQKMLD 339
            +  + TA    T++   DP  +Q+  F       NF  D S+S+   +Q   Q   +  
Sbjct: 298 SMGADFTAAALRTVL--TDPGYAQLMGFTNVYNAFNFKADGSTSSTARVQTVDQANSLQA 355

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
                                      I ++D LL+               +  ++  DA
Sbjct: 356 AASGTKNYYTVTSQS----------SGITNVDALLADN-------------VLARYIKDA 392

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           Y L         L+++LT    D    A +   D    LN  FNF ADGSI    +    
Sbjct: 393 YGLGT-SFSNADLKSILT----DSTYAAAQGHAD----LNADFNFQADGSINGSVI---- 439

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                                       +  + +K    +  +   ++   I  + + ++
Sbjct: 440 ----------------------------QTAAQRKSTTDKSAANAAHFNSMIGNVTNVDD 471

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
           ++++   ++++       S ++ +       ++ L D  + +       Y ++   FNF 
Sbjct: 472 IMSDAVAVSYIRN-----SMQIADSVSDATLRTFLVDRTAASAQ----GYSDVHDLFNFK 522

Query: 580 IHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYE 639
             G +                   LY  Q   +           A+Y++ TI  I N  +
Sbjct: 523 SDGSVPT-----------------LYASQSATQSASTTSKASDAAVYYQATIAGISNVDQ 565

Query: 640 ILGDSKLFKVVSKKLKLSPYFA------VLPERKKIRILKKHIKINDFKDSKKVEDFLYA 693
           +L D KL   V     +           +L ++             +FK    +ED L A
Sbjct: 566 LLADQKLNNFVRNAFGIPSTVTDVALRNILTDQSGTGTYADVAGAFNFKADGTLEDGLQA 625

Query: 694 AKAMDHQSIDY 704
             A    S  +
Sbjct: 626 QTATQISSTKF 636


>gi|116250732|ref|YP_766570.1| hypothetical protein RL0958 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115255380|emb|CAK06455.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 1109

 Score =  367 bits (941), Expect = 5e-99,   Method: Composition-based stats.
 Identities = 163/731 (22%), Positives = 297/731 (40%), Gaps = 122/731 (16%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +A        +   + V+    V  + +YY + I  +  +D+F+ D +L+SYA+K
Sbjct: 1   MISASLAYTILSRDMTSSLNKVASQATVKKDAQYYADHINKVENVDDFLGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQED 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F+I P Y S 
Sbjct: 121 DLIGLYKQSFVDADKAASAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFNIDPTYASK 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++ +Y
Sbjct: 181 DFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASVIESY 238

Query: 241 FNNTID---------------CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
             N+                       ++ YY   I ++++  D + D +L   +  + +
Sbjct: 239 TLNSQSVIIDNSVGSDVYYVGQTAADYNKAYYTAKIGTITNVDDLVADKRLTSYITTA-Y 297

Query: 286 PLNPEITADKFLTLMQENDPIVSQVKYFFQ----INFHRDNSSSTK--IQQDSQIQKMLD 339
            +  + TA    T++   DP  +Q+  F       NF  D S+S+   +Q   Q   + +
Sbjct: 298 SMGADFTAAALRTVL--TDPGYAQLMGFTNVYNAFNFKADGSASSTARVQTVDQANSLKN 355

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
                          +           I ++D+LL+               +  ++  DA
Sbjct: 356 AATMTGNYYTTTSQST----------GITNVDDLLADN-------------VLARYIKDA 392

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           Y L         L+N+LT    D    A +   D    LN  FNF ADGSI         
Sbjct: 393 YGLGTD-FSNADLKNILT----DSAYAAAQGHAD----LNADFNFQADGSING------- 436

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
             I+   +  +   +S  +A +                         +   I  + + ++
Sbjct: 437 SVIQTAAQRKSTTDKSAVNAAH-------------------------FNSMIGNVTNVDD 471

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
           ++++   ++++       S ++ +       ++ L D  + +       Y ++   FNF 
Sbjct: 472 IMSDAVAVSYIRN-----SMQIADSVSDATLRTFLVDRTAASAQ----GYSDVHDLFNFK 522

Query: 580 IHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYE 639
             G ++                  LY  Q   +           A+Y++ TI  I N  +
Sbjct: 523 SDGSIAT-----------------LYASQTATQSASTTSKADNAAVYYQSTIAGISNVDQ 565

Query: 640 ILGDSKLFKVVSKKLKLSPYFAVLPE------RKKIRILKKHIKINDFKDSKKVEDFLYA 693
           +L D KL   V     +    + +        +             +FK    +ED + A
Sbjct: 566 LLADQKLNNFVRNAYGIPSTVSDVDLRAILTDQSGTGTYADVAAAFNFKADGTLEDGMAA 625

Query: 694 AKAMDHQSIDY 704
             A    S  +
Sbjct: 626 QTATQISSTKF 636



 Score =  363 bits (932), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 155/695 (22%), Positives = 279/695 (40%), Gaps = 62/695 (8%)

Query: 32   ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
              ++   I +++ +D+ + D    SY   +  ++D   ++  ++  L    +        
Sbjct: 456  AAHFNSMIGNVTNVDDIMSDAVAVSYIRNSMQIADSV-SDATLRTFLVDRTAASA----- 509

Query: 92   LNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKI 151
                 Y      ++F     +                        A   + Y++  I  I
Sbjct: 510  ---QGYSDVHDLFNFKSDGSIAT------LYASQTATQSASTTSKADNAAVYYQSTIAGI 560

Query: 152  NSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAE 211
            ++VDQL  D++L ++V  ++ I P  +S   L+ +LT           +S    +  +A 
Sbjct: 561  SNVDQLLADQKLNNFVRNAYGI-PSTVSDVDLRAILTD----------QSGTGTYADVAA 609

Query: 212  NFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFL 271
             F F+ DG+L       T  QI          T D          Y   ++++S+  D L
Sbjct: 610  AFNFKADGTLEDGMAAQTATQISSTKFAATARTDD----------YSARMSTISNVDDLL 659

Query: 272  KDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS--TKI 328
             D  +   L+ +         AD K +                   NF  D S    + +
Sbjct: 660  ADSAITNFLKSTYNLPFNISDADLKSILTDATAAAAAGHADLNADFNFAADGSLPVVSSV 719

Query: 329  QQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL---------PLGKIKSIDNLLSGKCQ 379
            Q   Q Q   D Y        D+ +  +  +YQ              + S+++ L     
Sbjct: 720  QTADQAQTTNDNYAARYDDERDEAIDEVASNYQKLMADSSSLLNFSDVNSVNDFLRSNSA 779

Query: 380  LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
             +   S +        AL A+ L  Q++ R  +R +LTS+  DPD Y    KD+R+  L 
Sbjct: 780  ADFSKSNDNLPDLFHVALQAFGLTDQEVSRSMMRKILTSDAYDPDGYVASLKDERITNLA 839

Query: 440  HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
             AFNF  DG            T+      Y +    +          M+    + +   +
Sbjct: 840  RAFNFGPDGKAASPFQALPDATMAKYATDYRSHITML----------MKDGPVKDKAAKD 889

Query: 500  INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
              +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  D KS
Sbjct: 890  ATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKS 949

Query: 560  FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            + N   D R+++I+++FNFD  G L+  KIG +Q+    + T +LY  Q +E ++ E + 
Sbjct: 950  YLNATADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEEHTQELYVQQTMEAQQGESND 1009

Query: 620  NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
             + LALYF R   +I + Y ILGD  L++V++    L    + +   K+  ++ + +K+ 
Sbjct: 1010 GVRLALYFSRKASSITSIYGILGDKALYQVITTAYSLPSQISGMDVAKQADLINRFVKLE 1069

Query: 680  DFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQ 714
            D +D KKV+  L    AM     D + A   SP  
Sbjct: 1070 DLQDPKKVDKLLRRFTAM----YDVQNATQQSPAL 1100



 Score = 99.2 bits (245), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/167 (19%), Positives = 70/167 (41%), Gaps = 11/167 (6%)

Query: 31   EERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
            E  Y+ + +  + ++D+F+ D RL    LKA  L    + +  +KKI  SD  D KS +N
Sbjct: 893  EVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLN 952

Query: 91   QLNSLKYQYFARSYDFSPPPKVIQSDI-----------QHKTIIQDYKQSHQHKEEVALE 139
                 ++Q    +++F     + ++ I             +  +Q   ++ Q +    + 
Sbjct: 953  ATADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEEHTQELYVQQTMEAQQGESNDGVR 1012

Query: 140  ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
             + YF +    I S+  +  D+ L   +  ++S+  +   +   K  
Sbjct: 1013 LALYFSRKASSITSIYGILGDKALYQVITTAYSLPSQISGMDVAKQA 1059


>gi|327188120|gb|EGE55342.1| hypothetical protein RHECNPAF_944004 [Rhizobium etli CNPAF512]
          Length = 1111

 Score =  366 bits (940), Expect = 7e-99,   Method: Composition-based stats.
 Identities = 163/729 (22%), Positives = 296/729 (40%), Gaps = 122/729 (16%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +A        +   + V+    V  + +YY + I  +  +D+F+ D +L+SYA+K
Sbjct: 1   MITASLAYSILSKDMTSSLNKVASQATVKKDAQYYADHINKVKDVDDFLGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPDKDVQTDAQED 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S 
Sbjct: 121 DLIGLYKQSFVDADKAAAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYASK 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++  Y
Sbjct: 181 DFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASVIETY 238

Query: 241 FNNTIDCV---------------PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
             N+   +                   ++ YY   I ++++  D + D +L   ++ + +
Sbjct: 239 TLNSQSVIIDNSVGSDVVYVSKTAADYNKAYYTAKIGTITNVDDLVADARLTSYIKTA-Y 297

Query: 286 PLNPEITADKFLTLMQENDPIVSQVKYFFQ----INFHRDNSSSTK--IQQDSQIQKMLD 339
            +  + TA     ++   DP  +Q+  F       NF  D S+ST    Q   Q  K+  
Sbjct: 298 SMGADFTAPALRMVL--TDPSYAQLMGFTNVYNAFNFKADGSTSTTARAQTIDQANKLAS 355

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
                                      I ++D+LL+               +  ++  DA
Sbjct: 356 AASSTANYYSVTSQS----------SGITNVDDLLADS-------------VMARYIKDA 392

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           Y L + +    +L+N+LT       SYA          LN  FNFNADGSI    +    
Sbjct: 393 YGLGV-NFSNAELKNILT-----DSSYAAAQGQ---AGLNADFNFNADGSINGSVI---- 439

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                                       +  + +K    +  +   ++   I  + + ++
Sbjct: 440 ----------------------------QTAAQRKSTTDKSAANAAHFNAMIGNVTNVDD 471

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
           ++++   +++L       S ++ +       ++ L DP + +       Y ++   FNF 
Sbjct: 472 IMSDPVAVSYLRT-----SMQIADSVSDATLRTFLVDPAAASAQ----GYSDVHDLFNFK 522

Query: 580 IHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYE 639
             G ++                  L+  Q   +         + A+Y++ TI  I N  +
Sbjct: 523 TDGSVAT-----------------LHATQTAAQSANTTSKADSAAVYYQSTIAGISNVDQ 565

Query: 640 ILGDSKLFKVVSKKLKLSPYFAVLPE------RKKIRILKKHIKINDFKDSKKVEDFLYA 693
           +L D KL   V     +      +        +             +FK    +ED L A
Sbjct: 566 LLADQKLNNFVRNAYGIPSTVTDVDLRNILTDQSGTGTYADVAAAFNFKADGSLEDGLAA 625

Query: 694 AKAMDHQSI 702
             +    + 
Sbjct: 626 QTSSQTTNT 634



 Score =  365 bits (936), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 155/694 (22%), Positives = 286/694 (41%), Gaps = 58/694 (8%)

Query: 16   SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
                   S     +    ++   I +++ +D+ + D    SY   +  ++D   ++  ++
Sbjct: 440  QTAAQRKSTTDKSAANAAHFNAMIGNVTNVDDIMSDPVAVSYLRTSMQIADSV-SDATLR 498

Query: 76   KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEE 135
              L     DP +   Q     Y      ++F     V                   +   
Sbjct: 499  TFL----VDPAAASAQ----GYSDVHDLFNFKTDGSVATLHATQTAA------QSANTTS 544

Query: 136  VALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPK 195
             A   + Y++  I  I++VDQL  D++L ++V  ++ I      +  L+++LT       
Sbjct: 545  KADSAAVYYQSTIAGISNVDQLLADQKLNNFVRNAYGIPSTVTDVD-LRNILTD------ 597

Query: 196  KYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN 255
                +S    +  +A  F F+ DGSL       T  Q           T   +   +  +
Sbjct: 598  ----QSGTGTYADVAAAFNFKADGSLEDGLAAQTSSQ----------TTNTKIAAGARTD 643

Query: 256  YYKLAINSVSSFSDFLKDPKLFKMLQLSLF-PLNPEITADKFLTLMQENDPIVSQVKYFF 314
             Y   + ++++  + + DP +   L+ +   P +      K +                 
Sbjct: 644  DYSSRMATIANVDELIADPAITNFLKSTYNLPFDISDAELKSILTDATAAAAAGHADLNA 703

Query: 315  QINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL---------P 363
              NF  D S  + + +Q   Q Q   D Y        D+ ++ +  +Y            
Sbjct: 704  DFNFAADGSLPAVSSVQTADQAQTTNDNYMARYDDERDEAIEEVADNYSSMMADSTSLLD 763

Query: 364  LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
              +IK++++ L      +   S ++       AL A+ L  Q++ R  +R +LTS+  DP
Sbjct: 764  TAEIKTVNDFLRTNAAADFKKSNDKLPDPYHVALQAFGLTDQEVPRSMMRKILTSDAYDP 823

Query: 424  DSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKS 483
            + Y    KD+R+  L  AFNF  DG            T+      Y      +  A    
Sbjct: 824  NGYIASLKDERITNLARAFNFGPDGKAAAPLQALPDATLAKYATDYKAHVTMLLKAGP-- 881

Query: 484  FNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE 543
                     + + + +  +EVDY+   +  + S ++ LA+ R+ + +L++  +D +K  +
Sbjct: 882  --------VKDKASKDATTEVDYFAKGMAKVQSLDDFLADSRLTDLVLKANNLDPKKYDK 933

Query: 544  DFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
              L +IF SD  D KS+ NT  D R+K+I+++FNFD  G L+  KIG +Q+      T D
Sbjct: 934  ATLEKIFTSDPDDKKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGTIQNKAAEAHTQD 993

Query: 604  LYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVL 663
            LY  Q +E ++ E +  + LALYF R  P+I + Y ILGD  L++V++    L    + +
Sbjct: 994  LYVKQTLETQQGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSM 1053

Query: 664  PERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
               K+  ++ + +K+ D +D KKV+  L    AM
Sbjct: 1054 DVAKQADLINRFVKLEDLQDPKKVDKLLRRFTAM 1087


>gi|190890609|ref|YP_001977151.1| hypothetical protein RHECIAT_CH0000988 [Rhizobium etli CIAT 652]
 gi|190695888|gb|ACE89973.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 1111

 Score =  366 bits (938), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 165/729 (22%), Positives = 296/729 (40%), Gaps = 122/729 (16%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +A        +   + V+    V  + +YY + I  +  +D+F+ D +L+SYA+K
Sbjct: 1   MITASLAYSILSKDMTSSLNKVASQATVKKDAQYYADHINKVKDVDDFLGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPDKDVQTDAQED 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S 
Sbjct: 121 DLIGLYKQSFVDADKAAAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYASK 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q    +  Y
Sbjct: 181 DFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASAIETY 238

Query: 241 FNNTIDCV---------------PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
             N+   +                   +Q YY   I ++++  D + D +L   ++ + +
Sbjct: 239 TLNSQSVIIDNAVGSDVVYVSKTAADYNQAYYTAKIGTITNVDDLVADARLTSYIKTA-Y 297

Query: 286 PLNPEITADKFLTLMQENDPIVSQVKYFFQ----INFHRDNSSSTK--IQQDSQIQKMLD 339
            +  + TA     ++   DP  +Q+  F       NF  D S+ST    Q   Q  K+  
Sbjct: 298 SMGADFTAPALRMVL--TDPSYAQLMGFTNVYNAFNFKSDGSTSTTARAQTIDQANKLAS 355

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
                                      I ++D+LL+               +  ++  DA
Sbjct: 356 AASSTANYYSVTSQS----------SGITNVDDLLADS-------------VMARYIKDA 392

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           Y L + +    +L+N+LT       SYA          LN  FNFNADGSI    +    
Sbjct: 393 YGLGV-NFSNAELKNILT-----DSSYAAAQGQ---AGLNADFNFNADGSINGSVI---- 439

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                                       +  + +K    +  +   ++   I ++ + ++
Sbjct: 440 ----------------------------QTAAQRKSTTDKSAANAAHFNAMIGSVTNVDD 471

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
           ++++   +++L       S ++ +       ++ L DP + +       Y ++   FNF 
Sbjct: 472 IMSDPVAVSYLRT-----SMQIADSVSDATLRTFLVDPAAASAQ----GYSDVHDLFNFK 522

Query: 580 IHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYE 639
             G ++                  LY  Q   +         + A+Y++ TI  I N  +
Sbjct: 523 TDGSVAT-----------------LYATQTAAQSANTTSKADSAAVYYQSTIAGISNVDQ 565

Query: 640 ILGDSKLFKVVSKKLKLSPYFAVLPE------RKKIRILKKHIKINDFKDSKKVEDFLYA 693
           +L D KL   V     +      +        +             +FK    +ED L A
Sbjct: 566 LLADQKLNNFVRNAYGIPATVTDVDLRNILTDQSGTGTYANVAAAFNFKADGSLEDGLAA 625

Query: 694 AKAMDHQSI 702
             +    + 
Sbjct: 626 QTSSQTTNT 634



 Score =  365 bits (937), Expect = 1e-98,   Method: Composition-based stats.
 Identities = 154/694 (22%), Positives = 284/694 (40%), Gaps = 58/694 (8%)

Query: 16   SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
                   S     +    ++   I  ++ +D+ + D    SY   +  ++D   ++  ++
Sbjct: 440  QTAAQRKSTTDKSAANAAHFNAMIGSVTNVDDIMSDPVAVSYLRTSMQIADSV-SDATLR 498

Query: 76   KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEE 135
              L     DP +   Q     Y      ++F     V                   +   
Sbjct: 499  TFL----VDPAAASAQ----GYSDVHDLFNFKTDGSVAT------LYATQTAAQSANTTS 544

Query: 136  VALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPK 195
             A   + Y++  I  I++VDQL  D++L ++V  ++ I      +  L+++LT       
Sbjct: 545  KADSAAVYYQSTIAGISNVDQLLADQKLNNFVRNAYGIPATVTDVD-LRNILTD------ 597

Query: 196  KYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN 255
                +S    +  +A  F F+ DGSL       T  Q           T   +   +  +
Sbjct: 598  ----QSGTGTYANVAAAFNFKADGSLEDGLAAQTSSQ----------TTNTKIAAGARTD 643

Query: 256  YYKLAINSVSSFSDFLKDPKLFKMLQLSLF-PLNPEITADKFLTLMQENDPIVSQVKYFF 314
             Y   + ++++  + + DP +   L+ +   P +      K +                 
Sbjct: 644  DYSSRMATIANVDELIADPAITNFLKSTYNLPFDISDAELKSILTDATAAAAAGHADLNA 703

Query: 315  QINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL---------P 363
              NF  D S  + + +Q   Q Q   D Y        D+ ++ +  +Y            
Sbjct: 704  DFNFAADGSLPAVSSVQTADQAQTTNDNYMARYDDERDEAIEEVADNYSSMMADSTSLLD 763

Query: 364  LGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDP 423
              +IK++++ L      +   S ++       AL A+ L  Q++ R  +R +LTS+  DP
Sbjct: 764  TAEIKTVNDFLRTNAAADFKKSNDKLPDPYHVALQAFGLTDQEVPRSMMRKILTSDAYDP 823

Query: 424  DSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKS 483
            + Y    KD+R+  L  AFNF  DG            T+      Y      +  A    
Sbjct: 824  NGYIASLKDERITNLARAFNFGPDGKAAAPLQALPDATLAKYATDYKAHVTMLLKAGP-- 881

Query: 484  FNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE 543
                     + + + +  +EVDY+   +  + S ++ LA+ R+ + +L++  +D +   +
Sbjct: 882  --------VKDKASKDATTEVDYFAKGMAKVQSLDDFLADSRLTDLVLKANNLDPKDYDK 933

Query: 544  DFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
              L +IF SD  D KS+ NT  D R+K+I+++FNFD  G L+  KIG +Q+      T D
Sbjct: 934  ATLKKIFTSDPDDKKSYLNTKADARFKDIVAAFNFDKDGNLTRAKIGAIQNKAAEAHTQD 993

Query: 604  LYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVL 663
            LY  Q +E ++ E +  + LALYF R  P+I + Y ILGD  L++V++    L    + +
Sbjct: 994  LYVKQTLETQQGESNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSM 1053

Query: 664  PERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
               K+  ++ + +K+ D +D KKV+  L    AM
Sbjct: 1054 DVAKQADLINRFVKLEDLQDPKKVDKLLRRFTAM 1087


>gi|209548151|ref|YP_002280068.1| hypothetical protein Rleg2_0545 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209533907|gb|ACI53842.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 1111

 Score =  364 bits (935), Expect = 2e-98,   Method: Composition-based stats.
 Identities = 174/774 (22%), Positives = 313/774 (40%), Gaps = 134/774 (17%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +A        +   + V+    V  +  YY + I  ++++D+F+ D +L+SYA+K
Sbjct: 1   MITASLAYTILSKDMTSSLNKVASQATVKKDAEYYADHINKVTSVDDFLGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFASAFNFNAPEKDVQTDAQED 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  YKQS    ++    ES Y+  NI  + +VD L  + RL  YVL++F+I P Y S 
Sbjct: 121 DLIGLYKQSFIDADKATTAESTYYSNNIDSVTTVDDLVNNTRLRTYVLKTFNIDPTYASK 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++  Y
Sbjct: 181 DFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASVIETY 238

Query: 241 FNNTIDCV---------------PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
             N+   +                   +Q YY   I ++++  D + D +L   ++ + +
Sbjct: 239 TLNSQSVIIDNSVGSDVVYVNKTAADYNQAYYTAKIGTITNVDDLVADKRLTSYIKTA-Y 297

Query: 286 PLNPEITADKFLTLMQENDPIVSQVKYFFQ----INFHRDNSSSTK--IQQDSQIQKMLD 339
            +  + TA    T++   DP  +Q+  F       NF  D S+S+   ++   Q  K+  
Sbjct: 298 SMGADFTAAALRTVL--TDPGYAQLMGFTNVYNAFNFKSDGSTSSTARVRTLDQANKLSS 355

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
              +                       I ++D LL+                  ++  DA
Sbjct: 356 AASQTANYYKVTSQS----------SSITNVDALLADG-------------NMARYIKDA 392

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           Y L         L+N+LT    D    A +   D    LN  FNF ADGSI    +    
Sbjct: 393 YGLGTG-FSNADLKNILT----DSAYAAAQGHAD----LNADFNFQADGSINGSVIQTD- 442

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                                          + +K    +  +   ++   I+++ S ++
Sbjct: 443 -------------------------------TQRKSTTDKSAANAAHFNAMIDSVTSVDD 471

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
           ++++   +++L       S +V +       ++ L DP + +       Y ++   FNF 
Sbjct: 472 IMSDPVAVSYLRT-----SMQVADSVSDATLRTFLVDPAAASAQ----GYSDVHDLFNFK 522

Query: 580 IHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYE 639
             G ++                  LY  Q   +           A+Y++ TI  I N  +
Sbjct: 523 TDGSVAT-----------------LYASQTAAQSASTSSKADNAAVYYQATIAGIANVDQ 565

Query: 640 ILGDSKLFKVVSKKLKLSPYF------AVLPERKKIRILKKHIKINDFKDSKKVEDFLYA 693
           +L D KL   V     +           +L ++             +FK    ++D L A
Sbjct: 566 LLSDQKLNNFVRNAFGIPSTVTDVALRGILTDQSGTGTYADVAAAFNFKADGSLKDGLAA 625

Query: 694 AK---------AMDHQSIDYKKALFSSPNQN---KDPWNNSFDDPQNNVSLQLS 735
                      A   ++ DY   + +  N +    DP   +F     N+ L +S
Sbjct: 626 QTDTQIRNTKFAAGARTDDYSARMATIANVDDLIADPAITNFLKSTYNLPLNIS 679



 Score =  363 bits (932), Expect = 5e-98,   Method: Composition-based stats.
 Identities = 155/681 (22%), Positives = 276/681 (40%), Gaps = 58/681 (8%)

Query: 29   SCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSL 88
            +    ++   I  ++++D+ + D    SY   +  ++D   ++  ++  L     DP + 
Sbjct: 453  AANAAHFNAMIDSVTSVDDIMSDPVAVSYLRTSMQVADSV-SDATLRTFL----VDPAAA 507

Query: 89   VNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNI 148
              Q     Y      ++F     V                        A   + Y++  I
Sbjct: 508  SAQ----GYSDVHDLFNFKTDGSVAT------LYASQTAAQSASTSSKADNAAVYYQATI 557

Query: 149  HKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRA 208
              I +VDQL  D++L ++V  +F I      +  L+ +LT           +S    +  
Sbjct: 558  AGIANVDQLLSDQKLNNFVRNAFGIPSTVTDVA-LRGILTD----------QSGTGTYAD 606

Query: 209  MAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFS 268
            +A  F F+ DGSL       TD QI          T D          Y   + ++++  
Sbjct: 607  VAAAFNFKADGSLKDGLAAQTDTQIRNTKFAAGARTDD----------YSARMATIANVD 656

Query: 269  DFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS-- 325
            D + DP +   L+ +         AD K                     NF  D S    
Sbjct: 657  DLIADPAITNFLKSTYNLPLNISNADLKSYLTDATAASAAGYADLNADFNFAADGSLPVV 716

Query: 326  TKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL---------PLGKIKSIDNLLSG 376
            + +Q   Q Q   D Y        ++ +  +  +Y              +IKS+++ +  
Sbjct: 717  SSVQTADQAQTTNDNYMARYDDEREEAIDEVASNYSSMMADSTSLLDTAEIKSVNDFMRT 776

Query: 377  KCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLI 436
                +   S +        AL A+ L  QD+ R  +R +LTS+  DP+ Y    KD+R+ 
Sbjct: 777  NATADFKKSNDNLPDPYHVALQAFGLTEQDVPRSMMRKILTSDAYDPNGYIASLKDERIT 836

Query: 437  KLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRI 496
             +  AFNF  DG            T+      Y      +  A             + + 
Sbjct: 837  NMARAFNFGPDGKAASPFQALPDATLAKYATDYKAHMTMLLKAGP----------VKDKA 886

Query: 497  NLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKD 556
            + +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  D
Sbjct: 887  SKDATTEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDD 946

Query: 557  PKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEE 616
             KS+ N   D R+K+I+++FNFD  G L+  K+G +Q+    + T +LY  Q +E ++ E
Sbjct: 947  KKSYLNAKADARFKDIVAAFNFDKDGNLTRAKMGTIQNKAAEEHTQELYVQQTMEAQQGE 1006

Query: 617  KDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHI 676
             +  + LALYF R  P+I + Y ILGD  L++VV+    L    + +   K+  +L + +
Sbjct: 1007 SNDGVRLALYFSRKAPSITSIYSILGDKALYQVVTTAYSLPSQMSGMDVTKQADLLNRFV 1066

Query: 677  KINDFKDSKKVEDFLYAAKAM 697
            K+ D +D KKV+  +    AM
Sbjct: 1067 KLEDLQDPKKVDKLVRRFTAM 1087


>gi|218674013|ref|ZP_03523682.1| hypothetical protein RetlG_21992 [Rhizobium etli GR56]
          Length = 993

 Score =  359 bits (922), Expect = 7e-97,   Method: Composition-based stats.
 Identities = 158/681 (23%), Positives = 286/681 (41%), Gaps = 116/681 (17%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +A        +   + V+    V  + +YY + I  ++++D+F+ D +L+SYA+K
Sbjct: 1   MITASLAYSILSKDMTSSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLTDPDSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQED 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S 
Sbjct: 121 ELIGLYKQSFVDADKAAATESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYASK 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++  Y
Sbjct: 181 DFLRQVLTSDLSDPTSIVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASVIETY 238

Query: 241 FNNTIDCV---------------PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
             N+   +                   ++ YY   I ++++  D + D +L   ++ + +
Sbjct: 239 TLNSQSVIIDNSVGSDVYYVGKTAAEYNKAYYTAKIGTITNVDDLVADSRLTSYIKTA-Y 297

Query: 286 PLNPEITADKFLTLMQENDPIVSQVKYFFQ----INFHRDNSSS--TKIQQDSQIQKMLD 339
            +  + TA    T++   DP  +Q+  F       NF  D S+S   ++Q   Q  ++  
Sbjct: 298 SMGADFTAAALRTVL--TDPSYAQLMGFTNVYNAFNFKSDGSTSNTARVQSVEQANQLKS 355

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
                                      I ++D+LL+               +  ++  DA
Sbjct: 356 AASSTTNYYSVTSQS----------SSITNVDDLLADS-------------VLARYIKDA 392

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           Y L + +    +L+N+LT    D    A + K      LN  FNFNADGSI    +    
Sbjct: 393 YGLGV-NFSNAELKNILT----DSAYAAAQGK----AGLNADFNFNADGSINGSVIQTDT 443

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                  K  AN                                  ++   I ++ + ++
Sbjct: 444 QRQSTTGKSAAN--------------------------------ATHFNSMIASVTNVDD 471

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
           ++++   ++++       S ++ +       ++ L DP + +       Y ++   FNF 
Sbjct: 472 IMSDPIAVSYIRN-----SMQIADSVSDATLRTFLVDPAAASAQ----GYSDVHDLFNFK 522

Query: 580 IHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYE 639
             G ++                  LY  Q   +           A+Y++ TI  I N  +
Sbjct: 523 TDGSVAT-----------------LYSGQTAAQSASTASKADDAAVYYQATIAGISNVDQ 565

Query: 640 ILGDSKLFKVVSKKLKLSPYF 660
           +L D KL   V     +    
Sbjct: 566 LLADQKLNNFVRNAFGIPSTV 586



 Score =  259 bits (661), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 127/596 (21%), Positives = 232/596 (38%), Gaps = 58/596 (9%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
              S     +    ++   I  ++ +D+ + D    SY   +  ++D   ++  ++  L 
Sbjct: 444 QRQSTTGKSAANATHFNSMIASVTNVDDIMSDPIAVSYIRNSMQIADSV-SDATLRTFL- 501

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALE 139
               DP +   Q     Y      ++F     V                        A +
Sbjct: 502 ---VDPAAASAQ----GYSDVHDLFNFKTDGSVAT------LYSGQTAAQSASTASKADD 548

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
            + Y++  I  I++VDQL  D++L ++V  +F I      L  L+D+LT           
Sbjct: 549 AAVYYQATIAGISNVDQLLADQKLNNFVRNAFGIPSTVTDLA-LRDILTD---------- 597

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKL 259
           +S    +  +A  F F+ DG+L       TD Q+  I       T D          Y  
Sbjct: 598 QSGTGTYADVAAAFNFKADGTLEDGMPAQTDSQVTNIKIAATARTND----------YSA 647

Query: 260 AINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINF 318
            + ++++  D + DP +   L+ +         AD + +                   NF
Sbjct: 648 RMGTIANVDDLIADPAITNFLKSTYNLPFNISDADLRSILTDSTAAAAAGYADLNADFNF 707

Query: 319 HRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL---------PLGKI 367
             D S  + + +Q  +Q Q   D Y        D+ +  +  +Y+             +I
Sbjct: 708 AADGSLPAVSSVQTAAQAQTTNDNYMARYDDERDEAIAEVASNYKSMMADSTSLLDFSEI 767

Query: 368 KSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYA 427
            S+++ L      +   S +        AL A+ L  Q++ R  +R +LTS+  DPD Y 
Sbjct: 768 TSVNDFLRTNSSADFKKSNDNLPDPFHVALQAFGLTDQEVSRSMMRKILTSDAYDPDGYI 827

Query: 428 NKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSM 487
              KD+R+  L  AFNF  DG            T+      Y      +  A        
Sbjct: 828 ASLKDERITNLARAFNFGPDGKAASPFQALPDATMAKYATDYKAHMTMLLKAGP------ 881

Query: 488 EQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC 547
                + +   +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L 
Sbjct: 882 ----VKDKAAKDATAEVDYFAKTMAKVKSLDDFLDDSRLTDLVLKANNLDPEDYDKATLK 937

Query: 548 EIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
           +IF SD  D KS+ N+  D R+K+I+++FNFD  G L+  KIG +Q+    ++T +
Sbjct: 938 KIFTSDPDDKKSYLNSKADARFKDIVAAFNFDKDGNLTRAKIGTIQNKAAEENTQE 993



 Score =  138 bits (346), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 102/623 (16%), Positives = 195/623 (31%), Gaps = 117/623 (18%)

Query: 33  RYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQL 92
            YY  +I  I+ +D+ + D RL SY   A+ +     A    + +L        S    +
Sbjct: 268 AYYTAKIGTITNVDDLVADSRLTSYIKTAYSMGADFTAAAL-RTVLT-----DPSYAQLM 321

Query: 93  NSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFR--KNIHK 150
               +     +++F        +            +     +  A   + Y+        
Sbjct: 322 G---FTNVYNAFNFKSDGSTSNTARVQSV------EQANQLKSAASSTTNYYSVTSQSSS 372

Query: 151 INSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMA 210
           I +VD L  D  L  Y+  ++ +     S   LK++LT        Y           + 
Sbjct: 373 ITNVDDLLADSVLARYIKDAYGL-GVNFSNAELKNILTD-----SAYAAAQGK---AGLN 423

Query: 211 ENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDF 270
            +F F  DGS++    I TD Q +                 ++  ++   I SV++  D 
Sbjct: 424 ADFNFNADGSIN-GSVIQTDTQRQSTTGKS----------AANATHFNSMIASVTNVDDI 472

Query: 271 LKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIV-SQVKYFFQINFHRDNSSSTKIQ 329
           + DP     ++ S+   +    A     L+                 NF  D S +T   
Sbjct: 473 MSDPIAVSYIRNSMQIADSVSDATLRTFLVDPAAASAQGYSDVHDLFNFKTDGSVATLYS 532

Query: 330 QDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEP 389
             +  Q                K       YQ  +  I ++D LL+ +            
Sbjct: 533 GQTAAQSASTA----------SKADDAAVYYQATIAGISNVDQLLADQK----------- 571

Query: 390 IITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGS 449
                F  +A+ +    +    LR++LT           +S       +  AFNF ADG+
Sbjct: 572 --LNNFVRNAFGI-PSTVTDLALRDILTD----------QSGTGTYADVAAAFNFKADGT 618

Query: 450 IGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTL 509
           +      Q+   + +                               I +   +  + Y+ 
Sbjct: 619 LEDGMPAQTDSQVTN-------------------------------IKIAATARTNDYSA 647

Query: 510 NINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRY 569
            + TI + ++L+A+  I NFL  +  +    + +  L  I                   Y
Sbjct: 648 RMGTIANVDDLIADPAITNFLKSTYNL-PFNISDADLRSILTDSTAAAA--------AGY 698

Query: 570 KEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKR 629
            ++ + FNF   G L    +  VQ       T D Y  +     +E  +    +A  +K 
Sbjct: 699 ADLNADFNFAADGSLPA--VSSVQTAAQAQTTNDNYMARY---DDERDEAIAEVASNYKS 753

Query: 630 TIPNIRNHYEILGDSKLFKVVSK 652
            + +  +  +    + +   +  
Sbjct: 754 MMADSTSLLDFSEITSVNDFLRT 776


>gi|218674655|ref|ZP_03524324.1| hypothetical protein RetlG_25976 [Rhizobium etli GR56]
          Length = 469

 Score =  341 bits (873), Expect = 3e-91,   Method: Composition-based stats.
 Identities = 127/449 (28%), Positives = 226/449 (50%), Gaps = 14/449 (3%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ ++V+        S   S V+    V+ +  YY+E I  ++T+DEF+ D +L+SYA+K
Sbjct: 1   MVSAYVSYLAVARNLSASLSNVASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ FS   K  QSD+Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFSGETKTAQSDVQRD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
           +++  Y++S + + +   +E+ YF +NI  I SVD      RL +YVL +F ++ +Y S 
Sbjct: 121 SLLDAYEESFETEADAIEDETDYFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTST 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLKDVLT  L +   +  +  D+ + ++A+ F F  DGS+     ++++ QI  + S Y
Sbjct: 181 SFLKDVLTSDLDDADSFVNQLGDDVYVSLAKAFNFNEDGSVD--GDLMSEDQILLVTSAY 238

Query: 241 FNNTID---CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
              +          +   Y+   I +++S    + D KL   L+ +    + E  +D F+
Sbjct: 239 AVASATIASSETGEAYDTYFAAEIGNITSVDQLMSDDKLVSYLRTAYGLTDDE--SDTFI 296

Query: 298 TLMQENDPIVSQVK---YFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HDD 351
           +   ++  I   +         NF  D   +     Q   Q       + +N Q+L  + 
Sbjct: 297 SAALKSADIADAIGLSDLHDAFNFDEDGALADGDTAQTSDQTAATTAAFDENYQVLIANT 356

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
             +  + +Y   +  + SID+ L      +  ++ + P    + AL A++++   + R +
Sbjct: 357 DTEDAVDNYTTRIASVTSIDDFLVSNADDDDDDNDDLPE-MWEMALRAFDIDPDSVSRSE 415

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
           +R +L S+P+D  SY N   DDR +    
Sbjct: 416 VRKILESDPTDAKSYVNSLDDDRFVAFRK 444



 Score =  175 bits (442), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 87/466 (18%), Positives = 172/466 (36%), Gaps = 71/466 (15%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
             +     +S Y+++NI K+ +VD+   D +L  Y ++++ +     +  F+K VL   L
Sbjct: 23  ASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSYAMKAYGLEDMTYAKAFMKKVLESDL 82

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV 251
           ++   +     D R+   A  F+F  +          +D+Q + ++  Y  +       +
Sbjct: 83  SDSSSFANSLSDGRYAEFAAAFKFSGE-----TKTAQSDVQRDSLLDAYEESFETEADAI 137

Query: 252 SDQN-YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQ- 309
            D+  Y++  I S++S  DFL   +L   +  + F L+ E T+  FL  +  +D   +  
Sbjct: 138 EDETDYFEENIASITSVDDFLSSSRLKNYVLTA-FGLSTEYTSTSFLKDVLTSDLDDADS 196

Query: 310 ----------VKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKM-QSLIK 358
                     V      NF+ D S    +  + QI  +   Y      +   +  ++   
Sbjct: 197 FVNQLGDDVYVSLAKAFNFNEDGSVDGDLMSEDQILLVTSAYAVASATIASSETGEAYDT 256

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
            +   +G I S+D L+S                 + +   AY L   + D      + ++
Sbjct: 257 YFAAEIGNITSVDQLMSDDK-------------LVSYLRTAYGLTDDESDTFISAALKSA 303

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
           + +D               L+ AFNF+ DG++      Q+          +    + +  
Sbjct: 304 DIADAIGL---------SDLHDAFNFDEDGALADGDTAQTSDQTAATTAAFDENYQVLI- 353

Query: 479 AENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN------------KRI 526
                             N +    VD YT  I ++ S ++ L +              +
Sbjct: 354 -----------------ANTDTEDAVDNYTTRIASVTSIDDFLVSNADDDDDDNDDLPEM 396

Query: 527 LNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEI 572
               L +  ID   V    + +I +SD  D KS+ N+  D+R+   
Sbjct: 397 WEMALRAFDIDPDSVSRSEVRKILESDPTDAKSYVNSLDDDRFVAF 442



 Score =  166 bits (420), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 77/373 (20%), Positives = 137/373 (36%), Gaps = 46/373 (12%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
             +     +      Y+  + K+ ++D  +                    +A+ AY L  
Sbjct: 20  SNVASQATVARDSAYYKENIDKVTTVDEFMGD-------------YKLYSYAMKAYGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  ++ VL S+ SD  S+AN   D R  +   AF F+     G     QS +    
Sbjct: 67  MTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFS-----GETKTAQSDVQRDS 121

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            +  Y     +  DA                    I  E DY+  NI +I S ++ L++ 
Sbjct: 122 LLDAYEESFETEADA--------------------IEDETDYFEENIASITSVDDFLSSS 161

Query: 525 RILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGEL 584
           R+ N++L + G+ ++     FL ++  SDL D  SF N   D+ Y  +  +FNF+  G +
Sbjct: 162 RLKNYVLTAFGLSTEYTSTSFLKDVLTSDLDDADSFVNQLGDDVYVSLAKAFNFNEDGSV 221

Query: 585 SHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDS 644
               + + Q    I      Y          E     A   YF   I NI +  +++ D 
Sbjct: 222 DGDLMSEDQ----ILLVTSAYAVASATIASSET--GEAYDTYFAAEIGNITSVDQLMSDD 275

Query: 645 KLFKVVSKKLKLSPYFAVLPERK--KIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSI 702
           KL   +     L+   +        K   +   I ++D  D+   ++    A     Q+ 
Sbjct: 276 KLVSYLRTAYGLTDDESDTFISAALKSADIADAIGLSDLHDAFNFDEDGALADGDTAQTS 335

Query: 703 DYKKALFSSPNQN 715
           D   A  ++ ++N
Sbjct: 336 DQTAATTAAFDEN 348



 Score =  163 bits (413), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 81/422 (19%), Positives = 162/422 (38%), Gaps = 58/422 (13%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           + + +S   +N      +  D  YYK  I+ V++  +F+ D KL+    +  + L     
Sbjct: 11  VARNLSASLSNVASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSY-AMKAYGLEDMTY 69

Query: 293 ADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           A  F+  + E+D   S              F   F     + T  Q D Q   +LD Y++
Sbjct: 70  AKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFSGETKT-AQSDVQRDSLLDAYEE 128

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
           + +    D ++     ++  +  I S+D+ LS                   + L A+ L+
Sbjct: 129 SFET-EADAIEDETDYFEENIASITSVDDFLSSSR-------------LKNYVLTAFGLS 174

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
            +      L++VLTS+  D DS+ N+  DD  + L  AFNFN DGS+    M + ++ + 
Sbjct: 175 TEYTSTSFLKDVLTSDLDDADSFVNQLGDDVYVSLAKAFNFNEDGSVDGDLMSEDQILLV 234

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
            +   YA    +I  +E                         Y+   I  I S ++L+++
Sbjct: 235 TSA--YAVASATIASSETGEAYD------------------TYFAAEIGNITSVDQLMSD 274

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
            +++++L  + G+   +        +  +D+ D    +         ++  +FNFD  G 
Sbjct: 275 DKLVSYLRTAYGLTDDESDTFISAALKSADIADAIGLS---------DLHDAFNFDEDGA 325

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
           L+     +  D            +Q++    + +D        +   I ++ +  + L  
Sbjct: 326 LADGDTAQTSDQTAATTAAFDENYQVLIANTDTEDAVD----NYTTRIASVTSIDDFLVS 381

Query: 644 SK 645
           + 
Sbjct: 382 NA 383



 Score =  113 bits (283), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/248 (18%), Positives = 94/248 (37%), Gaps = 27/248 (10%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S + +      ++    +       +  +  YY  NI+ + + +E + + ++ ++ +++ 
Sbjct: 3   SAYVSYLAVARNLSASLSNVASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSYAMKAY 62

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G++     + F+ ++ +SDL D  SFAN+  D RY E  ++F F              Q 
Sbjct: 63  GLEDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFSGE-------TKTAQS 115

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
           +   D   D Y+     + +  +D       YF+  I +I +  + L  S+L   V    
Sbjct: 116 DVQRDSLLDAYEESFETEADAIEDETD----YFEENIASITSVDDFLSSSRLKNYVLTAF 171

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQ 714
            LS  +      K   +L   +   D                ++    D   +L  + N 
Sbjct: 172 GLSTEYTSTSFLK--DVLTSDLDDAD--------------SFVNQLGDDVYVSLAKAFNF 215

Query: 715 NKDPWNNS 722
           N+D   + 
Sbjct: 216 NEDGSVDG 223


>gi|163761036|ref|ZP_02168114.1| hypothetical protein HPDFL43_03334 [Hoeflea phototrophica DFL-43]
 gi|162281817|gb|EDQ32110.1| hypothetical protein HPDFL43_03334 [Hoeflea phototrophica DFL-43]
          Length = 961

 Score =  334 bits (855), Expect = 5e-89,   Method: Composition-based stats.
 Identities = 137/683 (20%), Positives = 261/683 (38%), Gaps = 65/683 (9%)

Query: 49  IKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP 108
           + D R    AL A GL +         KI   D+             ++   + S +   
Sbjct: 290 MIDFREEESALIADGLENSPEMTALRNKI---DVWTAD------TDARWT-ISTSLNEIV 339

Query: 109 PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVL 168
             +  ++           +           E +          + +D     + +     
Sbjct: 340 ELEASKTQEGADLAAIQSQIDALRVTITGAEANLTL-----TTSDIDDAVAAKDVAIAAY 394

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKIL 228
               +         L   L   +A  + Y   +  +++ A+A  + F  DG++       
Sbjct: 395 T--DLPELGDDTNQLAAQLNTDVAAARNYINAT--DKYLALAYAYNFNDDGTVPAGG-FQ 449

Query: 229 TDMQIEKIVSNYFNNT--IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFP 286
           T+ ++E     Y  +   +     + + +Y++  I S ++  + ++D ++   L+ +   
Sbjct: 450 TEAELEATTELYVTSQDRLTLTGAMLNDDYFRETIGSFTTAEEMMEDERIVSYLKSAFNL 509

Query: 287 ---------------LNPEITAD-----KFLTLMQENDPIVS-QVKYFFQINFHRDNSSS 325
                           +P   AD      +L    +  P     V      NF  D +  
Sbjct: 510 DTYLTVVTSTLENAITSPATDADLEDETNYLVAFHKGKPYFDDLVALSRAFNFEEDGTLP 569

Query: 326 TKIQQDSQIQK--MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGP 383
             +Q      +  +   Y        +   Q  I+  Q+         +L+    +    
Sbjct: 570 DGLQPVDAENQSVLSSRYFSGYDDADEAADQEAIRRMQI---------DLVGLNTEGATV 620

Query: 384 NSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFN 443
                      FA+ A  L+  ++ +  +R VLTS+  DP+SY    KD+R +K  + FN
Sbjct: 621 EDLFNSSAVYSFAMQAAELDPNEIPQRIMRKVLTSDLQDPNSYVYTLKDERYVKFANLFN 680

Query: 444 FNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSE 503
           F+++G        Q +  + D  + Y  +K      E  +               +  +E
Sbjct: 681 FDSEGVATAPLTAQDQARMDDISRDYIVQKTRFLTGEEAA-----------TARSDAEAE 729

Query: 504 VDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANT 563
             YY   ++ I + ++LL N+R+++F L +KGID + V  D L  +F+SDL DP S+ANT
Sbjct: 730 ASYYQRTVSNIETLDQLLGNRRLIDFALTAKGIDPETVSNDELQLLFRSDLDDPDSYANT 789

Query: 564 YKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIAL 623
             D R  E+++SFNFD  G+L  +   ++     + +T +LY  Q IE +  E+D  + L
Sbjct: 790 VSDFRLTEVVTSFNFDEAGKLMQRDAAEISSRGDLYETMNLYLRQTIELERGEEDNGVRL 849

Query: 624 ALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKD 683
           ALYF+R  P I + Y+ILGD+ L++V      L    + +    +  +L+  + + D  D
Sbjct: 850 ALYFERMAPTITSVYDILGDTALYEVFKTIFSLPDEISGMSVDSQAALLEDRMDMADLAD 909

Query: 684 SKKVEDFLYAAKAMDHQSIDYKK 706
            +K++  +     M         
Sbjct: 910 PEKLKKLVERFTIMYDLENSSSS 932



 Score =  271 bits (692), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 146/721 (20%), Positives = 282/721 (39%), Gaps = 98/721 (13%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +++     ++D++++  + VS+   VS E  Y++E I  + + +EF+ D RL+SYA+
Sbjct: 1   MTTTYLNYNLVAQDLKAE-MNRVSQQTQVSRETAYFKENIGKVRSAEEFVGDYRLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA GL DM +AE F+ K+LESDLSD  S  N+L   +Y+ FA ++ F    KV  S  Q 
Sbjct: 60  KAHGLEDMIYAEAFMLKVLESDLSDSDSYANRLTDSRYRDFAAAFQFEDGSKVPMSVNQI 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
              I  Y ++    ++    E  Y+      + +VDQ   D RL D++ QS+ I    + 
Sbjct: 120 DEAIGLYDETVASLDDKISGEVNYYNAMAGLVENVDQFLADPRLFDFITQSYGIDGSTVD 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIE----- 234
             FL+ +L     +P  Y   +            R   + +LS    IL D+        
Sbjct: 180 RTFLRGILASDPDDPNSYLNTNLIAN--------RTSSETTLSTAQPILNDIAARQSEVD 231

Query: 235 -KIVSNYFNNTIDCVPIVSDQNYYKLA-----INSVSSFSDFLKD---PKLFKMLQLSLF 285
            K     +   I  +    D+   + +     + S+ +  D L D         ++L++ 
Sbjct: 232 DKATMVAYGEGIVSIQAAIDEALVRQSEPGADVASIQTEIDVLTDGLHTTYRNFIELAMI 291

Query: 286 PLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQ---------DSQIQK 336
               E +A   +    EN P ++ ++    + +  D  +   I            S+ Q+
Sbjct: 292 DFREEESA--LIADGLENSPEMTALRNKIDV-WTADTDARWTISTSLNEIVELEASKTQE 348

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKS-IDNLLSGKCQLEGPNSAEEPIITLQF 395
             DL     QI   D ++  I   +  L    S ID+ ++ K                  
Sbjct: 349 GADLAAIQSQI---DALRVTITGAEANLTLTTSDIDDAVAAK----------------DV 389

Query: 396 ALDAY-NLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
           A+ AY +L     D +QL   L ++ +   +Y N +  D+ + L +A+NFN DG++ P  
Sbjct: 390 AIAAYTDLPELGDDTNQLAAQLNTDVAAARNYINAT--DKYLALAYAYNFNDDGTV-PAG 446

Query: 455 MMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTI 514
             Q+   +    + Y   +  +        +                   DY+   I + 
Sbjct: 447 GFQTEAELEATTELYVTSQDRLTLTGAMLND-------------------DYFRETIGSF 487

Query: 515 HSFEELLANKRILNFLLESKGIDS-QKVREDFLCEIFKS-----DLKDPKSFANTYKDNR 568
            + EE++ ++RI+++L  +  +D+   V    L     S     DL+D  ++   +   +
Sbjct: 488 TTAEEMMEDERIVSYLKSAFNLDTYLTVVTSTLENAITSPATDADLEDETNYLVAFHKGK 547

Query: 569 -----YKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIAL 623
                   +  +FNF+  G L    +  V        +   +       +  +++    +
Sbjct: 548 PYFDDLVALSRAFNFEEDGTL-PDGLQPVDAENQSVLSSRYFSGYDDADEAADQEAIRRM 606

Query: 624 ALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKD 683
            +             ++   S ++    +        A L   +  + + + +  +D +D
Sbjct: 607 QIDLVGLNTEGATVEDLFNSSAVYSFAMQA-------AELDPNEIPQRIMRKVLTSDLQD 659

Query: 684 S 684
            
Sbjct: 660 P 660



 Score =  150 bits (378), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 65/292 (22%), Positives = 124/292 (42%), Gaps = 22/292 (7%)

Query: 44  TIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARS 103
           T+++      ++S+A++A  L      ++ ++K+L SDL DP S V  L   +Y  FA  
Sbjct: 619 TVEDLFNSSAVYSFAMQAAELDPNEIPQRIMRKVLTSDLQDPNSYVYTLKDERYVKFANL 678

Query: 104 YDF-----SPPPKVIQSDIQHKTIIQDYK---------QSHQHKEEVALEESKYFRKNIH 149
           ++F     +  P   Q   +   I +DY          +        A  E+ Y+++ + 
Sbjct: 679 FNFDSEGVATAPLTAQDQARMDDISRDYIVQKTRFLTGEEAATARSDAEAEASYYQRTVS 738

Query: 150 KINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAM 209
            I ++DQL  +RRL+D+ L +  I P+ +S   L+ +    L +P  Y     D R   +
Sbjct: 739 NIETLDQLLGNRRLIDFALTAKGIDPETVSNDELQLLFRSDLDDPDSYANTVSDFRLTEV 798

Query: 210 AENFRFQPDGSLSKRDKIL--TDMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAIN 262
             +F F   G L +RD     +   + + ++ Y   TI+      D       Y++    
Sbjct: 799 VTSFNFDEAGKLMQRDAAEISSRGDLYETMNLYLRQTIELERGEEDNGVRLALYFERMAP 858

Query: 263 SVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFF 314
           +++S  D L D  L+++ +  +F L  EI+     +     +  +       
Sbjct: 859 TITSVYDILGDTALYEVFKT-IFSLPDEISGMSVDSQAALLEDRMDMADLAD 909



 Score =  103 bits (256), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/222 (17%), Positives = 82/222 (36%), Gaps = 13/222 (5%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
              +       E  YY+  + +I T+D+ + ++RL  +AL A G+   + +   ++ +  
Sbjct: 718 EAATARSDAEAEASYYQRTVSNIETLDQLLGNRRLIDFALTAKGIDPETVSNDELQLLFR 777

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH-----------KTIIQDYKQ 128
           SDL DP S  N ++  +      S++F    K++Q D                 ++   +
Sbjct: 778 SDLDDPDSYANTVSDFRLTEVVTSFNFDEAGKLMQRDAAEISSRGDLYETMNLYLRQTIE 837

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
             + +E+  +  + YF +    I SV  +  D  L +     FS+  +   +        
Sbjct: 838 LERGEEDNGVRLALYFERMAPTITSVYDILGDTALYEVFKTIFSLPDEISGMSVDSQ--A 895

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
             L +       +   + + + E F    D   S       +
Sbjct: 896 ALLEDRMDMADLADPEKLKKLVERFTIMYDLENSSSSPTAAE 937


>gi|163740770|ref|ZP_02148163.1| hypothetical protein RG210_13056 [Phaeobacter gallaeciensis 2.10]
 gi|161385761|gb|EDQ10137.1| hypothetical protein RG210_13056 [Phaeobacter gallaeciensis 2.10]
          Length = 591

 Score =  303 bits (775), Expect = 9e-80,   Method: Composition-based stats.
 Identities = 122/632 (19%), Positives = 231/632 (36%), Gaps = 103/632 (16%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +Q    K  +     + F + I  I S DQL  D  +L   L +F +     +  F+K V
Sbjct: 25  QQQIFEKSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKV 84

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
           L   L+ P  +     DNR+  +A+ F F  D         L    +EK  +N       
Sbjct: 85  LDSDLSEPTSFANRLNDNRYLGLAQTFGFGND-----AGPQLPSSSVEKPYAN------- 132

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
                            V+S  D L +  L     L  F L      + FL  + E+D  
Sbjct: 133 -----------------VASPEDLLSNQTLLNQ-ALDDFGLEKYAGNEFFLMRVLESD-- 172

Query: 307 VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
                         D +S      DS++    + ++ N    +   M++L+ ++      
Sbjct: 173 ------------TTDPASFVNRLSDSKLADFANAFQFNQPPEYTSSMEALVGEFNA---- 216

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
                  ++        +   E    L+  +D+++L     +   L+ +L SNP DPDS 
Sbjct: 217 -------MNDGNGPANADELLENEGLLKAVVDSFDLEY--TNTIFLKRMLESNPYDPDSP 267

Query: 427 ANKSKDDRLIKLNHAFNF---NADGSIGPIPMMQSRLTIRDNVKHY-------------- 469
            N+ +D R + ++ AF F   + +    P  ++     + D ++ +              
Sbjct: 268 VNQQEDPRYLAMSRAFGFGISDINSFTSPEELLAQPQLLEDALEQFNLSNPGEQYIRDVL 327

Query: 470 ----ANRKRSIHDAENKSFNSMEQISTQKRINLEINSEV--DYYTLNINTIHSFEELLAN 523
               ++    ++   N +F    +    +  +     +V  D     +      ++ + +
Sbjct: 328 ESDLSDPNSFVNQPSNLAFYDFAEAFQNEWPSAPSRMQVLADEVGGKLAGYEQPQQFVFD 387

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
                  L+   I  +++  D + + F+SDL    S+AN ++D   K +  +F F+  G 
Sbjct: 388 FDAFEAGLDVFNISERELDFDVMIKAFESDLSSEISYANLHRDPNLKAMAHAFAFNPGGS 447

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN------- 636
                 G  Q      +  DLYK +  E    E DPN+ LAL  +R + +I +       
Sbjct: 448 DHTYPAGFAQ------EIADLYKDRNFEIAIGESDPNMRLALSLERELQSIADAGGSEDA 501

Query: 637 -HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAK 695
             + I+G   L  +    L L   F  L   +++  +K+  +   F  +       + A 
Sbjct: 502 HWFGIIGSPPLKSMFETALGLPASFGQLDVDRQVNEMKERAQ-TSFGTT-------HPAD 553

Query: 696 AMDHQSID-YKKALFSSPNQNKDPWNNSFDDP 726
            ++ +++D ++         N D   N F DP
Sbjct: 554 LLEPETLDAFRNRFLLLSGLNSDQAANGFSDP 585



 Score =  209 bits (532), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 93/491 (18%), Positives = 179/491 (36%), Gaps = 70/491 (14%)

Query: 1   MIPSHVAPFPSKDIQS-KLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           ++ + +A +   D    +      K PI+    + + ++I+ I + D+ + D  +   AL
Sbjct: 7   VLGTGIAGWNFLDRTRVQQQQIFEKSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVAL 66

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
            AFGL +  +   FIKK+L+SDLS+P S  N+LN  +Y   A+++ F             
Sbjct: 67  GAFGLDEDINNRAFIKKVLDSDLSEPTSFANRLNDNRYLGLAQTFGFGNDAGPQLPSSS- 125

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
                                     K    + S + L  ++ LL+  L  F +     +
Sbjct: 126 ------------------------VEKPYANVASPEDLLSNQTLLNQALDDFGLEKYAGN 161

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL  VL     +P  +     D++    A  F+F      +   + L     E    N
Sbjct: 162 EFFLMRVLESDTTDPASFVNRLSDSKLADFANAFQFNQPPEYTSSMEALVG---EFNAMN 218

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFK-MLQLSLFPLNPEITADKFLT 298
             N   +   ++ ++   K  ++   SF     +    K ML+ + +  +          
Sbjct: 219 DGNGPANADELLENEGLLKAVVD---SFDLEYTNTIFLKRMLESNPYDPDS--------P 267

Query: 299 LMQENDPIVSQVKYFFQINFHRDNSSSTK---IQQDSQIQKMLDLYKKNC---------- 345
           + Q+ DP    +   F       NS ++    + Q   ++  L+ +  +           
Sbjct: 268 VNQQEDPRYLAMSRAFGFGISDINSFTSPEELLAQPQLLEDALEQFNLSNPGEQYIRDVL 327

Query: 346 ---------------QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGK-CQLEGPNSAEEP 389
                           +   D  ++   ++     +++ + + + GK    E P      
Sbjct: 328 ESDLSDPNSFVNQPSNLAFYDFAEAFQNEWPSAPSRMQVLADEVGGKLAGYEQPQQFVFD 387

Query: 390 IITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGS 449
               +  LD +N++ ++LD D +     S+ S   SYAN  +D  L  + HAF FN  GS
Sbjct: 388 FDAFEAGLDVFNISERELDFDVMIKAFESDLSSEISYANLHRDPNLKAMAHAFAFNPGGS 447

Query: 450 IGPIPMMQSRL 460
               P   ++ 
Sbjct: 448 DHTYPAGFAQE 458



 Score = 50.3 bits (118), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 48/176 (27%), Gaps = 13/176 (7%)

Query: 38  RIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKY 97
           ++       +F+ D   F   L  F +S+       + K  ESDLS   S  N       
Sbjct: 374 KLAGYEQPQQFVFDFDAFEAGLDVFNISERELDFDVMIKAFESDLSSEISYANLHRDPNL 433

Query: 98  QYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQ-----HKEEVALEESKYFRKNIHKIN 152
           +  A ++ F+P              I D  +         + +  +  +    + +  I 
Sbjct: 434 KAMAHAFAFNPGGSDHTYPAGFAQEIADLYKDRNFEIAIGESDPNMRLALSLERELQSIA 493

Query: 153 --------SVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
                       +     L      +  +   +  L   + V  +       +   
Sbjct: 494 DAGGSEDAHWFGIIGSPPLKSMFETALGLPASFGQLDVDRQVNEMKERAQTSFGTT 549


>gi|163737657|ref|ZP_02145074.1| hypothetical protein RGBS107_19038 [Phaeobacter gallaeciensis
           BS107]
 gi|161389183|gb|EDQ13535.1| hypothetical protein RGBS107_19038 [Phaeobacter gallaeciensis
           BS107]
          Length = 591

 Score =  301 bits (771), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 122/632 (19%), Positives = 231/632 (36%), Gaps = 103/632 (16%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +Q    K  +     + F + I  I S DQL  D  +L   L +F +     +  F+K V
Sbjct: 25  QQQIFEKSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKV 84

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
           L   L+ P  +     DNR+  +A+ F F  D         L    +EK  +N       
Sbjct: 85  LDSDLSEPTSFANRLNDNRYLGLAQTFGFGND-----AGPQLPSSSVEKPYAN------- 132

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
                            V+S  D L +  L     L  F L      + FL  + E+D  
Sbjct: 133 -----------------VASPEDLLSNQTLLNQ-ALDDFGLKKYAGNEFFLMRVLESD-- 172

Query: 307 VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
                         D +S      DS++    + ++ N    +   M++L+ ++      
Sbjct: 173 ------------TTDPASFVNRLSDSKLADFANAFQFNQPPEYTSSMEALVGEFNA---- 216

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
                  ++        +   E    L+  +D+++L     +   L+ +L SNP DPDS 
Sbjct: 217 -------MNDGNGPANADELLENEDLLKAVVDSFDLEY--TNTIFLKRMLESNPYDPDSP 267

Query: 427 ANKSKDDRLIKLNHAFNF---NADGSIGPIPMMQSRLTIRDNVKHY-------------- 469
            N+ +D R + ++ AF F   + +    P  ++     + D ++ +              
Sbjct: 268 VNQQEDPRYLAMSRAFGFGISDINSFTSPEELLAQPQLLEDALEQFNLSNPGEQYIRDVL 327

Query: 470 ----ANRKRSIHDAENKSFNSMEQISTQKRINLEINSEV--DYYTLNINTIHSFEELLAN 523
               ++    ++   N +F    +    +  +     +V  D     +      ++ + +
Sbjct: 328 ESDLSDPNSFVNQPSNLAFYDFAEAFQNEWPSAPSRMQVLADEVGGKLAGYEQPQQFVFD 387

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
                  L+   I  +++  D + + F+SDL    S+AN ++D   K +  +F F+  G 
Sbjct: 388 FDAFEAGLDVFNISERELDFDVMIKAFESDLSSEISYANLHRDPNLKAMAHAFAFNPGGS 447

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN------- 636
                 G  Q      +  DLYK +  E    E DPN+ LAL  +R + +I +       
Sbjct: 448 DHTYPAGFAQ------EIADLYKDRNFEIAIGESDPNMRLALSLERELQSIADAGGSEDA 501

Query: 637 -HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAK 695
             + I+G   L  +    L L   F  L   +++  +K+  +   F  +       + A 
Sbjct: 502 HWFGIIGSPPLKSMFETALGLPASFGQLDVDRQVNEMKERAQ-TSFGTT-------HPAD 553

Query: 696 AMDHQSID-YKKALFSSPNQNKDPWNNSFDDP 726
            ++ +++D ++         N D   N F DP
Sbjct: 554 LLEPETLDAFRNRFLLLSGLNSDQAANGFSDP 585



 Score =  207 bits (526), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 93/491 (18%), Positives = 180/491 (36%), Gaps = 70/491 (14%)

Query: 1   MIPSHVAPFPSKDIQS-KLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           ++ + +A +   D    +      K PI+    + + ++I+ I + D+ + D  +   AL
Sbjct: 7   VLGTGIAGWNFLDRTRVQQQQIFEKSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVAL 66

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
            AFGL +  +   FIKK+L+SDLS+P S  N+LN  +Y   A+++ F             
Sbjct: 67  GAFGLDEDINNRAFIKKVLDSDLSEPTSFANRLNDNRYLGLAQTFGFGNDAGPQLPSSS- 125

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
                                     K    + S + L  ++ LL+  L  F +     +
Sbjct: 126 ------------------------VEKPYANVASPEDLLSNQTLLNQALDDFGLKKYAGN 161

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL  VL     +P  +     D++    A  F+F      +   + L     E    N
Sbjct: 162 EFFLMRVLESDTTDPASFVNRLSDSKLADFANAFQFNQPPEYTSSMEALVG---EFNAMN 218

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFK-MLQLSLFPLNPEITADKFLT 298
             N   +   ++ +++  K  ++   SF     +    K ML+ + +  +          
Sbjct: 219 DGNGPANADELLENEDLLKAVVD---SFDLEYTNTIFLKRMLESNPYDPDS--------P 267

Query: 299 LMQENDPIVSQVKYFFQINFHRDNSSSTK---IQQDSQIQKMLDLYKKNC---------- 345
           + Q+ DP    +   F       NS ++    + Q   ++  L+ +  +           
Sbjct: 268 VNQQEDPRYLAMSRAFGFGISDINSFTSPEELLAQPQLLEDALEQFNLSNPGEQYIRDVL 327

Query: 346 ---------------QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGK-CQLEGPNSAEEP 389
                           +   D  ++   ++     +++ + + + GK    E P      
Sbjct: 328 ESDLSDPNSFVNQPSNLAFYDFAEAFQNEWPSAPSRMQVLADEVGGKLAGYEQPQQFVFD 387

Query: 390 IITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGS 449
               +  LD +N++ ++LD D +     S+ S   SYAN  +D  L  + HAF FN  GS
Sbjct: 388 FDAFEAGLDVFNISERELDFDVMIKAFESDLSSEISYANLHRDPNLKAMAHAFAFNPGGS 447

Query: 450 IGPIPMMQSRL 460
               P   ++ 
Sbjct: 448 DHTYPAGFAQE 458



 Score = 89.9 bits (221), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 48/255 (18%), Positives = 92/255 (36%), Gaps = 21/255 (8%)

Query: 495 RINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDL 554
             +  ++  V  +T  I  I S ++LL +  +L   L + G+D       F+ ++  SDL
Sbjct: 30  EKSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKVLDSDL 89

Query: 555 KDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKE 614
            +P SFAN   DNRY  +  +F F              +   ++    DL  +Q +  + 
Sbjct: 90  SEPTSFANRLNDNRYLGLAQTFGFGNDAGPQLPSSSVEKPYANVASPEDLLSNQTLLNQA 149

Query: 615 EEKDPNIALALY-------FKRTIPNIRNHYEILGDSKLFKVVSK-KLKLSPYFAVLPER 666
            +       A          +    +  +    L DSKL    +  +    P +      
Sbjct: 150 LDDFGLKKYAGNEFFLMRVLESDTTDPASFVNRLSDSKLADFANAFQFNQPPEYTSS--- 206

Query: 667 KKIRILKKHIKINDFKDSKKVEDFLYAAKAM----DHQSIDYKKALFSSPNQNKDPWNNS 722
               ++ +   +ND       ++ L     +    D   ++Y   +F       +P+   
Sbjct: 207 -MEALVGEFNAMNDGNGPANADELLENEDLLKAVVDSFDLEYTNTIFLKRMLESNPY--- 262

Query: 723 FDDPQNNVSLQLSPQ 737
             DP + V+ Q  P+
Sbjct: 263 --DPDSPVNQQEDPR 275



 Score = 50.3 bits (118), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/176 (13%), Positives = 48/176 (27%), Gaps = 13/176 (7%)

Query: 38  RIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKY 97
           ++       +F+ D   F   L  F +S+       + K  ESDLS   S  N       
Sbjct: 374 KLAGYEQPQQFVFDFDAFEAGLDVFNISERELDFDVMIKAFESDLSSEISYANLHRDPNL 433

Query: 98  QYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQ-----HKEEVALEESKYFRKNIHKIN 152
           +  A ++ F+P              I D  +         + +  +  +    + +  I 
Sbjct: 434 KAMAHAFAFNPGGSDHTYPAGFAQEIADLYKDRNFEIAIGESDPNMRLALSLERELQSIA 493

Query: 153 --------SVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
                       +     L      +  +   +  L   + V  +       +   
Sbjct: 494 DAGGSEDAHWFGIIGSPPLKSMFETALGLPASFGQLDVDRQVNEMKERAQTSFGTT 549


>gi|260466626|ref|ZP_05812814.1| protein of unknown function DUF1217 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029632|gb|EEW30920.1| protein of unknown function DUF1217 [Mesorhizobium opportunistum
           WSM2075]
          Length = 373

 Score =  284 bits (726), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 95/378 (25%), Positives = 162/378 (42%), Gaps = 38/378 (10%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           I     +    + Y   + K+KSID+ +                   ++A+ AY L   D
Sbjct: 22  IEKQPTVDRDTQYYLANITKVKSIDDFVKNDR-------------LFKYAMKAYGLEDMD 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +   L    +DPDS+ANK  D R  +   AFNF A+G+   I     +L +    
Sbjct: 69  YAKAFMVKALKEGVTDPDSFANKLTDKRYAQFVSAFNFAANGADATIYNKAQQLVM---- 124

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           K+YA + +      N  +               +  E  YY  NI  + S ++L++N R+
Sbjct: 125 KNYATQAQIAGLDPNSDY---------------VKGETTYYLANITKVKSVDDLMSNSRL 169

Query: 527 LNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSH 586
             + L + G+DS    +D + ++ +S + DP S AN   +  Y  +  +FNF+ +GE + 
Sbjct: 170 YTYALAAYGLDSATEDKDLIKQVLQSKVSDPDSVANKQTNPAYAGLALAFNFEANGENAT 229

Query: 587 KKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKL 646
                 Q       T D Y  Q +E+   + +  + LALYF+R  P+I + Y++L D+ L
Sbjct: 230 TISPAQQP------TVDKYLRQTLEEDAGQTNQGVRLALYFQRKAPDITSWYDVLADTAL 283

Query: 647 FKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKK 706
             VV   L L   FA     K+ ++ ++ + + DF D  K+  FL    +M   +     
Sbjct: 284 ASVVRTALGLPDSFATANIDKQAQLFEQKLDLTDFTDPAKLTKFLTRFTSMYEINNPTST 343

Query: 707 ALFSSPNQNKDPWNNSFD 724
           A+ S       P  +   
Sbjct: 344 AVSSISVLFAKPVTSGIS 361



 Score =  228 bits (582), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 74/306 (24%), Positives = 142/306 (46%), Gaps = 17/306 (5%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +  +    ++DI SK    + K P V  + +YY   I  + +ID+F+K+ RLF YA+
Sbjct: 1   MLNTFTSYQLITRDI-SKSIDRIEKQPTVDRDTQYYLANITKVKSIDDFVKNDRLFKYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQ 118
           KA+GL DM +A+ F+ K L+  ++DP S  N+L   +Y  F  +++F+         +  
Sbjct: 60  KAYGLEDMDYAKAFMVKALKEGVTDPDSFANKLTDKRYAQFVSAFNFAANGADATIYNKA 119

Query: 119 HKTIIQDYKQSHQ-----HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
            + ++++Y    Q        +    E+ Y+  NI K+ SVD L  + RL  Y L ++ +
Sbjct: 120 QQLVMKNYATQAQIAGLDPNSDYVKGETTYYLANITKVKSVDDLMSNSRLYTYALAAYGL 179

Query: 174 TPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQI 233
                    +K VL   +++P     +  +  +  +A  F F+ +G  +           
Sbjct: 180 DSATEDKDLIKQVLQSKVSDPDSVANKQTNPAYAGLALAFNFEANGENATTIS----PAQ 235

Query: 234 EKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN 288
           +  V  Y   T++     ++Q      Y++     ++S+ D L D  L  +++ +L   +
Sbjct: 236 QPTVDKYLRQTLEEDAGQTNQGVRLALYFQRKAPDITSWYDVLADTALASVVRTALGLPD 295

Query: 289 PEITAD 294
              TA+
Sbjct: 296 SFATAN 301



 Score =  126 bits (316), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 40/233 (17%), Positives = 84/233 (36%), Gaps = 23/233 (9%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
            + +   +      ++ +  YY  NI  + S ++ + N R+  + +++ G++     + F
Sbjct: 14  DISKSIDRIEKQPTVDRDTQYYLANITKVKSIDDFVKNDRLFKYAMKAYGLEDMDYAKAF 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + +  K  + DP SFAN   D RY + +S+FNF  +G  +       Q           Y
Sbjct: 74  MVKALKEGVTDPDSFANKLTDKRYAQFVSAFNFAANGADATIYNKAQQL------VMKNY 127

Query: 606 KHQ-MIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
             Q  I   +   D       Y+   I  +++  +++ +S+L+        L        
Sbjct: 128 ATQAQIAGLDPNSDYVKGETTYYLANITKVKSVDDLMSNSRLYTYALAAYGLDSATEDKD 187

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKD 717
             K++         +   D   V          + Q+      L  + N   +
Sbjct: 188 LIKQVLQ-------SKVSDPDSVA---------NKQTNPAYAGLALAFNFEAN 224



 Score =  114 bits (286), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 66/349 (18%), Positives = 120/349 (34%), Gaps = 54/349 (15%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           I + +S   +       +  D  YY   I  V S  DF+K+ +LFK   +  + L     
Sbjct: 11  ITRDISKSIDRIEKQPTVDRDTQYYLANITKVKSIDDFVKNDRLFKY-AMKAYGLEDMDY 69

Query: 293 ADKFLTLMQEND-----------PIVSQVKYFFQINFHRDNSSSTKIQQDSQI--QKMLD 339
           A  F+    +                   ++    NF  + + +T   +  Q+  +    
Sbjct: 70  AKAFMVKALKEGVTDPDSFANKLTDKRYAQFVSAFNFAANGADATIYNKAQQLVMKNYAT 129

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
             +      + D ++     Y   + K+KS+D+L+S                   +AL A
Sbjct: 130 QAQIAGLDPNSDYVKGETTYYLANITKVKSVDDLMSNSR-------------LYTYALAA 176

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           Y L+    D+D ++ VL S  SDPDS ANK  +     L  AFNF A+G          +
Sbjct: 177 YGLDSATEDKDLIKQVLQSKVSDPDSVANKQTNPAYAGLALAFNFEANGENATTISPAQQ 236

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
            T+   ++                               +      Y+      I S+ +
Sbjct: 237 PTVDKYLRQTLEE--------------------DAGQTNQGVRLALYFQRKAPDITSWYD 276

Query: 520 LLANKRILNFLLESKGIDS-------QKVREDFLCEIFKSDLKDPKSFA 561
           +LA+  + + +  + G+          K  + F  ++  +D  DP    
Sbjct: 277 VLADTALASVVRTALGLPDSFATANIDKQAQLFEQKLDLTDFTDPAKLT 325


>gi|255601155|ref|XP_002537616.1| conserved hypothetical protein [Ricinus communis]
 gi|223515719|gb|EEF24767.1| conserved hypothetical protein [Ricinus communis]
          Length = 386

 Score =  284 bits (726), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 98/362 (27%), Positives = 169/362 (46%), Gaps = 12/362 (3%)

Query: 342 KKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
             N Q          + +Y+  +  +K+I +  +         +   P    Q AL AY 
Sbjct: 1   MNNYQSSQSTLTTDAVNNYKNRIASVKTIKDFFASNTSDSSAANDSAPE-LYQMALRAYG 59

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
           +   ++ + +L  +L S+P DP SY N  KD R   L  AFNF++ G++       S+  
Sbjct: 60  IGENEVTKSRLTKILESDPYDPKSYVNSLKDSRFTALAKAFNFDSKGNLKAPVQSLSQTQ 119

Query: 462 IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL 521
           I   +  Y++R  +       +           +   +  +   Y+  NI  + S  +LL
Sbjct: 120 INSYISEYSSRTTAGLSGAELT-----------KATSDAKTAGTYFATNIVKVTSVTDLL 168

Query: 522 ANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
           A+ ++ NF+L +  ID + V    L + F SD  D KSF NT    ++K I+ +FNF   
Sbjct: 169 ADSKLTNFILTANSIDPKTVDTATLKKAFASDPSDSKSFINTTDGAKFKSIVEAFNFGTD 228

Query: 582 GELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEIL 641
           G L+  K+G  Q+   +  T DL+ HQ +E ++ E +P + LALYF+R   +I + Y+I+
Sbjct: 229 GNLTDSKLGTAQNQGALAATNDLFLHQTLEDQQGETNPGVRLALYFQRKASDINSIYDIM 288

Query: 642 GDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQS 701
           GDS L++V++    L    + +    +  +L K + ++D +D  KV   L    AM    
Sbjct: 289 GDSALYEVITTTYNLPSSISNMDVDTQASMLSKFVNVSDLQDPDKVNQLLQRFSAMYDME 348

Query: 702 ID 703
            +
Sbjct: 349 NN 350



 Score =  154 bits (389), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 67/366 (18%), Positives = 138/366 (37%), Gaps = 50/366 (13%)

Query: 23  SKDPIVSCEERYYRERIKHISTIDEFIKDK------------RLFSYALKAFGLSDMSHA 70
           S+  + +     Y+ RI  + TI +F                 L+  AL+A+G+ +    
Sbjct: 7   SQSTLTTDAVNNYKNRIASVKTIKDFFASNTSDSSAANDSAPELYQMALRAYGIGENEVT 66

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ--------------SD 116
           +  + KILESD  DPKS VN L   ++   A++++F     +                S+
Sbjct: 67  KSRLTKILESDPYDPKSYVNSLKDSRFTALAKAFNFDSKGNLKAPVQSLSQTQINSYISE 126

Query: 117 IQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
              +T               A     YF  NI K+ SV  L  D +L +++L + SI PK
Sbjct: 127 YSSRTTAGLSGAELTKATSDAKTAGTYFATNIVKVTSVTDLLADSKLTNFILTANSIDPK 186

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR--DKILTDMQIE 234
            +    LK       ++ K +   +   +F+++ E F F  DG+L+            + 
Sbjct: 187 TVDTATLKKAFASDPSDSKSFINTTDGAKFKSIVEAFNFGTDGNLTDSKLGTAQNQGALA 246

Query: 235 KIVSNYFNNTIDCVPIVSD-----QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP 289
                + + T++     ++       Y++   + ++S  D + D  L++++  +    + 
Sbjct: 247 ATNDLFLHQTLEDQQGETNPGVRLALYFQRKASDINSIYDIMGDSALYEVITTTYNLPSS 306

Query: 290 EITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILH 349
               D         D   S +  F  +         + +Q   ++ ++L  +     + +
Sbjct: 307 ISNMDV--------DTQASMLSKFVNV---------SDLQDPDKVNQLLQRFSAMYDMEN 349

Query: 350 DDKMQS 355
           +    +
Sbjct: 350 NTTSST 355



 Score = 79.9 bits (195), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 58/376 (15%), Positives = 117/376 (31%), Gaps = 60/376 (15%)

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP 289
             Q         N       + + ++++    +  S+ +D    P+L++M  L  + +  
Sbjct: 6   SSQSTLTTDAVNNYKNRIASVKTIKDFFASNTSDSSAAND--SAPELYQM-ALRAYGIGE 62

Query: 290 EITADKFLTLMQENDPI-----------VSQVKYFFQINFHRDNSSSTKIQQDSQIQ--- 335
                  LT + E+DP                      NF    +    +Q  SQ Q   
Sbjct: 63  NEVTKSRLTKILESDPYDPKSYVNSLKDSRFTALAKAFNFDSKGNLKAPVQSLSQTQINS 122

Query: 336 -------KMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEE 388
                  +                 ++    +   + K+ S+ +LL+             
Sbjct: 123 YISEYSSRTTAGLSGAELTKATSDAKTAGTYFATNIVKVTSVTDLLADSK---------- 172

Query: 389 PIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
                 F L A +++ + +D   L+    S+PSD  S+ N +   +   +  AFNF  DG
Sbjct: 173 ---LTNFILTANSIDPKTVDTATLKKAFASDPSDSKSFINTTDGAKFKSIVEAFNFGTDG 229

Query: 449 SIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYT 508
           ++              + K    + +    A N  F        Q   N  +     Y+ 
Sbjct: 230 NL-------------TDSKLGTAQNQGALAATNDLFLHQTLEDQQGETNPGV-RLALYFQ 275

Query: 509 LNINTIHSFEELLANKRILNFLLESKGI-------DSQKVREDFLCEIFKSDLKDPKSFA 561
              + I+S  +++ +  +   +  +  +       D           +  SDL+DP    
Sbjct: 276 RKASDINSIYDIMGDSALYEVITTTYNLPSSISNMDVDTQASMLSKFVNVSDLQDPDK-V 334

Query: 562 NTYKDNRYKEIISSFN 577
           N     R+  +    N
Sbjct: 335 NQLL-QRFSAMYDMEN 349


>gi|218459363|ref|ZP_03499454.1| hypothetical protein RetlK5_07677 [Rhizobium etli Kim 5]
          Length = 332

 Score =  280 bits (716), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 95/339 (28%), Positives = 163/339 (48%), Gaps = 14/339 (4%)

Query: 376 GKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRL 435
                +   S +        AL A+ L  QD+ R  +R +LTS+  DPD Y    KD+R+
Sbjct: 1   TNAAADFKKSNDNLPDPYHVALQAFGLTDQDVPRSMMRKILTSDAYDPDGYIASLKDERI 60

Query: 436 IKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKR 495
             L  AFNF  DG            T+      Y      +  A             + +
Sbjct: 61  TNLARAFNFGPDGKAASPFQALPDATLAKYATDYKAHMTMLLKAGP----------VKDK 110

Query: 496 INLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLK 555
            + +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  
Sbjct: 111 ASKDATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPD 170

Query: 556 DPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEE 615
           D KS+ N+  D R+++I+++FNFD  G L+  KIG +Q+    ++T +LY  Q +E ++ 
Sbjct: 171 DKKSYLNSKADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEENTQELYVRQTLEAQQG 230

Query: 616 EKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKH 675
           E +  + LALYF R  P+I + Y ILGD  L++V++    L    + +   K+  ++ + 
Sbjct: 231 ETNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVTKQADLINRF 290

Query: 676 IKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQ 714
           +K+ D +D KKV+  L    AM     D + +   SP  
Sbjct: 291 VKLEDLQDPKKVDKLLRRFTAM----YDVQNSAQQSPAL 325



 Score =  163 bits (412), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 65/261 (24%), Positives = 106/261 (40%), Gaps = 23/261 (8%)

Query: 55  FSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ 114
           +  AL+AFGL+D       ++KIL SD  DP   +  L   +    AR+++F P  K   
Sbjct: 18  YHVALQAFGLTDQDVPRSMMRKILTSDAYDPDGYIASLKDERITNLARAFNFGPDGKAAS 77

Query: 115 S-----DIQHKTIIQDYK----------QSHQHKEEVALEESKYFRKNIHKINSVDQLFK 159
                 D        DYK                 + A  E  YF K + K+ S+D    
Sbjct: 78  PFQALPDATLAKYATDYKAHMTMLLKAGPVKDKASKDATAEVDYFAKGMAKVKSLDDFLD 137

Query: 160 DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG 219
           D RL D VL++ ++ PK      LK + T    + K Y     D RF+ +   F F  DG
Sbjct: 138 DSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNSKADARFQDIVAAFNFDKDG 197

Query: 220 SLSKR--DKILTDMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLK 272
           +L++     I      E     Y   T++     ++       Y+     S++S    L 
Sbjct: 198 NLTRAKIGTIQNKAAEENTQELYVRQTLEAQQGETNDGVRLALYFSRKAPSITSIYSILG 257

Query: 273 DPKLFKMLQLSLFPLNPEITA 293
           D  L++++  + + L  +I++
Sbjct: 258 DKALYQVITTA-YSLPAQISS 277



 Score =  108 bits (268), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 86/217 (39%), Gaps = 23/217 (10%)

Query: 31  EERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
           E  Y+ + +  + ++D+F+ D RL    LKA  L    + +  +KKI  SD  D KS +N
Sbjct: 118 EVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLN 177

Query: 91  QLNSLKYQYFARSYDFSPPPKVIQS-----------DIQHKTIIQDYKQSHQHKEEVALE 139
                ++Q    +++F     + ++           +   +  ++   ++ Q +    + 
Sbjct: 178 SKADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEENTQELYVRQTLEAQQGETNDGVR 237

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD-------VLTLGLA 192
            + YF +    I S+  +  D+ L   +  ++S+  +  S+   K        V    L 
Sbjct: 238 LALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVTKQADLINRFVKLEDLQ 297

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT 229
           +PKK      D   R     +  Q     S   +ILT
Sbjct: 298 DPKKV-----DKLLRRFTAMYDVQNSAQQSPALQILT 329



 Score = 89.9 bits (221), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/253 (17%), Positives = 92/253 (36%), Gaps = 23/253 (9%)

Query: 313 FFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDN 372
               NF  D  +++  Q  +     L  Y  + +      +++     +        +D 
Sbjct: 64  ARAFNFGPDGKAASPFQ--ALPDATLAKYATDYKAHMTMLLKAGPVKDKASKDATAEVDY 121

Query: 373 LLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKD 432
              G  +++  +   +        L A NL+ +D D+  L+ + TS+P D  SY N   D
Sbjct: 122 FAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNSKAD 181

Query: 433 DRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQIST 492
            R   +  AFNF+ DG++                K    + ++  +   + +      + 
Sbjct: 182 ARFQDIVAAFNFDKDGNL-------------TRAKIGTIQNKAAEENTQELYVRQTLEAQ 228

Query: 493 QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCE---- 548
           Q   N  +     Y++    +I S   +L +K +   +  +  + +Q    D   +    
Sbjct: 229 QGETNDGV-RLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVTKQADLI 287

Query: 549 ---IFKSDLKDPK 558
              +   DL+DPK
Sbjct: 288 NRFVKLEDLQDPK 300


>gi|254477619|ref|ZP_05091005.1| flagellar protein, putative [Ruegeria sp. R11]
 gi|214031862|gb|EEB72697.1| flagellar protein, putative [Ruegeria sp. R11]
          Length = 590

 Score =  268 bits (685), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 106/642 (16%), Positives = 222/642 (34%), Gaps = 115/642 (17%)

Query: 123 IQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
            +  +Q    K  +     + F   I  I + DQL  D  +L   L +F +     +  F
Sbjct: 21  TRTQQQQIFEKSPILDRAVQDFTNKIDSIQTADQLLDDYNVLQVALGAFGLEEDIANRAF 80

Query: 183 LKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN 242
           +K VL   L++P+ +     DNR+  +A+ F F                           
Sbjct: 81  IKQVLESDLSDPRSFANRLNDNRYLGLAQTFGFGS------------------------E 116

Query: 243 NTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
           +        +++ Y      +V+S  D L +  L     L  F L      + FL  + E
Sbjct: 117 DGPQLPSASAEKPYV-----NVASPEDLLSNKTLLNQ-ALDDFGLQRYAGNEFFLQKVLE 170

Query: 303 NDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL 362
           +D                D++S      D+++      +K N    +   M +++ ++  
Sbjct: 171 SDLS--------------DDNSFVNRLSDTRLADFASQFKFNAPPEYTSSMDAMLGEFTA 216

Query: 363 PLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSD 422
                      ++        +        L   ++ ++L     +   L+ +L ++P D
Sbjct: 217 -----------MNDGAGPANADELLGNETLLNAVIETFDLEY--TNPIFLKRMLEADPYD 263

Query: 423 PDSYANKSKDDRLIKLNHAFNF---NADGSIGPIPMMQSRLTIRDNVKHY---------- 469
            +S   + +D R++ ++ AF F   + +    P  +      + + +  +          
Sbjct: 264 ENSAVRQQEDPRVLAMSRAFGFGMPDINSFSSPDELFARPELLEEVLDQFNNSNPGEDFL 323

Query: 470 --------ANRKRSIHDAENKSFNSMEQISTQKRINL--EINSEVDYYTLNINTIHSFEE 519
                   ++    ++   N +F  + +    +      ++    D     ++   +  +
Sbjct: 324 RQVLESDLSDPNSFVNQPGNLAFFDLAEAYQTEWTPPPSKVKVLADEVGTKLSGYENPRQ 383

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFD 579
            + +       L+   ++ +++   F+ ++F+SDL    S+AN Y+D   + + ++F F+
Sbjct: 384 FVFDFDAFEAGLDVFNMNERQLDFSFMLKVFESDLSSETSYANLYRDPNVQAMANAFAFN 443

Query: 580 IHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--- 636
             G       G        ++  DLY  +  E    E DPN+ LAL  +R + +I +   
Sbjct: 444 PGGNDRTYPPG------FAEEIADLYTDRNFEIAIGESDPNMRLALALERELQSIADAGG 497

Query: 637 -----HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN-------DFKDS 684
                 Y I+G   L  V    L L   F  L   +++  +K     +       D    
Sbjct: 498 SEDAHWYGIIGSPPLKTVFESALGLPSSFGQLDVDRQVNEMKDRAFASFGTTHPADLLKP 557

Query: 685 KKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDP 726
            K+E+F              +         N D  +  F DP
Sbjct: 558 DKLEEF--------------RNRFLLLSELNSDTASAGFSDP 585



 Score =  233 bits (595), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 99/485 (20%), Positives = 180/485 (37%), Gaps = 70/485 (14%)

Query: 1   MIPSHVAPFPSKD-IQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           ++ + +A +   D  +++      K PI+    + +  +I  I T D+ + D  +   AL
Sbjct: 7   VLGTGIAGWNFLDRTRTQQQQIFEKSPILDRAVQDFTNKIDSIQTADQLLDDYNVLQVAL 66

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
            AFGL +      FIK++LESDLSDP+S  N+LN  +Y   A+++ F             
Sbjct: 67  GAFGLEEDIANRAFIKQVLESDLSDPRSFANRLNDNRYLGLAQTFGFGS----------- 115

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
               +D  Q      E          K    + S + L  ++ LL+  L  F +     +
Sbjct: 116 ----EDGPQLPSASAE----------KPYVNVASPEDLLSNKTLLNQALDDFGLQRYAGN 161

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VL   L++   +     D R    A  F+F      +     +     E    N
Sbjct: 162 EFFLQKVLESDLSDDNSFVNRLSDTRLADFASQFKFNAPPEYTSSMDAM---LGEFTAMN 218

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFK-MLQLSLFPLNPEITADKFLT 298
                 +   ++ ++         + +F     +P   K ML+   +        D+   
Sbjct: 219 DGAGPANADELLGNETLLNAV---IETFDLEYTNPIFLKRMLEADPY--------DENSA 267

Query: 299 LMQENDPIVSQVKYFFQINFHRDNSSSTK---IQQDSQIQKMLDLYKKNC---------- 345
           + Q+ DP V  +   F       NS S+      +   ++++LD +  +           
Sbjct: 268 VRQQEDPRVLAMSRAFGFGMPDINSFSSPDELFARPELLEEVLDQFNNSNPGEDFLRQVL 327

Query: 346 ---------------QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGK-CQLEGPNSAEEP 389
                           +   D  ++   ++  P  K+K + + +  K    E P      
Sbjct: 328 ESDLSDPNSFVNQPGNLAFFDLAEAYQTEWTPPPSKVKVLADEVGTKLSGYENPRQFVFD 387

Query: 390 IITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGS 449
               +  LD +N+N + LD   +  V  S+ S   SYAN  +D  +  + +AF FN  G+
Sbjct: 388 FDAFEAGLDVFNMNERQLDFSFMLKVFESDLSSETSYANLYRDPNVQAMANAFAFNPGGN 447

Query: 450 IGPIP 454
               P
Sbjct: 448 DRTYP 452



 Score = 60.3 bits (144), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/212 (12%), Positives = 57/212 (26%), Gaps = 18/212 (8%)

Query: 38  RIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKY 97
           ++       +F+ D   F   L  F +++      F+ K+ ESDLS   S  N       
Sbjct: 374 KLSGYENPRQFVFDFDAFEAGLDVFNMNERQLDFSFMLKVFESDLSSETSYANLYRDPNV 433

Query: 98  QYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQ-----HKEEVALEESKYFRKNIHKIN 152
           Q  A ++ F+P              I D            + +  +  +    + +  I 
Sbjct: 434 QAMANAFAFNPGGNDRTYPPGFAEEIADLYTDRNFEIAIGESDPNMRLALALERELQSIA 493

Query: 153 --------SVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE---- 200
                       +     L      +  +   +  L   + V  +       +       
Sbjct: 494 DAGGSEDAHWYGIIGSPPLKTVFESALGLPSSFGQLDVDRQVNEMKDRAFASFGTTHPAD 553

Query: 201 -SRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
             + ++       F    + +        +D 
Sbjct: 554 LLKPDKLEEFRNRFLLLSELNSDTASAGFSDP 585


>gi|254464676|ref|ZP_05078087.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685584|gb|EDZ46066.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 574

 Score =  263 bits (672), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 118/619 (19%), Positives = 220/619 (35%), Gaps = 105/619 (16%)

Query: 123 IQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
            +D +Q    K  V     K F + I  I S DQL  D  LL   L +F +     +  F
Sbjct: 21  TRDQQQEVYEKSPVLDRTVKDFTQRITSIQSADQLLDDYNLLTVTLGAFGLDEDINNRAF 80

Query: 183 LKDVLTLGLANPKKYFIESRDNRFRAMAENFRF-QPDGSLSKRDKILTDMQIEKIVSNYF 241
           +K VL   +++PK       D+R++A+AE F F   DG                      
Sbjct: 81  IKQVLESDMSDPKSIVNRLNDSRYQALAETFGFGSADG---------------------- 118

Query: 242 NNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQ 301
                 +P    +N +      +++  D L +  L +   L    L        FL  + 
Sbjct: 119 ----PKLPSARAENEF----AGIATPDDLLSNRTLLRK-ALGNAGLEGLENNQFFLQKVL 169

Query: 302 ENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ 361
           E+D                D SS      D +       +       ++  +++L+ ++ 
Sbjct: 170 ESDL--------------DDPSSFANKLSDPRYAAFAGQFNFGQVPAYESSIEALVSEFN 215

Query: 362 LPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPS 421
                + S              +        LQ  +D + L       D LR VL S+ +
Sbjct: 216 QHTDGLAS-------------ADDLLADEDLLQAVIDTFGLE--RTYPDFLRRVLNSDTT 260

Query: 422 DPDSYANKSKDDRLIKLNHAFNFNA---DGSIGPIPMMQSRLTIRDNVKHY--------- 469
           DPDS+ N+ +D R + ++ AF F     +    P  ++ +   +   +  +         
Sbjct: 261 DPDSFVNQLEDKRYLAVSEAFGFGWPDINAMTDPEELLSNPQLLEHALDTFNVSDRGETY 320

Query: 470 ---------ANRKRSIHDAENKSFNSMEQISTQKRINLEINSEV--DYYTLNINTIHSFE 518
                    ++    ++  EN ++ +  +    +        +V  D  T  + T  +  
Sbjct: 321 LRQVLESDLSDPNSFVNQPENLAYYNFAEAFQNEWPEPVSKMQVFADEITDKLGTFTNPR 380

Query: 519 ELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNF 578
           EL+ +  +    L+  G   +    D + + F SDL    SFAN + D   K +  +F+F
Sbjct: 381 ELVFDLGLFEATLDLFGQSKRSTDFDTVLKAFDSDLSSRTSFANMHYDTGLKAMAQAFSF 440

Query: 579 DIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI---- 634
           +  GE+S +           ++  +LY  +  E +    DPN+ LAL  +R + ++    
Sbjct: 441 NA-GEVSREY-----PEGFAEELAELYTTRQFEIEIGNSDPNMRLALALERELQDVVDAG 494

Query: 635 ----RNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHI-------KINDFKD 683
                + Y I+G   L  +    L L    A L   +++  +K             DF +
Sbjct: 495 GSENAHWYNIIGSPPLRSIFETALGLPSGIAQLDIERQLEEMKDRAFSAFGTTHPADFLE 554

Query: 684 SKKVEDFLYAAKAMDHQSI 702
            + ++ F      +   + 
Sbjct: 555 PEMLDQFRKRFLLLSDLNS 573



 Score =  196 bits (498), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 90/465 (19%), Positives = 171/465 (36%), Gaps = 52/465 (11%)

Query: 3   PSHVAPFP----SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYA 58
            + +A +     ++D Q +++    K P++    + + +RI  I + D+ + D  L +  
Sbjct: 9   GTGIAGWSFLQRTRDQQQEVYE---KSPVLDRTVKDFTQRITSIQSADQLLDDYNLLTVT 65

Query: 59  LKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQ 118
           L AFGL +  +   FIK++LESD+SDPKS+VN+LN  +YQ  A ++ F           +
Sbjct: 66  LGAFGLDEDINNRAFIKQVLESDMSDPKSIVNRLNDSRYQALAETFGFGSADGPKLPSAR 125

Query: 119 HKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYI 178
            +                              I + D L  +R LL   L +  +     
Sbjct: 126 AENE-------------------------FAGIATPDDLLSNRTLLRKALGNAGLEGLEN 160

Query: 179 SLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRF-------QPDGSLSKRDKILTDM 231
           +  FL+ VL   L +P  +  +  D R+ A A  F F           +L       TD 
Sbjct: 161 NQFFLQKVLESDLDDPSSFANKLSDPRYAAFAGQFNFGQVPAYESSIEALVSEFNQHTDG 220

Query: 232 QIEKIVSNYFNNTIDCV--PIVSDQNY---YKLAINSVS----SFSDFLKDPKLFKMLQL 282
                      + +  V      ++ Y    +  +NS +    SF + L+D +   + + 
Sbjct: 221 LASADDLLADEDLLQAVIDTFGLERTYPDFLRRVLNSDTTDPDSFVNQLEDKRYLAVSEA 280

Query: 283 SLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYK 342
             F             L+                N      +  +   +S +        
Sbjct: 281 FGFGWPDINAMTDPEELL---SNPQLLEHALDTFNVSDRGETYLRQVLESDLSDPNSFVN 337

Query: 343 KNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQ-LEGPNSAEEPIITLQFALDAYN 401
           +   + + +  ++   ++  P+ K++   + ++ K      P      +   +  LD + 
Sbjct: 338 QPENLAYYNFAEAFQNEWPEPVSKMQVFADEITDKLGTFTNPRELVFDLGLFEATLDLFG 397

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNA 446
            + +  D D +     S+ S   S+AN   D  L  +  AF+FNA
Sbjct: 398 QSKRSTDFDTVLKAFDSDLSSRTSFANMHYDTGLKAMAQAFSFNA 442



 Score = 86.8 bits (213), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 52/361 (14%), Positives = 120/361 (33%), Gaps = 62/361 (17%)

Query: 58  ALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDI 117
            +  FGL        F++++L SD +DP S VNQL   +Y   + ++ F  P        
Sbjct: 237 VIDTFGLERTYPD--FLRRVLNSDTTDPDSFVNQLEDKRYLAVSEAFGFGWPD------- 287

Query: 118 QHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
                                         I+ +   ++L  + +LL++ L +F+++ + 
Sbjct: 288 ------------------------------INAMTDPEELLSNPQLLEHALDTFNVSDR- 316

Query: 178 ISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIV 237
               +L+ VL   L++P  +  +  +  +   AE F+       ++  + ++ MQ+    
Sbjct: 317 -GETYLRQVLESDLSDPNSFVNQPENLAYYNFAEAFQ-------NEWPEPVSKMQV---- 364

Query: 238 SNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
             + +   D +   ++       +    +  D     K        L   + ++++    
Sbjct: 365 --FADEITDKLGTFTNPRELVFDLGLFEATLDLFGQSKRSTDFDTVLKAFDSDLSSRTSF 422

Query: 298 TLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLI 357
             M   D  +  +   F  N   + S         ++ ++    +   +I + D    L 
Sbjct: 423 ANMHY-DTGLKAMAQAFSFN-AGEVSREYPEGFAEELAELYTTRQFEIEIGNSDPNMRLA 480

Query: 358 KDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
              +  L  +  +D   S          +       + AL    L    + +  +   L 
Sbjct: 481 LALERELQDV--VDAGGSENAHWYNIIGSPPLRSIFETAL---GL-PSGIAQLDIERQLE 534

Query: 418 S 418
            
Sbjct: 535 E 535


>gi|260428823|ref|ZP_05782800.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260419446|gb|EEX12699.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 399

 Score =  244 bits (621), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 86/408 (21%), Positives = 160/408 (39%), Gaps = 54/408 (13%)

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
            L  +        ++    + ++  +G I S + L++ +               L  AL 
Sbjct: 16  TLESQRTAFNKSAEITRDSEYFKEKIGTINSAEELVNDRR-------------LLSVALS 62

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGS-------IG 451
           A+ ++ Q   +  +R VL     D D+ ANK  D R   L   F+F   G          
Sbjct: 63  AFGMDDQIDSKYLIRRVLEEGTKDDDALANKLSDSRFTVLAEVFDFEKTGGYRMQEEGFA 122

Query: 452 PIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNI 511
                     +  +++        + D E  +        TQ + N+EI+ E  Y+  NI
Sbjct: 123 DPIFAAYEKKVLADLEVKLAEPEYVADPEYAAL-----FETQVKRNIEISRE--YFNDNI 175

Query: 512 NTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKE 571
            +I S +ELL +  ++  ++ + GI+ ++  +  L  + +    DP + AN   D R   
Sbjct: 176 GSITSPDELLLDFDLMQVVMGAFGIEDRRGSKALLKRVLEEGASDPNALANVLGDKRLIR 235

Query: 572 IISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTI 631
           +  +F+FD            +Q +   ++  + Y+ Q  E    E DP I  AL F+R+I
Sbjct: 236 LAEAFSFDK-----SVPTNALQADSFANNIVEQYRWQRFEDAVGEVDPAIGTALQFQRSI 290

Query: 632 PNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK------ 677
           P++           Y ILG +    VV   L L   F+ +   K++ ILK  +       
Sbjct: 291 PDLATSDISDSAKWYSILGSTTSRSVVETALSLPKGFSQIDIDKQVEILKDKMDRRFGVK 350

Query: 678 -INDFKDSKKVEDFLYAAKAMD-------HQSIDYKKALFSSPNQNKD 717
            ++D +D   +   +++    +       +QS      L S+   ++D
Sbjct: 351 EVSDLEDPATLRKIVHSYLLQEQIAQSSGYQSNQIAITLLSTIRYDQD 398



 Score =  188 bits (476), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 72/322 (22%), Positives = 131/322 (40%), Gaps = 43/322 (13%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
           +  +K   ++ +  Y++E+I  I++ +E + D+RL S AL AFG+ D   ++  I+++LE
Sbjct: 22  TAFNKSAEITRDSEYFKEKIGTINSAEELVNDRRLLSVALSAFGMDDQIDSKYLIRRVLE 81

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFS-PPPKVIQSDIQHKTIIQDYKQSHQHKEEVAL 138
               D  +L N+L+  ++   A  +DF       +Q +     I   Y++      EV L
Sbjct: 82  EGTKDDDALANKLSDSRFTVLAEVFDFEKTGGYRMQEEGFADPIFAAYEKKVLADLEVKL 141

Query: 139 EE------------------------SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
            E                         +YF  NI  I S D+L  D  L+  V+ +F I 
Sbjct: 142 AEPEYVADPEYAALFETQVKRNIEISREYFNDNIGSITSPDELLLDFDLMQVVMGAFGIE 201

Query: 175 PKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIE 234
            +  S   LK VL  G ++P        D R   +AE F F  D S+     +  D    
Sbjct: 202 DRRGSKALLKRVLEEGASDPNALANVLGDKRLIRLAEAFSF--DKSVPTN-ALQADSFAN 258

Query: 235 KIVSNY-----FNNTIDCVPIVSDQNYYKLAINSVSS--------FSDFLKDPKLFKMLQ 281
            IV  Y      +   +  P +     ++ +I  +++        +   L       +++
Sbjct: 259 NIVEQYRWQRFEDAVGEVDPAIGTALQFQRSIPDLATSDISDSAKWYSILGSTTSRSVVE 318

Query: 282 LSLFPLN--PEITADKFLTLMQ 301
            +L       +I  DK + +++
Sbjct: 319 TALSLPKGFSQIDIDKQVEILK 340



 Score =  108 bits (270), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 48/253 (18%), Positives = 95/253 (37%), Gaps = 31/253 (12%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           +++E   T    + EI  + +Y+   I TI+S EEL+ ++R+L+  L + G+D Q   + 
Sbjct: 15  STLESQRTAFNKSAEITRDSEYFKEKIGTINSAEELVNDRRLLSVALSAFGMDDQIDSKY 74

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            +  + +   KD  + AN   D+R+  +   F+F+  G        ++Q+    D     
Sbjct: 75  LIRRVLEEGTKDDDALANKLSDSRFTVLAEVFDFEKTGGY------RMQEEGFADPIFAA 128

Query: 605 YKHQ----------------------MIEKKEEEKDPNIALALYFKRTIPNIRNHYEILG 642
           Y+ +                      + E + +          YF   I +I +  E+L 
Sbjct: 129 YEKKVLADLEVKLAEPEYVADPEYAALFETQVKRNIEISRE--YFNDNIGSITSPDELLL 186

Query: 643 DSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSI 702
           D  L +VV     +          K++ + +     N   +    +  +  A+A      
Sbjct: 187 DFDLMQVVMGAFGIEDRRGSKALLKRV-LEEGASDPNALANVLGDKRLIRLAEAFSFDKS 245

Query: 703 DYKKALFSSPNQN 715
               AL +    N
Sbjct: 246 VPTNALQADSFAN 258



 Score =  103 bits (257), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 57/315 (18%), Positives = 114/315 (36%), Gaps = 35/315 (11%)

Query: 117 IQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            Q      + +++  +K      +S+YF++ I  INS ++L  DRRLL   L +F +  +
Sbjct: 10  WQMLQSTLESQRTAFNKSAEITRDSEYFKEKIGTINSAEELVNDRRLLSVALSAFGMDDQ 69

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGS-------------LSK 223
             S   ++ VL  G  +      +  D+RF  +AE F F+  G               + 
Sbjct: 70  IDSKYLIRRVLEEGTKDDDALANKLSDSRFTVLAEVFDFEKTGGYRMQEEGFADPIFAAY 129

Query: 224 RDKILTDMQIEKIVSNYFN--------NTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPK 275
             K+L D++++     Y           T     I   + Y+   I S++S  + L D  
Sbjct: 130 EKKVLADLEVKLAEPEYVADPEYAALFETQVKRNIEISREYFNDNIGSITSPDELLLDFD 189

Query: 276 LFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYF--------FQINFHRDNSSSTK 327
           L +++  +    +   +      +++E     + +               F  D S  T 
Sbjct: 190 LMQVVMGAFGIEDRRGSKALLKRVLEEGASDPNALANVLGDKRLIRLAEAFSFDKSVPTN 249

Query: 328 I-QQDSQIQKMLDLY---KKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGP 383
             Q DS    +++ Y   +    +   D        +Q  +  + + D  +S   +    
Sbjct: 250 ALQADSFANNIVEQYRWQRFEDAVGEVDPAIGTALQFQRSIPDLATSD--ISDSAKWYSI 307

Query: 384 NSAEEPIITLQFALD 398
             +      ++ AL 
Sbjct: 308 LGSTTSRSVVETALS 322


>gi|256014917|ref|YP_003104926.1| hypothetical protein BMI_II127 [Brucella microti CCM 4915]
 gi|255997577|gb|ACU49264.1| hypothetical protein BMI_II127 [Brucella microti CCM 4915]
          Length = 258

 Score =  238 bits (608), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 94/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 9   SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 68

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 69  FVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 122

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V          +   
Sbjct: 123 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNAD 182

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 183 IDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH 216



 Score =  177 bits (448), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 52/186 (27%), Positives = 93/186 (50%), Gaps = 5/186 (2%)

Query: 6   VAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLS 65
            +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL 
Sbjct: 2   TSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLE 61

Query: 66  DMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQ 124
           DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    + +I 
Sbjct: 62  DMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVID 121

Query: 125 DYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            Y +    KE       +  + YF +    + +  ++  D+ LL  V  +F       + 
Sbjct: 122 KYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNA 181

Query: 181 PFLKDV 186
              K  
Sbjct: 182 DIDKQA 187



 Score =  131 bits (328), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 16  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 75

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 76  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 131

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  M+Q +    +    AD
Sbjct: 132 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNAD 182



 Score = 93.8 bits (231), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 82/238 (34%), Gaps = 42/238 (17%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 18  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 64

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 65  YAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 124

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 125 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 164

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
           L  +  + G        D  K  +    +I  S + DP  + + +  +R+  +    N
Sbjct: 165 LTMVQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHEMNN 220



 Score = 52.9 bits (125), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 65/220 (29%), Gaps = 21/220 (9%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           I   ++           +  +  YYK  I +V S  DF+ D +LF    +  F L     
Sbjct: 7   IASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKAFGLEDMAY 65

Query: 293 ADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           A  F+  +                      F   F      +   Q  +  Q ++D Y +
Sbjct: 66  AKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVR 125

Query: 344 NCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAY 400
                          L   ++     + +   +L  K  L    +      T+  A    
Sbjct: 126 QTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNA---- 181

Query: 401 NLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
             ++    +     +  S  SDPD Y +K    R   ++ 
Sbjct: 182 --DIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 217


>gi|306841068|ref|ZP_07473791.1| flagellar basal-body rod protein FLGF [Brucella sp. BO2]
 gi|306288906|gb|EFM60209.1| flagellar basal-body rod protein FLGF [Brucella sp. BO2]
          Length = 262

 Score =  238 bits (607), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 94/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 13  SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 73  FVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 126

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V          +   
Sbjct: 127 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNAD 186

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 187 IDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH 220



 Score =  181 bits (458), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 96/191 (50%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +    KE       +  + YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPS 180

Query: 176 KYISLPFLKDV 186
              +    K  
Sbjct: 181 TMSNADIDKQA 191



 Score =  131 bits (328), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 135

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  M+Q +    +    AD
Sbjct: 136 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNAD 186



 Score = 93.4 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 82/238 (34%), Gaps = 42/238 (17%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 69  YAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 129 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 168

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
           L  +  + G        D  K  +    +I  S + DP  + + +  +R+  +    N
Sbjct: 169 LTMVQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHEMNN 224



 Score = 53.3 bits (126), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 37/228 (16%), Positives = 68/228 (29%), Gaps = 21/228 (9%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           D + +   I   ++           +  +  YYK  I +V S  DF+ D +LF    +  
Sbjct: 3   DTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKA 61

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQ 335
           F L     A  F+  +                      F   F      +   Q  +  Q
Sbjct: 62  FGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ 121

Query: 336 KMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
            ++D Y +               L   ++     + +   +L  K  L    +      T
Sbjct: 122 GVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPST 181

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
           +  A      ++    +     +  S  SDPD Y +K    R   ++ 
Sbjct: 182 MSNA------DIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 221


>gi|17989453|ref|NP_542086.1| flagellar basal-body rod protein FLGF [Brucella melitensis bv. 1
           str. 16M]
 gi|148558502|ref|YP_001257193.1| hypothetical protein BOV_A0118 [Brucella ovis ATCC 25840]
 gi|225628602|ref|ZP_03786636.1| flagellar basal-body rod protein FLGF [Brucella ceti str. Cudo]
 gi|225685988|ref|YP_002733960.1| hypothetical protein BMEA_B0130 [Brucella melitensis ATCC 23457]
 gi|254699438|ref|ZP_05161266.1| hypothetical protein Bsuib55_01044 [Brucella suis bv. 5 str. 513]
 gi|254706315|ref|ZP_05168143.1| hypothetical protein BpinM_04810 [Brucella pinnipedialis
           M163/99/10]
 gi|254711393|ref|ZP_05173204.1| hypothetical protein BpinB_14282 [Brucella pinnipedialis B2/94]
 gi|254720630|ref|ZP_05182441.1| hypothetical protein Bru83_14188 [Brucella sp. 83/13]
 gi|256029977|ref|ZP_05443591.1| hypothetical protein BpinM2_04885 [Brucella pinnipedialis
           M292/94/1]
 gi|256043050|ref|ZP_05445995.1| hypothetical protein Bmelb1R_01137 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059630|ref|ZP_05449827.1| hypothetical protein Bneo5_04665 [Brucella neotomae 5K33]
 gi|256111964|ref|ZP_05452915.1| hypothetical protein Bmelb3E_04760 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158142|ref|ZP_05456058.1| hypothetical protein BcetM4_04805 [Brucella ceti M490/95/1]
 gi|256252907|ref|ZP_05458443.1| hypothetical protein BcetB_01052 [Brucella ceti B1/94]
 gi|256262886|ref|ZP_05465418.1| flagellar basal-body rod protein FLGF [Brucella melitensis bv. 2
           str. 63/9]
 gi|260564282|ref|ZP_05834767.1| flagellar basal body rod protein FlgF [Brucella melitensis bv. 1
           str. 16M]
 gi|261219996|ref|ZP_05934277.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313762|ref|ZP_05952959.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318999|ref|ZP_05958196.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261323600|ref|ZP_05962797.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261749889|ref|ZP_05993598.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|265985674|ref|ZP_06098409.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265986998|ref|ZP_06099555.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265989488|ref|ZP_06102045.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993413|ref|ZP_06105970.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996659|ref|ZP_06109216.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294853151|ref|ZP_06793823.1| hypothetical protein BAZG_02096 [Brucella sp. NVSL 07-0026]
 gi|306837354|ref|ZP_07470233.1| flagellar basal-body rod protein FLGF [Brucella sp. NF 2653]
 gi|306846299|ref|ZP_07478860.1| flagellar basal-body rod protein FLGF [Brucella sp. BO1]
 gi|17985332|gb|AAL54350.1| flagellar basal-body rod protein flgf [Brucella melitensis bv. 1
           str. 16M]
 gi|148369787|gb|ABQ62659.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|225616448|gb|EEH13496.1| flagellar basal-body rod protein FLGF [Brucella ceti str. Cudo]
 gi|225642093|gb|ACO02006.1| protein of unknown function DUF1217 [Brucella melitensis ATCC
           23457]
 gi|260151925|gb|EEW87018.1| flagellar basal body rod protein FlgF [Brucella melitensis bv. 1
           str. 16M]
 gi|260918580|gb|EEX85233.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261298222|gb|EEY01719.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261299580|gb|EEY03077.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261302788|gb|EEY06285.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739642|gb|EEY27568.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262550956|gb|EEZ07117.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262764283|gb|EEZ10315.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000157|gb|EEZ12847.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092723|gb|EEZ16932.1| flagellar basal-body rod protein FLGF [Brucella melitensis bv. 2
           str. 63/9]
 gi|264659195|gb|EEZ29456.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264664266|gb|EEZ34527.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294818806|gb|EFG35806.1| hypothetical protein BAZG_02096 [Brucella sp. NVSL 07-0026]
 gi|306273294|gb|EFM55163.1| flagellar basal-body rod protein FLGF [Brucella sp. BO1]
 gi|306407546|gb|EFM63746.1| flagellar basal-body rod protein FLGF [Brucella sp. NF 2653]
 gi|326410314|gb|ADZ67378.1| flagellar basal-body rod protein FLGF [Brucella melitensis M28]
 gi|326553607|gb|ADZ88246.1| flagellar basal-body rod protein FLGF [Brucella melitensis M5-90]
          Length = 262

 Score =  238 bits (606), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 94/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 13  SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 73  FVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 126

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V          +   
Sbjct: 127 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNAD 186

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 187 IDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH 220



 Score =  180 bits (457), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 96/191 (50%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +    KE       +  + YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPS 180

Query: 176 KYISLPFLKDV 186
              +    K  
Sbjct: 181 TMSNADIDKQA 191



 Score =  131 bits (328), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 135

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  M+Q +    +    AD
Sbjct: 136 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNAD 186



 Score = 93.4 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 82/238 (34%), Gaps = 42/238 (17%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 69  YAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 129 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 168

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
           L  +  + G        D  K  +    +I  S + DP  + + +  +R+  +    N
Sbjct: 169 LTMVQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHEMNN 224



 Score = 53.3 bits (126), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 37/228 (16%), Positives = 68/228 (29%), Gaps = 21/228 (9%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           D + +   I   ++           +  +  YYK  I +V S  DF+ D +LF    +  
Sbjct: 3   DTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKA 61

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQ 335
           F L     A  F+  +                      F   F      +   Q  +  Q
Sbjct: 62  FGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ 121

Query: 336 KMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
            ++D Y +               L   ++     + +   +L  K  L    +      T
Sbjct: 122 GVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPST 181

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
           +  A      ++    +     +  S  SDPD Y +K    R   ++ 
Sbjct: 182 MSNA------DIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 221


>gi|110632663|ref|YP_672871.1| hypothetical protein Meso_0302 [Mesorhizobium sp. BNC1]
 gi|110283647|gb|ABG61706.1| protein of unknown function DUF1217 [Chelativorans sp. BNC1]
          Length = 258

 Score =  237 bits (605), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 55/242 (22%), Positives = 112/242 (46%), Gaps = 9/242 (3%)

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
            + +       +E+   +      ++ E  YY  NI  + S EE +A+ R+  + +++ G
Sbjct: 4   TYTSYQLIVRDIERSIDRVEQQPMVSRETAYYQENIGKVKSIEEFVADDRLFRYAMKAHG 63

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           ++     +  + +  +  + D  SF N   D RYK+ + +FNF  +GE +          
Sbjct: 64  LEDMAYAKALMVKALEGGIDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTTFHSST--- 120

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
                T + Y  Q +E+    ++  + LALYF+R   +++++YEIL D  L +VV   L 
Sbjct: 121 ---TGTVEKYLRQTLEEDAGNQNEGVRLALYFQRKAGSLKSYYEILADPALSQVVRTALG 177

Query: 656 LSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM---DHQSIDYKKALFSSP 712
                A     K+  ++K+ + + +  D +K+E+FL     +   D+ S   + ++ +  
Sbjct: 178 FPDALAQADIDKQAEMIKERLDLEELNDPEKLEEFLQRFTTLWEIDNPSFSPQSSIAALF 237

Query: 713 NQ 714
           +Q
Sbjct: 238 SQ 239



 Score =  167 bits (423), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 46/181 (25%), Positives = 87/181 (48%), Gaps = 7/181 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI ++ +     +DI+  +   V + P+VS E  YY+E I  + +I+EF+ D RLF YA+
Sbjct: 1   MINTYTSYQLIVRDIERSI-DRVEQQPMVSRETAYYQENIGKVKSIEEFVADDRLFRYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ----- 114
           KA GL DM++A+  + K LE  + D  S VN+L   +Y+ F  +++F+   +        
Sbjct: 60  KAHGLEDMAYAKALMVKALEGGIDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTTFHSS 119

Query: 115 SDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           +    +  ++   +     +   +  + YF++    + S  ++  D  L   V  +    
Sbjct: 120 TTGTVEKYLRQTLEEDAGNQNEGVRLALYFQRKAGSLKSYYEILADPALSQVVRTALGFP 179

Query: 175 P 175
            
Sbjct: 180 D 180



 Score =  118 bits (296), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 81/185 (43%), Gaps = 3/185 (1%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   ++ I++D ++S     ++ +   E+ Y+++NI K+ S+++   D RL  Y +++
Sbjct: 2   INTYTSYQLIVRDIERSIDRVEQQPMVSRETAYYQENIGKVKSIEEFVADDRLFRYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
             +     +   +   L  G+ +   +  +  D R++   + F F   G  +      T 
Sbjct: 62  HGLEDMAYAKALMVKALEGGIDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTTFHSSTT 121

Query: 231 MQIEKIVSNYFNN-TIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP 289
             +EK +         +    V    Y++    S+ S+ + L DP L ++++ +L   + 
Sbjct: 122 GTVEKYLRQTLEEDAGNQNEGVRLALYFQRKAGSLKSYYEILADPALSQVVRTALGFPDA 181

Query: 290 EITAD 294
              AD
Sbjct: 182 LAQAD 186



 Score = 87.6 bits (215), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 30/192 (15%), Positives = 59/192 (30%), Gaps = 34/192 (17%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              YQ  +GK+KSI+  ++                  ++A+ A+ L      +  +   L
Sbjct: 32  TAYYQENIGKVKSIEEFVADDR-------------LFRYAMKAHGLEDMAYAKALMVKAL 78

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSI 476
                D DS+ NK  D R       FNF   G         +  T+   ++         
Sbjct: 79  EGGIDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTTFHSSTTGTVEKYLRQTLEE---- 134

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI 536
                                 E      Y+     ++ S+ E+LA+  +   +  + G 
Sbjct: 135 ----------------DAGNQNEGVRLALYFQRKAGSLKSYYEILADPALSQVVRTALGF 178

Query: 537 DSQKVREDFLCE 548
               + +  + +
Sbjct: 179 -PDALAQADIDK 189


>gi|83269072|ref|YP_418363.1| flagellar basal-body rod protein FlgF [Brucella melitensis biovar
           Abortus 2308]
 gi|82939346|emb|CAJ12293.1| flagellar basal-body rod protein FlgF [Brucella melitensis biovar
           Abortus 2308]
          Length = 258

 Score =  237 bits (603), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 52/214 (24%), Positives = 94/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 9   SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 68

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 69  FVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 122

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  ++          +   
Sbjct: 123 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNAD 182

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 183 IDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH 216



 Score =  175 bits (443), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 51/186 (27%), Positives = 93/186 (50%), Gaps = 5/186 (2%)

Query: 6   VAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLS 65
            +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL 
Sbjct: 2   TSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLE 61

Query: 66  DMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQ 124
           DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    + +I 
Sbjct: 62  DMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVID 121

Query: 125 DYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            Y +    KE       +  + YF +    + +  ++  D+ LL  +  +F       + 
Sbjct: 122 KYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNA 181

Query: 181 PFLKDV 186
              K  
Sbjct: 182 DIDKQA 187



 Score =  131 bits (328), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 16  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 75

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 76  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 131

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  MLQ +    +    AD
Sbjct: 132 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNAD 182



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/238 (16%), Positives = 82/238 (34%), Gaps = 42/238 (17%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 18  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 64

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 65  YAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 124

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 125 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 164

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
           L  L  + G        D  K  +    +I  S + DP  + + +  +R+  +    N
Sbjct: 165 LTMLQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHEMNN 220



 Score = 52.9 bits (125), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 36/220 (16%), Positives = 65/220 (29%), Gaps = 21/220 (9%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           I   ++           +  +  YYK  I +V S  DF+ D +LF    +  F L     
Sbjct: 7   IASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKAFGLEDMAY 65

Query: 293 ADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           A  F+  +                      F   F      +   Q  +  Q ++D Y +
Sbjct: 66  AKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVR 125

Query: 344 NCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAY 400
                          L   ++     + +   +L  K  L    +      T+  A    
Sbjct: 126 QTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNA---- 181

Query: 401 NLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
             ++    +     +  S  SDPD Y +K    R   ++ 
Sbjct: 182 --DIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 217


>gi|62317079|ref|YP_222932.1| hypothetical protein BruAb2_0125 [Brucella abortus bv. 1 str.
           9-941]
 gi|189022346|ref|YP_001932087.1| Flagellar basal-body rod protein FLGF [Brucella abortus S19]
 gi|237816641|ref|ZP_04595633.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254691432|ref|ZP_05154686.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 6 str.
           870]
 gi|254695269|ref|ZP_05157097.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698368|ref|ZP_05160196.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731813|ref|ZP_05190391.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 4 str.
           292]
 gi|256256618|ref|ZP_05462154.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 9 str.
           C68]
 gi|260544320|ref|ZP_05820141.1| flagellar basal-body rod protein FLGF [Brucella abortus NCTC 8038]
 gi|260757050|ref|ZP_05869398.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759579|ref|ZP_05871927.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762823|ref|ZP_05875155.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882860|ref|ZP_05894474.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261215635|ref|ZP_05929916.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297249975|ref|ZP_06933676.1| hypothetical protein BAYG_02750 [Brucella abortus bv. 5 str. B3196]
 gi|62197272|gb|AAX75571.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|189020920|gb|ACD73641.1| Flagellar basal-body rod protein FLGF [Brucella abortus S19]
 gi|237787454|gb|EEP61670.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260097591|gb|EEW81465.1| flagellar basal-body rod protein FLGF [Brucella abortus NCTC 8038]
 gi|260669897|gb|EEX56837.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673244|gb|EEX60065.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677158|gb|EEX63979.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872388|gb|EEX79457.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917242|gb|EEX84103.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297173844|gb|EFH33208.1| hypothetical protein BAYG_02750 [Brucella abortus bv. 5 str. B3196]
          Length = 262

 Score =  237 bits (603), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 52/214 (24%), Positives = 94/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 13  SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 73  FVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 126

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  ++          +   
Sbjct: 127 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNAD 186

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 187 IDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH 220



 Score =  179 bits (453), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 52/191 (27%), Positives = 96/191 (50%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +    KE       +  + YF +    + +  ++  D+ LL  +  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPS 180

Query: 176 KYISLPFLKDV 186
              +    K  
Sbjct: 181 TMSNADIDKQA 191



 Score =  130 bits (327), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 135

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  MLQ +    +    AD
Sbjct: 136 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNAD 186



 Score = 92.6 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/238 (16%), Positives = 82/238 (34%), Gaps = 42/238 (17%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 69  YAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 129 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 168

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
           L  L  + G        D  K  +    +I  S + DP  + + +  +R+  +    N
Sbjct: 169 LTMLQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHEMNN 224



 Score = 53.3 bits (126), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 37/228 (16%), Positives = 68/228 (29%), Gaps = 21/228 (9%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           D + +   I   ++           +  +  YYK  I +V S  DF+ D +LF    +  
Sbjct: 3   DTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKA 61

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQ 335
           F L     A  F+  +                      F   F      +   Q  +  Q
Sbjct: 62  FGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ 121

Query: 336 KMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
            ++D Y +               L   ++     + +   +L  K  L    +      T
Sbjct: 122 GVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPST 181

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
           +  A      ++    +     +  S  SDPD Y +K    R   ++ 
Sbjct: 182 MSNA------DIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 221


>gi|254711992|ref|ZP_05173803.1| hypothetical protein BcetM6_01082 [Brucella ceti M644/93/1]
 gi|254715062|ref|ZP_05176873.1| hypothetical protein BcetM_01092 [Brucella ceti M13/05/1]
 gi|261216769|ref|ZP_05931050.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261319636|ref|ZP_05958833.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260921858|gb|EEX88426.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292326|gb|EEX95822.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 262

 Score =  237 bits (603), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 94/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 13  SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 73  FVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 126

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V          +   
Sbjct: 127 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNAD 186

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 187 IDKQAKMIADKIDFSKMSDPDYVSKFISRITAMH 220



 Score =  181 bits (459), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 96/191 (50%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +    KE       +  + YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPS 180

Query: 176 KYISLPFLKDV 186
              +    K  
Sbjct: 181 TMSNADIDKQA 191



 Score =  131 bits (329), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 135

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  M+Q +    +    AD
Sbjct: 136 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNAD 186



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 74/219 (33%), Gaps = 40/219 (18%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 69  YAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 129 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 168

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPK 558
           L  +  + G        D  K  +    +I  S + DP 
Sbjct: 169 LTMVQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD 207



 Score = 53.3 bits (126), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 62/213 (29%), Gaps = 19/213 (8%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           D + +   I   ++           +  +  YYK  I +V S  DF+ D +LF    +  
Sbjct: 3   DTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKA 61

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQ 335
           F L     A  F+  +                      F   F      +   Q  +  Q
Sbjct: 62  FGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ 121

Query: 336 KMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
            ++D Y +               L   ++     + +   +L  K  L    +      T
Sbjct: 122 GVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPST 181

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDS 425
           +  A      ++    +     +  S  SDPD 
Sbjct: 182 MSNA------DIDKQAKMIADKIDFSKMSDPDY 208


>gi|239834449|ref|ZP_04682777.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239822512|gb|EEQ94081.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 264

 Score =  234 bits (596), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 51/213 (23%), Positives = 91/213 (42%), Gaps = 6/213 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           + M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ L++ G++     + 
Sbjct: 15  SDMARSLQRVSKEPMVERETAYYKENIGKVKSVDDFMADSRLYNYALKAFGLEDMAFAKA 74

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    +K   + AN   D RYKE  + F+F+  G  +       Q         D 
Sbjct: 75  FVRKILTEGIKSDDAMANKLTDKRYKEFATVFDFEGKGAEAT------QSTAAQQGVVDK 128

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +E +   ++  + LALYF+R  P + N YEILGD  L  ++          +   
Sbjct: 129 YLRQTLETEAGSQNEGVRLALYFQRKAPTLTNAYEILGDKALVSMIQTTFGWPSTISNAD 188

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
             K+ ++++  I      D   V   +    AM
Sbjct: 189 IDKQAKMIEDKIDFTKMSDPDYVSKLISRFTAM 221



 Score =  175 bits (443), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 92/191 (48%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I  + ++D+F+ D RL++YALK
Sbjct: 3   MVDTMTSYRLIASDMARSLQRVSKEPMVERETAYYKENIGKVKSVDDFMADSRLYNYALK 62

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           AFGL DM+ A+ F++KIL   +    ++ N+L   +Y+ FA  +DF     +  QS    
Sbjct: 63  AFGLEDMAFAKAFVRKILTEGIKSDDAMANKLTDKRYKEFATVFDFEGKGAEATQSTAAQ 122

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + ++  Y +     E       +  + YF++    + +  ++  D+ L+  +  +F    
Sbjct: 123 QGVVDKYLRQTLETEAGSQNEGVRLALYFQRKAPTLTNAYEILGDKALVSMIQTTFGWPS 182

Query: 176 KYISLPFLKDV 186
              +    K  
Sbjct: 183 TISNADIDKQA 193



 Score =  128 bits (322), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 76/171 (44%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI K+ SVD    D RL +Y L++F +     +  F++ +LT
Sbjct: 22  QRVSKEPMVERETAYYKENIGKVKSVDDFMADSRLYNYALKAFGLEDMAFAKAFVRKILT 81

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F+  G+    +   +    + +V  Y   T++  
Sbjct: 82  EGIKSDDAMANKLTDKRYKEFATVFDFEGKGA----EATQSTAAQQGVVDKYLRQTLETE 137

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    ++++  + L D  L  M+Q +    +    AD
Sbjct: 138 AGSQNEGVRLALYFQRKAPTLTNAYEILGDKALVSMIQTTFGWPSTISNAD 188



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 33/213 (15%), Positives = 72/213 (33%), Gaps = 33/213 (15%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             D+ +   ++  +  ++     Y+  +GK+KS+D+ ++                   +A
Sbjct: 14  ASDMARSLQRVSKEPMVERETAYYKENIGKVKSVDDFMADSR-------------LYNYA 60

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           L A+ L      +  +R +LT      D+ ANK  D R  +    F+F   G+       
Sbjct: 61  LKAFGLEDMAFAKAFVRKILTEGIKSDDAMANKLTDKRYKEFATVFDFEGKGAEATQSTA 120

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
             +  +   ++                        T+     E      Y+     T+ +
Sbjct: 121 AQQGVVDKYLRQTLE--------------------TEAGSQNEGVRLALYFQRKAPTLTN 160

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
             E+L +K +++ +  + G  S     D   + 
Sbjct: 161 AYEILGDKALVSMIQTTFGWPSTISNADIDKQA 193



 Score = 52.6 bits (124), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 36/226 (15%), Positives = 67/226 (29%), Gaps = 21/226 (9%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           D + +   I   ++           +  +  YYK  I  V S  DF+ D +L+    L  
Sbjct: 5   DTMTSYRLIASDMARSLQRVSKEPMVERETAYYKENIGKVKSVDDFMADSRLYNY-ALKA 63

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQ 335
           F L     A  F+  +                      F   F  +   +   Q  +  Q
Sbjct: 64  FGLEDMAFAKAFVRKILTEGIKSDDAMANKLTDKRYKEFATVFDFEGKGAEATQSTAAQQ 123

Query: 336 KMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
            ++D Y +               L   +Q     + +   +L  K  +    +      T
Sbjct: 124 GVVDKYLRQTLETEAGSQNEGVRLALYFQRKAPTLTNAYEILGDKALVSMIQTTFGWPST 183

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKL 438
           +  A      ++    +     +  +  SDPD Y +K    R   +
Sbjct: 184 ISNA------DIDKQAKMIEDKIDFTKMSDPD-YVSKLI-SRFTAM 221


>gi|23499890|ref|NP_699330.1| hypothetical protein BRA0127 [Brucella suis 1330]
 gi|23463465|gb|AAN33335.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 258

 Score =  233 bits (594), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 94/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 9   SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 68

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 69  FVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 122

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V          +   
Sbjct: 123 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNAD 182

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 183 IDKQAKMIADKIDFSKMSDPDYVLKFISRFTAMH 216



 Score =  175 bits (444), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 52/186 (27%), Positives = 93/186 (50%), Gaps = 5/186 (2%)

Query: 6   VAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLS 65
            +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL 
Sbjct: 2   TSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLE 61

Query: 66  DMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQ 124
           DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    + +I 
Sbjct: 62  DMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVID 121

Query: 125 DYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            Y +    KE       +  + YF +    + +  ++  D+ LL  V  +F       + 
Sbjct: 122 KYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNA 181

Query: 181 PFLKDV 186
              K  
Sbjct: 182 DIDKQA 187



 Score =  133 bits (333), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 75/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 16  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 75

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 76  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 131

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  M+Q +   L+    AD
Sbjct: 132 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNAD 182



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 74/219 (33%), Gaps = 40/219 (18%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 18  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 64

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 65  YAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 124

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 125 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 164

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPK 558
           L  +  + G        D  K  +    +I  S + DP 
Sbjct: 165 LTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPD 203



 Score = 52.9 bits (125), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 33/205 (16%), Positives = 60/205 (29%), Gaps = 19/205 (9%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           I   ++           +  +  YYK  I +V S  DF+ D +LF    +  F L     
Sbjct: 7   IASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKAFGLEDMAY 65

Query: 293 ADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           A  F+  +                      F   F      +   Q  +  Q ++D Y +
Sbjct: 66  AKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVR 125

Query: 344 NCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAY 400
                          L   ++     + +   +L  K  L    +    + T+  A    
Sbjct: 126 QTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNA---- 181

Query: 401 NLNMQDLDRDQLRNVLTSNPSDPDS 425
             ++    +     +  S  SDPD 
Sbjct: 182 --DIDKQAKMIADKIDFSKMSDPDY 204


>gi|163844322|ref|YP_001621977.1| hypothetical protein BSUIS_B0133 [Brucella suis ATCC 23445]
 gi|163675045|gb|ABY39155.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 262

 Score =  233 bits (594), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 94/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 13  SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 73  FVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 126

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V          +   
Sbjct: 127 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNAD 186

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 187 IDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH 220



 Score =  178 bits (452), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 96/191 (50%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +    KE       +  + YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLS 180

Query: 176 KYISLPFLKDV 186
              +    K  
Sbjct: 181 TMSNADIDKQA 191



 Score =  132 bits (332), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 75/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 135

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  M+Q +   L+    AD
Sbjct: 136 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNAD 186



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/238 (15%), Positives = 82/238 (34%), Gaps = 42/238 (17%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 69  YAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 129 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 168

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
           L  +  + G        D  K  +    +I  S + DP  + + +  +R+  +    N
Sbjct: 169 LTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHEMNN 224



 Score = 53.3 bits (126), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 37/228 (16%), Positives = 69/228 (30%), Gaps = 21/228 (9%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           D + +   I   ++           +  +  YYK  I +V S  DF+ D +LF    +  
Sbjct: 3   DTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKA 61

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQ 335
           F L     A  F+  +                      F   F      +   Q  +  Q
Sbjct: 62  FGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ 121

Query: 336 KMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
            ++D Y +               L   ++     + +   +L  K  L    +    + T
Sbjct: 122 GVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLST 181

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
           +  A      ++    +     +  S  SDPD Y +K    R   ++ 
Sbjct: 182 MSNA------DIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 221


>gi|227820851|ref|YP_002824821.1| hypothetical protein NGR_c02700 [Sinorhizobium fredii NGR234]
 gi|227339850|gb|ACP24068.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 301

 Score =  233 bits (594), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 59/250 (23%), Positives = 107/250 (42%), Gaps = 11/250 (4%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            + + +       +     +      +  E +YY   I +I S +E  A+ R+ ++ +++
Sbjct: 44  TTTYTSYKLITADITGSLERVSEQPVVARETEYYLSRIGSIKSLDEFFADSRLYDYAMKA 103

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G++     + F+ ++    +    +FAN   D+RYK ++ S NF  HG+ +        
Sbjct: 104 HGLEDMAYAKAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGDTATSF----- 158

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKK 653
                    D Y  Q +E+   E++  + LALYF+R  P I + YEI+ D  L +VV   
Sbjct: 159 -ERAQKGVVDKYARQTLEQNAGEENGGVRLALYFERMAPLITSGYEIIADEALAQVVRAA 217

Query: 654 LKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-----DHQSIDYKKAL 708
           L+L   FA     ++    ++ I + DF+D  K+  F+    A+        S D     
Sbjct: 218 LQLPEEFAAADVDRQAEAYEEAIDLKDFQDPVKLAAFIDRFTALWEIENSSDSYDPLAVF 277

Query: 709 FSSPNQNKDP 718
            SS      P
Sbjct: 278 GSSSGYGISP 287



 Score =  169 bits (427), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 47/190 (24%), Positives = 88/190 (46%), Gaps = 7/190 (3%)

Query: 3   PSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
            ++ +    + DI   L   VS+ P+V+ E  YY  RI  I ++DEF  D RL+ YA+KA
Sbjct: 45  TTYTSYKLITADITGSL-ERVSEQPVVARETEYYLSRIGSIKSLDEFFADSRLYDYAMKA 103

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQHK 120
            GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+       S +   K
Sbjct: 104 HGLEDMAYAKAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGDTATSFERAQK 163

Query: 121 TIIQDYK----QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            ++  Y     + +  +E   +  + YF +    I S  ++  D  L   V  +  +  +
Sbjct: 164 GVVDKYARQTLEQNAGEENGGVRLALYFERMAPLITSGYEIIADEALAQVVRAALQLPEE 223

Query: 177 YISLPFLKDV 186
           + +    +  
Sbjct: 224 FAAADVDRQA 233



 Score =  120 bits (301), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 41/207 (19%), Positives = 87/207 (42%), Gaps = 11/207 (5%)

Query: 107 SPPPKVIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLL 164
           +  P V  +   +K I  D   S +   ++ V   E++Y+   I  I S+D+ F D RL 
Sbjct: 38  TGRPIVTTTYTSYKLITADITGSLERVSEQPVVARETEYYLSRIGSIKSLDEFFADSRLY 97

Query: 165 DYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR 224
           DY +++  +     +  F++ VLT G+ +   +  +  D+R++A+ E+  F   G  +  
Sbjct: 98  DYAMKAHGLEDMAYAKAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGDTATS 157

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSD-----QNYYKLAINSVSSFSDFLKDPKLFKM 279
                +   + +V  Y   T++      +       Y++     ++S  + + D  L ++
Sbjct: 158 F----ERAQKGVVDKYARQTLEQNAGEENGGVRLALYFERMAPLITSGYEIIADEALAQV 213

Query: 280 LQLSLFPLNPEITADKFLTLMQENDPI 306
           ++ +L        AD         + I
Sbjct: 214 VRAALQLPEEFAAADVDRQAEAYEEAI 240



 Score = 86.5 bits (212), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 29/193 (15%), Positives = 57/193 (29%), Gaps = 33/193 (17%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
            + Y   +G IKS+D   +                   +A+ A+ L      +  +R VL
Sbjct: 74  TEYYLSRIGSIKSLDEFFADSR-------------LYDYAMKAHGLEDMAYAKAFMRKVL 120

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSI 476
           T      D++ANK  D R   L  + NF   G          +  +    +    +    
Sbjct: 121 TEGIDSEDAFANKLADSRYKALVESLNFARHGDTATSFERAQKGVVDKYARQTLEQNAGE 180

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI 536
            +                           Y+      I S  E++A++ +   +  +  +
Sbjct: 181 ENGG--------------------VRLALYFERMAPLITSGYEIIADEALAQVVRAALQL 220

Query: 537 DSQKVREDFLCEI 549
             +    D   + 
Sbjct: 221 PEEFAAADVDRQA 233



 Score = 45.2 bits (105), Expect = 0.045,   Method: Composition-based stats.
 Identities = 30/233 (12%), Positives = 65/233 (27%), Gaps = 23/233 (9%)

Query: 219 GSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFK 278
           G         +   I   ++       +   +  +  YY   I S+ S  +F  D +L+ 
Sbjct: 39  GRPIVTTTYTSYKLITADITGSLERVSEQPVVARETEYYLSRIGSIKSLDEFFADSRLYD 98

Query: 279 MLQLSLFPLNPEITADKFLTLMQEN-------------DPIVSQVKYFFQINFHRDNSSS 325
              +    L     A  F+  +                D     +        H D ++S
Sbjct: 99  Y-AMKAHGLEDMAYAKAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGDTATS 157

Query: 326 TKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNS 385
            +  Q   + K      +      +  ++ L   ++     I S   +++ +   +   +
Sbjct: 158 FERAQKGVVDKYARQTLEQNAGEENGGVR-LALYFERMAPLITSGYEIIADEALAQVVRA 216

Query: 386 AEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKL 438
           A +       A      ++          +   +  DP   A     DR   L
Sbjct: 217 ALQLPEEFAAA------DVDRQAEAYEEAIDLKDFQDPVKLAAFI--DRFTAL 261


>gi|161620213|ref|YP_001594099.1| hypothetical protein BCAN_B0131 [Brucella canis ATCC 23365]
 gi|254702555|ref|ZP_05164383.1| hypothetical protein Bsuib36_01112 [Brucella suis bv. 3 str. 686]
 gi|261753133|ref|ZP_05996842.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161337024|gb|ABX63328.1| protein of unknown function DUF1217 [Brucella canis ATCC 23365]
 gi|261742886|gb|EEY30812.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 262

 Score =  233 bits (593), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 94/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 13  SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 73  FVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 126

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V          +   
Sbjct: 127 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNAD 186

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 187 IDKQAKMIADKIDFSKMSDPDYVLKFISRFTAMH 220



 Score =  179 bits (454), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 96/191 (50%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +    KE       +  + YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLS 180

Query: 176 KYISLPFLKDV 186
              +    K  
Sbjct: 181 TMSNADIDKQA 191



 Score =  133 bits (333), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 75/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 135

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  M+Q +   L+    AD
Sbjct: 136 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNAD 186



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 74/219 (33%), Gaps = 40/219 (18%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 69  YAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 129 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 168

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPK 558
           L  +  + G        D  K  +    +I  S + DP 
Sbjct: 169 LTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPD 207



 Score = 53.3 bits (126), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 63/213 (29%), Gaps = 19/213 (8%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           D + +   I   ++           +  +  YYK  I +V S  DF+ D +LF    +  
Sbjct: 3   DTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKA 61

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQ 335
           F L     A  F+  +                      F   F      +   Q  +  Q
Sbjct: 62  FGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ 121

Query: 336 KMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
            ++D Y +               L   ++     + +   +L  K  L    +    + T
Sbjct: 122 GVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLST 181

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDS 425
           +  A      ++    +     +  S  SDPD 
Sbjct: 182 MSNA------DIDKQAKMIADKIDFSKMSDPDY 208


>gi|153011531|ref|YP_001372745.1| hypothetical protein Oant_4216 [Ochrobactrum anthropi ATCC 49188]
 gi|151563419|gb|ABS16916.1| protein of unknown function DUF1217 [Ochrobactrum anthropi ATCC
           49188]
          Length = 264

 Score =  233 bits (593), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 89/213 (41%), Gaps = 6/213 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           + M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 15  SDMARSLQRVSKEPMVERETAYYKENIGKVKSIDDFMADSRLYNYAMKAFGLEDMAFAKA 74

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I    +    + AN   D RYKE  + F+F   G  + +     Q         D 
Sbjct: 75  FVRKILTEGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTAAQQ------GVVDK 128

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +E +   ++  + LALYF R  P I N YEILGD  L  ++          +   
Sbjct: 129 YLRQTLETEAGSQNEGVRLALYFARKAPTITNAYEILGDKALVSMIQTTFGWPSSISNAD 188

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
             K+ ++++  I      D   V   +    AM
Sbjct: 189 VDKQAKMIEDKIDFTKMSDPDYVSKLISRFTAM 221



 Score =  174 bits (441), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 48/191 (25%), Positives = 92/191 (48%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I  + +ID+F+ D RL++YA+K
Sbjct: 3   MVDTMTSYRLIASDMARSLQRVSKEPMVERETAYYKENIGKVKSIDDFMADSRLYNYAMK 62

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           AFGL DM+ A+ F++KIL   ++   ++ N+L   +Y+ FA  +DF     +  +S    
Sbjct: 63  AFGLEDMAFAKAFVRKILTEGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTAAQ 122

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + ++  Y +     E       +  + YF +    I +  ++  D+ L+  +  +F    
Sbjct: 123 QGVVDKYLRQTLETEAGSQNEGVRLALYFARKAPTITNAYEILGDKALVSMIQTTFGWPS 182

Query: 176 KYISLPFLKDV 186
              +    K  
Sbjct: 183 SISNADVDKQA 193



 Score =  128 bits (320), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/171 (20%), Positives = 73/171 (42%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI K+ S+D    D RL +Y +++F +     +  F++ +LT
Sbjct: 22  QRVSKEPMVERETAYYKENIGKVKSIDDFMADSRLYNYAMKAFGLEDMAFAKAFVRKILT 81

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +           + +V  Y   T++  
Sbjct: 82  EGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTAA----QQGVVDKYLRQTLETE 137

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y+     ++++  + L D  L  M+Q +    +    AD
Sbjct: 138 AGSQNEGVRLALYFARKAPTITNAYEILGDKALVSMIQTTFGWPSSISNAD 188



 Score = 94.9 bits (234), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 73/213 (34%), Gaps = 33/213 (15%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             D+ +   ++  +  ++     Y+  +GK+KSID+ ++                   +A
Sbjct: 14  ASDMARSLQRVSKEPMVERETAYYKENIGKVKSIDDFMADSR-------------LYNYA 60

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + A+ L      +  +R +LT   +  D+ ANK  D R  +    F+F   G+       
Sbjct: 61  MKAFGLEDMAFAKAFVRKILTEGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTA 120

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
             +  +   ++                        T+     E      Y+     TI +
Sbjct: 121 AQQGVVDKYLRQTLE--------------------TEAGSQNEGVRLALYFARKAPTITN 160

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
             E+L +K +++ +  + G  S     D   + 
Sbjct: 161 AYEILGDKALVSMIQTTFGWPSSISNADVDKQA 193



 Score = 48.7 bits (114), Expect = 0.004,   Method: Composition-based stats.
 Identities = 33/226 (14%), Positives = 65/226 (28%), Gaps = 21/226 (9%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           D + +   I   ++           +  +  YYK  I  V S  DF+ D +L+    +  
Sbjct: 5   DTMTSYRLIASDMARSLQRVSKEPMVERETAYYKENIGKVKSIDDFMADSRLYNY-AMKA 63

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQ 335
           F L     A  F+  +                      F   F      +   +  +  Q
Sbjct: 64  FGLEDMAFAKAFVRKILTEGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTAAQQ 123

Query: 336 KMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
            ++D Y +               L   +      I +   +L  K  +    +      +
Sbjct: 124 GVVDKYLRQTLETEAGSQNEGVRLALYFARKAPTITNAYEILGDKALVSMIQTTFGWPSS 183

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKL 438
           +  A      ++    +     +  +  SDPD Y +K    R   +
Sbjct: 184 ISNA------DVDKQAKMIEDKIDFTKMSDPD-YVSKLI-SRFTAM 221


>gi|12214188|emb|CAC21603.1| unnamed protein product [Sinorhizobium meliloti]
          Length = 315

 Score =  232 bits (590), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 59/250 (23%), Positives = 107/250 (42%), Gaps = 11/250 (4%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            + + +       + +   +     ++  E +YY   I +I + ++  A+ R+ N+ +++
Sbjct: 58  TTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKA 117

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G++     + F+ ++    +    +FAN   D RYK ++ S NF  HGE +        
Sbjct: 118 HGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAF----- 172

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKK 653
                    + Y  Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV   
Sbjct: 173 -ERAQKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRTV 231

Query: 654 LKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-----DHQSIDYKKAL 708
           L+L   FA     ++    +  I   DF+D +K+ +FL    A+          D     
Sbjct: 232 LQLPAEFAAADVDRQAEAYEAAIDFKDFQDPQKIAEFLDRFTALWEIDNSSDGYDPLAVF 291

Query: 709 FSSPNQNKDP 718
            +S      P
Sbjct: 292 GASSGYGISP 301



 Score =  164 bits (415), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 40/189 (21%), Positives = 84/189 (44%), Gaps = 5/189 (2%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
            ++ +        +K    VS  P V+ E  YY  +I  I T+D+F  D RL++YA+KA 
Sbjct: 59  TTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAH 118

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTI 122
           GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+   +   +  + +  
Sbjct: 119 GLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQKG 178

Query: 123 I-----QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           +     +   +    +E   +  + YF++    I +  ++  D  L   V     +  ++
Sbjct: 179 VAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLPAEF 238

Query: 178 ISLPFLKDV 186
            +    +  
Sbjct: 239 AAADVDRQA 247



 Score =  115 bits (287), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 47/270 (17%), Positives = 100/270 (37%), Gaps = 33/270 (12%)

Query: 85  PKSLVNQLNSLKYQYFARS----------YDFSPPPKVIQSDIQHKTIIQDYKQSHQH-- 132
           P S  N++   + +  AR+          +  +  P V  +   ++ I  D  +S +   
Sbjct: 23  PGSDRNRV---RSRQLARAEDRAHISSSRFIATGEPIVTTTYTSYRLITADLTKSLERVS 79

Query: 133 KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA 192
            +     E++Y+   I  I ++D  F D RL +Y +++  +     +  F++ VL  G+ 
Sbjct: 80  AQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAFMRKVLAEGID 139

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI-DCVPIV 251
           +   +  +  D R++A+ E+  F   G  +   +       EK           +    V
Sbjct: 140 SDDAFANKLADGRYKALVESLNFARHGEAATAFERAQKGVAEKYTRQTLEQKAGEENTGV 199

Query: 252 SDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVK 311
               Y++    ++++  + + D  L  +++  +  L  E  A          D       
Sbjct: 200 RLALYFQRMAPTIANGYEIIADEALSHVVRT-VLQLPAEFAAA---------DVDRQAEA 249

Query: 312 YFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
           Y   I+F          Q   +I + LD +
Sbjct: 250 YEAAIDFKD-------FQDPQKIAEFLDRF 272



 Score = 81.8 bits (200), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/209 (14%), Positives = 67/209 (32%), Gaps = 17/209 (8%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             DL K   ++     +    + Y   +G IK++D+  +                   +A
Sbjct: 68  TADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSR-------------LYNYA 114

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + A+ L      +  +R VL       D++ANK  D R   L  + NF   G        
Sbjct: 115 MKAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFER 174

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
             +       +    +K      E  +   +     +    +    E+       + + +
Sbjct: 175 AQKGVAEKYTRQTLEQKA----GEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRT 230

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDF 545
             +L A     +   +++  ++    +DF
Sbjct: 231 VLQLPAEFAAADVDRQAEAYEAAIDFKDF 259


>gi|163758008|ref|ZP_02165096.1| hypothetical protein HPDFL43_00245 [Hoeflea phototrophica DFL-43]
 gi|162284297|gb|EDQ34580.1| hypothetical protein HPDFL43_00245 [Hoeflea phototrophica DFL-43]
          Length = 260

 Score =  231 bits (589), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 58/223 (26%), Positives = 103/223 (46%), Gaps = 6/223 (2%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S + +       + +   +     ++  E + Y   I+ I S +E +A+ R+ N+ +++ 
Sbjct: 3   STYTSYRLIAQDIPKSIERIASQPQVARESENYLSRISEIKSIDEFMADTRVFNYAMKAH 62

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G++     + F+ ++      D  +FAN   D RY++   +FNF  HGE +       Q 
Sbjct: 63  GLEDMSYAKAFMRKVLTEGTDDDNAFANQLADTRYRDFAEAFNFARHGETATIFTSAQQ- 121

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
                 T D Y    +E++    +  + LALYF+R  P + + YEIL D+ L  VV   L
Sbjct: 122 -----GTVDKYHRLTLEEEAGADNTGVRLALYFERNAPELTSAYEILADNALADVVRTAL 176

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
            L    A     K+  ++   I + DFKD +K++ FL    A+
Sbjct: 177 GLPSELAATDIDKQADLINSRIDLEDFKDPEKLDKFLNRFTAL 219



 Score =  173 bits (438), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 91/191 (47%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +         K    ++  P V+ E   Y  RI  I +IDEF+ D R+F+YA+K
Sbjct: 1   MISTYTSYRLIAQDIPKSIERIASQPQVARESENYLSRISEIKSIDEFMADTRVFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ--SDIQ 118
           A GL DMS+A+ F++K+L     D  +  NQL   +Y+ FA +++F+   +     +  Q
Sbjct: 61  AHGLEDMSYAKAFMRKVLTEGTDDDNAFANQLADTRYRDFAEAFNFARHGETATIFTSAQ 120

Query: 119 HKTIIQDYK---QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             T+ + ++   +     +   +  + YF +N  ++ S  ++  D  L D V  +  +  
Sbjct: 121 QGTVDKYHRLTLEEEAGADNTGVRLALYFERNAPELTSAYEILADNALADVVRTALGLPS 180

Query: 176 KYISLPFLKDV 186
           +  +    K  
Sbjct: 181 ELAATDIDKQA 191



 Score =  114 bits (285), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/199 (20%), Positives = 80/199 (40%), Gaps = 11/199 (5%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   ++ I QD  +S +    +     ES+ +   I +I S+D+   D R+ +Y +++
Sbjct: 2   ISTYTSYRLIAQDIPKSIERIASQPQVARESENYLSRISEIKSIDEFMADTRVFNYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
             +     +  F++ VLT G  +   +  +  D R+R  AE F F   G  +    I T 
Sbjct: 62  HGLEDMSYAKAFMRKVLTEGTDDDNAFANQLADTRYRDFAEAFNFARHGETAT---IFTS 118

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
            Q +  V  Y   T++      +       Y++     ++S  + L D  L  +++ +L 
Sbjct: 119 AQ-QGTVDKYHRLTLEEEAGADNTGVRLALYFERNAPELTSAYEILADNALADVVRTALG 177

Query: 286 PLNPEITADKFLTLMQEND 304
             +     D        N 
Sbjct: 178 LPSELAATDIDKQADLINS 196



 Score = 95.3 bits (235), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 68/203 (33%), Gaps = 33/203 (16%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           I    ++    ++Y   + +IKSID  ++                   +A+ A+ L    
Sbjct: 22  IASQPQVARESENYLSRISEIKSIDEFMADTR-------------VFNYAMKAHGLEDMS 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R VLT    D +++AN+  D R      AFNF   G    I     + T+    
Sbjct: 69  YAKAFMRKVLTEGTDDDNAFANQLADTRYRDFAEAFNFARHGETATIFTSAQQGTVDKYH 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +     +    +                           Y+  N   + S  E+LA+  +
Sbjct: 129 RLTLEEEAGADN--------------------TGVRLALYFERNAPELTSAYEILADNAL 168

Query: 527 LNFLLESKGIDSQKVREDFLCEI 549
            + +  + G+ S+    D   + 
Sbjct: 169 ADVVRTALGLPSELAATDIDKQA 191


>gi|218461856|ref|ZP_03501947.1| hypothetical protein RetlK5_21288 [Rhizobium etli Kim 5]
          Length = 256

 Score =  231 bits (589), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 82/236 (34%), Positives = 138/236 (58%), Gaps = 2/236 (0%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +A        +   + V+    V  + +YY + I  ++++D+F+ D +L+SYA+K
Sbjct: 23  MITASLAYSILSKDMTSSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMK 82

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q  
Sbjct: 83  AYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNAPEKDVQTDAQED 142

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            +I  YKQS    ++ +  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S 
Sbjct: 143 ELIGLYKQSFVDADKASAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYASK 202

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKI 236
            FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   +
Sbjct: 203 DFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASV 256



 Score =  150 bits (379), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 63/252 (25%), Positives = 112/252 (44%), Gaps = 38/252 (15%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++     ++   + Y   + K+ S+D+ L                    +A+ AY L  
Sbjct: 42  NKVASQATVKKDAQYYADHINKVTSVDDFLGD-------------YKLYSYAMKAYGLED 88

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  ++ VL S+ +DP+SYANK  D R  +   AFNFNA     P   +Q+     +
Sbjct: 89  MTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNA-----PEKDVQTDAQEDE 143

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            +  Y   K+S  DA+  S                  +E  YY+ NI+++ + ++L+ N 
Sbjct: 144 LIGLY---KQSFVDADKAS-----------------AAESTYYSNNIDSVQTVDDLVNNT 183

Query: 525 RILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGEL 584
           R+  ++L++  ID     +DFL ++  SDL DP S  NT   ++YK + + F+F+  G +
Sbjct: 184 RLRTYVLKTFKIDPTYASKDFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTV 243

Query: 585 SHKKIGKVQDNF 596
           +       Q   
Sbjct: 244 TGTAQTAAQKAS 255



 Score =  138 bits (346), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 50/248 (20%), Positives = 106/248 (42%), Gaps = 27/248 (10%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           +   A +     M     +      +  +  YY  +IN + S ++ L + ++ ++ +++ 
Sbjct: 25  TASLAYSILSKDMTSSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMKAY 84

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G++     + F+ ++ +SDL DP S+AN   D RY+E  ++FNF+            VQ 
Sbjct: 85  GLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNA-------PEKDVQT 137

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
           +   D+   LYK   ++  +     + A + Y+   I +++   +++ +++L   V K  
Sbjct: 138 DAQEDELIGLYKQSFVDADK----ASAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTF 193

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQ 714
           K+ P +A     +++         +D  D   V         ++ Q  D  KAL +  + 
Sbjct: 194 KIDPTYASKDFLRQVLT-------SDLSDPASV---------VNTQGGDKYKALAAQFSF 237

Query: 715 NKDPWNNS 722
           N D     
Sbjct: 238 NADGTVTG 245



 Score =  121 bits (302), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 41/220 (18%), Positives = 89/220 (40%), Gaps = 16/220 (7%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           +    +    ++++Y+  +I+K+ SVD    D +L  Y ++++ +     +  F+K VL 
Sbjct: 42  NKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMKAYGLEDMTYAKAFMKKVLE 101

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
             L +P  Y  +  D R+R  A  F F           + TD Q ++++  Y  + +D  
Sbjct: 102 SDLTDPNSYANKLSDARYREFAAAFNFNAP-----EKDVQTDAQEDELIGLYKQSFVDAD 156

Query: 249 PI-VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIV 307
               ++  YY   I+SV +  D + + +L   +  +        + D    ++  +    
Sbjct: 157 KASAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYASKDFLRQVLTSDLSDP 216

Query: 308 SQV----------KYFFQINFHRDNSSSTKIQQDSQIQKM 337
           + V              Q +F+ D + +   Q  +Q   +
Sbjct: 217 ASVVNTQGGDKYKALAAQFSFNADGTVTGTAQTAAQKASV 256



 Score =  109 bits (273), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 57/265 (21%), Positives = 102/265 (38%), Gaps = 25/265 (9%)

Query: 206 FRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVS 265
           +R            +L      L    + K +++  N       +  D  YY   IN V+
Sbjct: 6   YRQFVVLLEIFAKRALLMITASLAYSILSKDMTSSLNKVASQATVKKDAQYYADHINKVT 65

Query: 266 SFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI---------VSQVKYFFQI 316
           S  DFL D KL+    +  + L     A  F+  + E+D                  F  
Sbjct: 66  SVDDFLGDYKLYSY-AMKAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAA 124

Query: 317 NFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSG 376
            F+  N+    +Q D+Q  +++ LYK++  +  D    +    Y   +  ++++D+L++ 
Sbjct: 125 AFNF-NAPEKDVQTDAQEDELIGLYKQSF-VDADKASAAESTYYSNNIDSVQTVDDLVNN 182

Query: 377 KCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLI 436
                             + L  + ++     +D LR VLTS+ SDP S  N    D+  
Sbjct: 183 TR-------------LRTYVLKTFKIDPTYASKDFLRQVLTSDLSDPASVVNTQGGDKYK 229

Query: 437 KLNHAFNFNADGSIGPIPMMQSRLT 461
            L   F+FNADG++       ++  
Sbjct: 230 ALAAQFSFNADGTVTGTAQTAAQKA 254


>gi|260568537|ref|ZP_05839006.1| flagellar basal-body rod protein FlgF [Brucella suis bv. 4 str. 40]
 gi|260155202|gb|EEW90283.1| flagellar basal-body rod protein FlgF [Brucella suis bv. 4 str. 40]
          Length = 262

 Score =  231 bits (589), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 93/214 (43%), Gaps = 6/214 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++     + 
Sbjct: 13  SNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F  +I    + D  + AN   D RYKE  + F+F   G  +       Q         D 
Sbjct: 73  FARKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT------QSTAAQQGVIDK 126

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V          +   
Sbjct: 127 YVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNAD 186

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMD 698
             K+ +++   I  +   D   V  F+    AM 
Sbjct: 187 IDKQAKMIADKIDFSKMSDPDYVLKFISRFTAMH 220



 Score =  177 bits (448), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 53/191 (27%), Positives = 95/191 (49%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           AFGL DM++A+ F +KIL   ++D  ++ N+L   +Y+ FA  +DF     +  QS    
Sbjct: 61  AFGLEDMAYAKAFARKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +    KE       +  + YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLS 180

Query: 176 KYISLPFLKDV 186
              +    K  
Sbjct: 181 TMSNADIDKQA 191



 Score =  131 bits (328), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 74/171 (43%), Gaps = 9/171 (5%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F + +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFARKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +      +  D R++  A  F F   G+ +      +    + ++  Y   T++  
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQAT----QSTAAQQGVIDKYVRQTLEKE 135

Query: 249 PIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
               ++      Y++    S+++  + L D  L  M+Q +   L+    AD
Sbjct: 136 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNAD 186



 Score = 91.1 bits (224), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 73/219 (33%), Gaps = 40/219 (18%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L    
Sbjct: 22  VSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLEDMA 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +   R +LT   +D D+ ANK  D R  +    F+F   G+         +  I   V
Sbjct: 69  YAKAFARKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYV 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    +                    +     E      Y+     ++ +  E+L +K +
Sbjct: 129 RQTLEK--------------------EAGSQNEGVRLALYFERKAPSLTNAYEILGDKAL 168

Query: 527 LNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPK 558
           L  +  + G        D  K  +    +I  S + DP 
Sbjct: 169 LTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPD 207



 Score = 52.6 bits (124), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 34/213 (15%), Positives = 62/213 (29%), Gaps = 19/213 (8%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           D + +   I   ++           +  +  YYK  I +V S  DF+ D +LF    +  
Sbjct: 3   DTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNY-AMKA 61

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQ 335
           F L     A  F   +                      F   F      +   Q  +  Q
Sbjct: 62  FGLEDMAYAKAFARKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQ 121

Query: 336 KMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
            ++D Y +               L   ++     + +   +L  K  L    +    + T
Sbjct: 122 GVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLST 181

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDS 425
           +  A      ++    +     +  S  SDPD 
Sbjct: 182 MSNA------DIDKQAKMIADKIDFSKMSDPDY 208


>gi|328545468|ref|YP_004305577.1| flagellar basal-body rod protein flgf [polymorphum gilvum
           SL003B-26A1]
 gi|326415209|gb|ADZ72272.1| Flagellar basal-body rod protein flgf [Polymorphum gilvum
           SL003B-26A1]
          Length = 261

 Score =  229 bits (584), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 58/213 (27%), Positives = 97/213 (45%), Gaps = 6/213 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            +M +          +  E +YY  NI    S ++ L + R+  + +++ G+      + 
Sbjct: 13  TNMTRSLDTVASEPTVRRESEYYLANIGKAKSIDDFLGDDRLFKYAMKAFGLQDMDYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +    D  SFAN   D+RY++   +FNF  +G+ +       Q         D 
Sbjct: 73  FMRKVLEEGTDDRNSFANKLADDRYRQFAETFNFTRYGDAATAFTRAQQ------GVVDA 126

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +E +  E +  + LALYF R    I + Y+IL D  L +VV   L L   FA+  
Sbjct: 127 YVRQSLEIQNGESNEGVRLALYFSRKAETIDSAYDILADRALAQVVYAALGLPDEFAMAD 186

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
             K+   ++K + + DFKD + VE FL     M
Sbjct: 187 VDKQAAFIEKRLDLEDFKDPQAVEAFLKRFTTM 219



 Score =  175 bits (442), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 49/191 (25%), Positives = 86/191 (45%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +         ++   TV+ +P V  E  YY   I    +ID+F+ D RLF YA+K
Sbjct: 1   MISTLLQYQMVSTNMTRSLDTVASEPTVRRESEYYLANIGKAKSIDDFLGDDRLFKYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           AFGL DM +A+ F++K+LE    D  S  N+L   +Y+ FA +++F+       +  + +
Sbjct: 61  AFGLQDMDYAKAFMRKVLEEGTDDRNSFANKLADDRYRQFAETFNFTRYGDAATAFTRAQ 120

Query: 121 TIIQDYK-----QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             + D       +    +    +  + YF +    I+S   +  DR L   V  +  +  
Sbjct: 121 QGVVDAYVRQSLEIQNGESNEGVRLALYFSRKAETIDSAYDILADRALAQVVYAALGLPD 180

Query: 176 KYISLPFLKDV 186
           ++      K  
Sbjct: 181 EFAMADVDKQA 191



 Score =  116 bits (291), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/189 (22%), Positives = 79/189 (41%), Gaps = 11/189 (5%)

Query: 113 IQSDIQHKTIIQDYKQ--SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I + +Q++ +  +  +       E     ES+Y+  NI K  S+D    D RL  Y +++
Sbjct: 2   ISTLLQYQMVSTNMTRSLDTVASEPTVRRESEYYLANIGKAKSIDDFLGDDRLFKYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           F +     +  F++ VL  G  +   +  +  D+R+R  AE F F   G         T 
Sbjct: 62  FGLQDMDYAKAFMRKVLEEGTDDRNSFANKLADDRYRQFAETFNFTRYG---DAATAFTR 118

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
            Q + +V  Y   +++     S++      Y+     ++ S  D L D  L +++  +L 
Sbjct: 119 AQ-QGVVDAYVRQSLEIQNGESNEGVRLALYFSRKAETIDSAYDILADRALAQVVYAALG 177

Query: 286 PLNPEITAD 294
             +    AD
Sbjct: 178 LPDEFAMAD 186



 Score = 97.6 bits (241), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 79/220 (35%), Gaps = 40/220 (18%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  +  ++   + Y   +GK KSID+ L                   ++A+ A+ L   D
Sbjct: 22  VASEPTVRRESEYYLANIGKAKSIDDFLGDDR-------------LFKYAMKAFGLQDMD 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R VL     D +S+ANK  DDR  +    FNF   G          +  +   V
Sbjct: 69  YAKAFMRKVLEEGTDDRNSFANKLADDRYRQFAETFNFTRYGDAATAFTRAQQGVVDAYV 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +                      +  Q   + E      Y++    TI S  ++LA++ +
Sbjct: 129 RQ--------------------SLEIQNGESNEGVRLALYFSRKAETIDSAYDILADRAL 168

Query: 527 LNFLLESKGIDSQ------KVREDFLCEIF-KSDLKDPKS 559
              +  + G+  +        +  F+ +     D KDP++
Sbjct: 169 AQVVYAALGLPDEFAMADVDKQAAFIEKRLDLEDFKDPQA 208



 Score = 49.5 bits (116), Expect = 0.002,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 68/214 (31%), Gaps = 25/214 (11%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           +   ++   +       +  +  YY   I    S  DFL D +LFK   +  F L     
Sbjct: 11  VSTNMTRSLDTVASEPTVRRESEYYLANIGKAKSIDDFLGDDRLFKY-AMKAFGLQDMDY 69

Query: 293 ADKFLTLMQEN-------------DPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLD 339
           A  F+  + E              D    Q  +    NF R   ++T     +Q   +  
Sbjct: 70  AKAFMRKVLEEGTDDRNSFANKLADDRYRQ--FAETFNFTRYGDAATAF-TRAQQGVVDA 126

Query: 340 LYKKNCQILHDDKMQS--LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFAL 397
             +++ +I + +  +   L   +      I S  ++L+ +   +   +A         A 
Sbjct: 127 YVRQSLEIQNGESNEGVRLALYFSRKAETIDSAYDILADRALAQVVYAALGLPDEFAMA- 185

Query: 398 DAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSK 431
                ++        + +   +  DP +     K
Sbjct: 186 -----DVDKQAAFIEKRLDLEDFKDPQAVEAFLK 214


>gi|126730141|ref|ZP_01745953.1| flagellar protein, putative [Sagittula stellata E-37]
 gi|126709521|gb|EBA08575.1| flagellar protein, putative [Sagittula stellata E-37]
          Length = 397

 Score =  228 bits (582), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 69/354 (19%), Positives = 138/354 (38%), Gaps = 31/354 (8%)

Query: 342 KKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
           K+         +    + ++  +G + S D+L++ +               L  AL A+ 
Sbjct: 19  KQRTAFNASAYLARDTEYFKEKIGGVTSGDDLVNDRR-------------LLSVALAAFG 65

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
           L+ Q      ++ VL     + D+ ANK KD R + L  AF+F    +        +   
Sbjct: 66  LSDQIDSAYLIKRVLNEGAENDDALANKLKDGRYVALARAFSFEETTNFPFQEEGFAGDI 125

Query: 462 IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL 521
           +    K   +    + +    + N +   + +  +   + +   Y+   I ++ S ++L+
Sbjct: 126 LASYDKRIRSDLADLLEEPEYANNPIAAETLEATVLDGLETTKTYFRETIGSVTSVDDLM 185

Query: 522 ANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
            +  +L   L + G++ +   +  L  +F+    +P + AN   D     +  +F FD  
Sbjct: 186 KDNDLLKVALTAFGVEERTNSKTLLKRVFEEGATNPGALANVLGDKGLIAMTKAFGFD-- 243

Query: 582 GELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI------- 634
                +    ++     D   D Y+ Q  E    E +P I  AL F+R  P +       
Sbjct: 244 ----TEPTTAIRTEEFADKIIDNYQWQAFEDAVNEVNPTIGTALSFQRGAPALAGLSGSE 299

Query: 635 -RNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKK----HIKINDFKD 683
               + +LGDS + +V    L L   F+ +   K++ ++K+       I  FKD
Sbjct: 300 NTKWFNVLGDSTMREVFQTALGLPSSFSQIDIDKQVEMMKEKAASRFGITQFKD 353



 Score =  187 bits (475), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 79/351 (22%), Positives = 140/351 (39%), Gaps = 38/351 (10%)

Query: 1   MIPSH--VAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYA 58
           MIP    +     +   SK  +  +    ++ +  Y++E+I  +++ D+ + D+RL S A
Sbjct: 1   MIPGSGLIGWQVLQTTMSKQRTAFNASAYLARDTEYFKEKIGGVTSGDDLVNDRRLLSVA 60

Query: 59  LKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDI 117
           L AFGLSD   +   IK++L     +  +L N+L   +Y   AR++ F        Q + 
Sbjct: 61  LAAFGLSDQIDSAYLIKRVLNEGAENDDALANKLKDGRYVALARAFSFEETTNFPFQEEG 120

Query: 118 QHKTIIQDYKQSHQHKEEVALEE------------------------SKYFRKNIHKINS 153
               I+  Y +  +      LEE                          YFR+ I  + S
Sbjct: 121 FAGDILASYDKRIRSDLADLLEEPEYANNPIAAETLEATVLDGLETTKTYFRETIGSVTS 180

Query: 154 VDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENF 213
           VD L KD  LL   L +F +  +  S   LK V   G  NP        D    AM + F
Sbjct: 181 VDDLMKDNDLLKVALTAFGVEERTNSKTLLKRVFEEGATNPGALANVLGDKGLIAMTKAF 240

Query: 214 RFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV-PIVSDQNYYKLAINSV-------- 264
            F  + + + R +   D  I+      F + ++ V P +     ++    ++        
Sbjct: 241 GFDTEPTTAIRTEEFADKIIDNYQWQAFEDAVNEVNPTIGTALSFQRGAPALAGLSGSEN 300

Query: 265 SSFSDFLKDPKLFKMLQLSLFPLN--PEITADKFLTLMQENDPIVSQVKYF 313
           + + + L D  + ++ Q +L   +   +I  DK + +M+E       +  F
Sbjct: 301 TKWFNVLGDSTMREVFQTALGLPSSFSQIDIDKQVEMMKEKAASRFGITQF 351



 Score =  111 bits (278), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/205 (17%), Positives = 79/205 (38%), Gaps = 26/205 (12%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            +M +  T    +  +  + +Y+   I  + S ++L+ ++R+L+  L + G+  Q     
Sbjct: 15  TTMSKQRTAFNASAYLARDTEYFKEKIGGVTSGDDLVNDRRLLSVALAAFGLSDQIDSAY 74

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            +  +     ++  + AN  KD RY  +  +F+F+             Q+     D    
Sbjct: 75  LIKRVLNEGAENDDALANKLKDGRYVALARAFSFEE------TTNFPFQEEGFAGDILAS 128

Query: 605 YKHQ-------MIEKKEEEKDPNIALAL-------------YFKRTIPNIRNHYEILGDS 644
           Y  +       ++E+ E   +P  A  L             YF+ TI ++ +  +++ D+
Sbjct: 129 YDKRIRSDLADLLEEPEYANNPIAAETLEATVLDGLETTKTYFRETIGSVTSVDDLMKDN 188

Query: 645 KLFKVVSKKLKLSPYFAVLPERKKI 669
            L KV      +          K++
Sbjct: 189 DLLKVALTAFGVEERTNSKTLLKRV 213



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 41/274 (14%), Positives = 95/274 (34%), Gaps = 49/274 (17%)

Query: 232 QIEKIVSNYFNNTIDCVP-IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
           Q+ +   +      +    +  D  Y+K  I  V+S  D + D +L  +   +    +  
Sbjct: 11  QVLQTTMSKQRTAFNASAYLARDTEYFKEKIGGVTSGDDLVNDRRLLSVALAAFGLSDQI 70

Query: 291 ITA---DKFLTLMQENDP----------IVSQVKYF-----FQINFHRDNSSSTKIQQ-- 330
            +A    + L    END            V+  + F         F  +  +   +    
Sbjct: 71  DSAYLIKRVLNEGAENDDALANKLKDGRYVALARAFSFEETTNFPFQEEGFAGDILASYD 130

Query: 331 ---DSQIQKMLDLYKKNCQILHDDKMQSLI--------KDYQLPLGKIKSIDNLLSGKCQ 379
               S +  +L+  +     +  + +++ +          ++  +G + S+D+L+     
Sbjct: 131 KRIRSDLADLLEEPEYANNPIAAETLEATVLDGLETTKTYFRETIGSVTSVDDLMKDN-- 188

Query: 380 LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
                        L+ AL A+ +  +   +  L+ V     ++P + AN   D  LI + 
Sbjct: 189 -----------DLLKVALTAFGVEERTNSKTLLKRVFEEGATNPGALANVLGDKGLIAMT 237

Query: 440 HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRK 473
            AF F+ +    P   +++       + +Y  + 
Sbjct: 238 KAFGFDTE----PTTAIRTEEFADKIIDNYQWQA 267


>gi|118589944|ref|ZP_01547348.1| flagellar basal-body rod protein flgf [Stappia aggregata IAM 12614]
 gi|118437441|gb|EAV44078.1| flagellar basal-body rod protein flgf [Stappia aggregata IAM 12614]
          Length = 262

 Score =  227 bits (579), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 58/224 (25%), Positives = 105/224 (46%), Gaps = 6/224 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            +ME+       +  +  + +YY  NI  I + +E L + RI N+ + + G++     + 
Sbjct: 13  TNMERSLKTVAADPMVERQTEYYRENIRDIKTIDEFLGDDRIFNYAMTAMGLEDMIYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +    D  +FAN   D +YK    +FNF  +GE +     + Q     +     
Sbjct: 73  FIRKVLEEGTDDRGAFANQLADTKYKNFAETFNFKRYGE-TTTSFARTQ-----EAIVQK 126

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +E +E E++  + LALYF+R  P+I N Y++L D  L + V   L L   FA+  
Sbjct: 127 YHRQTLEVREGEQNQGVRLALYFERRAPDITNAYDVLADRALAEAVYTSLGLPQEFAMTD 186

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKAL 708
             K+   L++ +  + F D+  +  FL    A+   S     ++
Sbjct: 187 IDKQAAYLEERLDFSKFGDADYLAKFLNRFSALYDLSNGPTGSM 230



 Score =  174 bits (441), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 108/240 (45%), Gaps = 11/240 (4%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI +       +    +   TV+ DP+V  +  YYRE I+ I TIDEF+ D R+F+YA+ 
Sbjct: 1   MINTLSQVQLVRTNMERSLKTVAADPMVERQTEYYRENIRDIKTIDEFLGDDRIFNYAMT 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A GL DM +A+ FI+K+LE    D  +  NQL   KY+ FA +++F    +   S  + +
Sbjct: 61  AMGLEDMIYAKAFIRKVLEEGTDDRGAFANQLADTKYKNFAETFNFKRYGETTTSFARTQ 120

Query: 121 TII-----QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             I     +   +  + ++   +  + YF +    I +   +  DR L + V  S  +  
Sbjct: 121 EAIVQKYHRQTLEVREGEQNQGVRLALYFERRAPDITNAYDVLADRALAEAVYTSLGLPQ 180

Query: 176 KYISLPFLKDV--LTLGLANP---KKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           ++      K    L   L         ++    NRF A+ +     P GS+S    +  +
Sbjct: 181 EFAMTDIDKQAAYLEERLDFSKFGDADYLAKFLNRFSALYDLSN-GPTGSMSPTLALFGN 239



 Score =  117 bits (292), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 29/167 (17%), Positives = 66/167 (39%), Gaps = 1/167 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
                + +   +++Y+R+NI  I ++D+   D R+ +Y + +  +     +  F++ VL 
Sbjct: 20  KTVAADPMVERQTEYYRENIRDIKTIDEFLGDDRIFNYAMTAMGLEDMIYAKAFIRKVLE 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G  +   +  +  D +++  AE F F+  G  +       +  ++K           + 
Sbjct: 80  EGTDDRGAFANQLADTKYKNFAETFNFKRYGETTTSFARTQEAIVQKYHRQTLEVREGEQ 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
              V    Y++     +++  D L D  L + +  SL         D
Sbjct: 140 NQGVRLALYFERRAPDITNAYDVLADRALAEAVYTSLGLPQEFAMTD 186



 Score = 85.7 bits (210), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 28/202 (13%), Positives = 61/202 (30%), Gaps = 34/202 (16%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +  D  ++   + Y+  +  IK+ID  L                    +A+ A  L    
Sbjct: 22  VAADPMVERQTEYYRENIRDIKTIDEFLGDDR-------------IFNYAMTAMGLEDMI 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R VL     D  ++AN+  D +       FNF   G             ++   
Sbjct: 69  YAKAFIRKVLEEGTDDRGAFANQLADTKYKNFAETFNFKRYGETTTSFARTQEAIVQKYH 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +                         ++    +      Y+      I +  ++LA++ +
Sbjct: 129 RQTLE--------------------VREGEQNQGVRLALYFERRAPDITNAYDVLADRAL 168

Query: 527 LNFLLESKGIDSQKVREDFLCE 548
              +  S G+  Q+     + +
Sbjct: 169 AEAVYTSLGL-PQEFAMTDIDK 189



 Score = 54.1 bits (128), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 34/244 (13%), Positives = 79/244 (32%), Gaps = 23/244 (9%)

Query: 226 KILTDMQIEKIVSNYFNNTIDCVPIVSDQN-YYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             L+ +Q+ +        T+   P+V  Q  YY+  I  + +  +FL D ++F     ++
Sbjct: 3   NTLSQVQLVRTNMERSLKTVAADPMVERQTEYYRENIRDIKTIDEFLGDDRIFNYAMTAM 62

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKY----------FFQINFHRDNSSSTKIQQDSQI 334
              +          +++E                        NF R   ++T   + +Q 
Sbjct: 63  GLEDMIYAKAFIRKVLEEGTDDRGAFANQLADTKYKNFAETFNFKRYGETTTSFAR-TQE 121

Query: 335 QKMLDLYKKNCQILHDDKMQS--LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
             +   +++  ++   ++ Q   L   ++     I +  ++L+ +   E   ++      
Sbjct: 122 AIVQKYHRQTLEVREGEQNQGVRLALYFERRAPDITNAYDVLADRALAEAVYTSLGLPQE 181

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGP 452
                     ++          +  S   D D  A     +R   L    N    GS+ P
Sbjct: 182 FAMT------DIDKQAAYLEERLDFSKFGDADYLAKFL--NRFSALYDLSN-GPTGSMSP 232

Query: 453 IPMM 456
              +
Sbjct: 233 TLAL 236


>gi|150395478|ref|YP_001325945.1| hypothetical protein Smed_0251 [Sinorhizobium medicae WSM419]
 gi|150026993|gb|ABR59110.1| protein of unknown function DUF1217 [Sinorhizobium medicae WSM419]
          Length = 259

 Score =  227 bits (577), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 60/250 (24%), Positives = 107/250 (42%), Gaps = 11/250 (4%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            + + +       + +   +     ++  E +YY   I +I + +E  A+ R+ ++ +++
Sbjct: 2   TTTYTSYKLITADLTKSLERVSEQPDVARETEYYLSKIGSIKTLDEFFADSRLYDYAMKA 61

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G++     + F+ ++    +    +FAN   D RYK ++ S NF  HGE +        
Sbjct: 62  HGLEDMAYAKAFMRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGEAATSF----- 116

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKK 653
                    + Y  Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV   
Sbjct: 117 -ERAQKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRTV 175

Query: 654 LKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-----DHQSIDYKKAL 708
           L+L   FA     ++    +  + + DF+D  KV +FL    A+          D     
Sbjct: 176 LQLPEEFAATDVDRQAAAYESAVDLKDFQDPHKVAEFLDRFTALWEIDNSSDGYDPLAVF 235

Query: 709 FSSPNQNKDP 718
            SS      P
Sbjct: 236 GSSSGYGISP 245



 Score =  163 bits (413), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 43/191 (22%), Positives = 85/191 (44%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  ++ +        +K    VS+ P V+ E  YY  +I  I T+DEF  D RL+ YA+K
Sbjct: 1   MTTTYTSYKLITADLTKSLERVSEQPDVARETEYYLSKIGSIKTLDEFFADSRLYDYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+   +   S  + +
Sbjct: 61  AHGLEDMAYAKAFMRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGEAATSFERAQ 120

Query: 121 TII-----QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             +     +   +    +E   +  + YF++    I +  ++  D  L   V     +  
Sbjct: 121 KGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLPE 180

Query: 176 KYISLPFLKDV 186
           ++ +    +  
Sbjct: 181 EFAATDVDRQA 191



 Score =  109 bits (272), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 75/197 (38%), Gaps = 3/197 (1%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
             +   +K I  D  +S +   ++     E++Y+   I  I ++D+ F D RL DY +++
Sbjct: 2   TTTYTSYKLITADLTKSLERVSEQPDVARETEYYLSKIGSIKTLDEFFADSRLYDYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
             +     +  F++ VL  G+ +   +  +  D R++++ E+  F   G  +   +    
Sbjct: 62  HGLEDMAYAKAFMRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGEAATSFERAQK 121

Query: 231 MQIEKIVSNYFNNTI-DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP 289
              EK           +    V    Y++    ++++  + + D  L  +++  L     
Sbjct: 122 GVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLPEE 181

Query: 290 EITADKFLTLMQENDPI 306
               D           +
Sbjct: 182 FAATDVDRQAAAYESAV 198



 Score = 77.2 bits (188), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 62/213 (29%), Gaps = 33/213 (15%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             DL K   ++     +    + Y   +G IK++D   +                   +A
Sbjct: 12  TADLTKSLERVSEQPDVARETEYYLSKIGSIKTLDEFFADSR-------------LYDYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + A+ L      +  +R VL       D++ANK  D R   L  + NF   G        
Sbjct: 59  MKAHGLEDMAYAKAFMRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGEAATSFER 118

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
             +       +    +K                                Y+     TI +
Sbjct: 119 AQKGVAEKYTRQTLEQK--------------------AGEENTGVRLALYFQRMAPTIAN 158

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
             E++A++ + + +     +  +    D   + 
Sbjct: 159 GYEIIADEALSHVVRTVLQLPEEFAATDVDRQA 191



 Score = 39.1 bits (89), Expect = 2.9,   Method: Composition-based stats.
 Identities = 11/118 (9%), Positives = 32/118 (27%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           I   ++       +   +  +  YY   I S+ +  +F  D +L+     +    +    
Sbjct: 11  ITADLTKSLERVSEQPDVARETEYYLSKIGSIKTLDEFFADSRLYDYAMKAHGLEDMAYA 70

Query: 293 ADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHD 350
                 ++ E                ++    S    +  +     +  +K     + 
Sbjct: 71  KAFMRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGEAATSFERAQKGVAEKYT 128


>gi|126031430|pdb|2O8S|A Chain A, X-Ray Crystal Structure Of Protein Agr_c_984 From
           Agrobacterium Tumefaciens. Northeast Structural Genomics
           Consortium Target Atr120.
 gi|126031431|pdb|2O8S|B Chain B, X-Ray Crystal Structure Of Protein Agr_c_984 From
           Agrobacterium Tumefaciens. Northeast Structural Genomics
           Consortium Target Atr120
          Length = 323

 Score =  225 bits (572), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 54/250 (21%), Positives = 98/250 (39%), Gaps = 11/250 (4%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            S + +       + +   +     ++  E +YY   I ++ S ++  A+ R+ N+ L++
Sbjct: 55  TSTYTSYRLISQDIGKSLERVSKQPDVARETEYYREKIGSVKSIDDFXADTRLYNYALKA 114

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G++     + F+ ++      D  +FAN   DNRY E+  S +F               
Sbjct: 115 HGLEDXAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAG------LGAAATA 168

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKK 653
                      Y  Q +E++  + +  + LALYF+R  P I++  + L D  L +V    
Sbjct: 169 TEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTT 228

Query: 654 LKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKA-----MDHQSIDYKKAL 708
             L   FA     K+  +++K I I D +D +KV   L              + D     
Sbjct: 229 FNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLLERFTIXWEXQNPSTTYDPLAVF 288

Query: 709 FSSPNQNKDP 718
            SS      P
Sbjct: 289 GSSSGYGISP 298



 Score =  168 bits (424), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 49/189 (25%), Positives = 84/189 (44%), Gaps = 5/189 (2%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
            ++ +         K    VSK P V+ E  YYRE+I  + +ID+F  D RL++YALKA 
Sbjct: 56  STYTSYRLISQDIGKSLERVSKQPDVARETEYYREKIGSVKSIDDFXADTRLYNYALKAH 115

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTI 122
           GL D ++A+ FI+K+L    SD  +  N+L+  +Y   A+S DF+       +    K+ 
Sbjct: 116 GLEDXAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAAATATEAAKSG 175

Query: 123 I-----QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           +     +   +     +   +  + YF +    I S      D  L      +F++   +
Sbjct: 176 VIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTFNLPDAF 235

Query: 178 ISLPFLKDV 186
            +    K  
Sbjct: 236 AAADVDKQA 244



 Score =  124 bits (310), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 40/194 (20%), Positives = 82/194 (42%), Gaps = 11/194 (5%)

Query: 108 PPPKVIQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLD 165
               V  +   ++ I QD  +S +   K+     E++Y+R+ I  + S+D    D RL +
Sbjct: 50  SGGSVTSTYTSYRLISQDIGKSLERVSKQPDVARETEYYREKIGSVKSIDDFXADTRLYN 109

Query: 166 YVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD 225
           Y L++  +     +  F++ VLT G ++   +  +  DNR+  +A++  F          
Sbjct: 110 YALKAHGLEDXAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAG----LGAA 165

Query: 226 KILTDMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKML 280
              T+     ++ NY   T++      +       Y++    ++ S  DFL D  L ++ 
Sbjct: 166 ATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVF 225

Query: 281 QLSLFPLNPEITAD 294
           + +    +    AD
Sbjct: 226 RTTFNLPDAFAAAD 239



 Score = 90.3 bits (222), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 64/203 (31%), Gaps = 33/203 (16%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +     +    + Y+  +G +KSID+  +                   +AL A+ L    
Sbjct: 75  VSKQPDVARETEYYREKIGSVKSIDDFXADTR-------------LYNYALKAHGLEDXA 121

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R VLT   SD +++ANK  D+R  +L  + +F   G+            I +  
Sbjct: 122 YAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAAATATEAAKSGVIGNYA 181

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    ++    +                           Y+     TI S  + LA+  +
Sbjct: 182 RQTLEQEAGDDNNG--------------------VRLALYFERKAPTIKSGLDFLADDAL 221

Query: 527 LNFLLESKGIDSQKVREDFLCEI 549
                 +  +       D   + 
Sbjct: 222 AQVFRTTFNLPDAFAAADVDKQA 244



 Score = 49.1 bits (115), Expect = 0.003,   Method: Composition-based stats.
 Identities = 27/221 (12%), Positives = 64/221 (28%), Gaps = 21/221 (9%)

Query: 219 GSLSKRDKILTDMQIEKIVSNYFNNTIDCVP----IVSDQNYYKLAINSVSSFSDFLKDP 274
           GS      + +     +++S     +++ V     +  +  YY+  I SV S  DF  D 
Sbjct: 46  GSNESGGSVTSTYTSYRLISQDIGKSLERVSKQPDVARETEYYREKIGSVKSIDDFXADT 105

Query: 275 KLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQI 334
           +L+     +    +          ++ E     +        N + + + S         
Sbjct: 106 RLYNYALKAHGLEDXAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAA 165

Query: 335 QKMLDLYKKN-----------CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGP 383
               +  K              +   D+    L   ++     IKS  + L+     +  
Sbjct: 166 ATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVF 225

Query: 384 NSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPD 424
            +          A      ++        +++   +  DP+
Sbjct: 226 RTTFNLPDAFAAA------DVDKQAALIEKSINIKDLQDPE 260


>gi|307311550|ref|ZP_07591191.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
 gi|306899567|gb|EFN30196.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
          Length = 259

 Score =  223 bits (567), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 58/250 (23%), Positives = 106/250 (42%), Gaps = 11/250 (4%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            + + +       + +   +     ++  E +YY   I +I + ++  A+ R+ N+ +++
Sbjct: 2   TTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKA 61

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G++     + F+ ++    +    +FAN   D RYK ++ S NF  HGE +        
Sbjct: 62  HGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAF----- 116

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKK 653
                    + Y  Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV   
Sbjct: 117 -ERAQKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTV 175

Query: 654 LKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-----DHQSIDYKKAL 708
           L+L   FA     ++    +  I   DF+D +K+ +FL    A+          D     
Sbjct: 176 LQLPAEFAAADVDRQADAYEAAIDFKDFQDPQKIAEFLDRFTALWEIDNSSDGYDPLAVF 235

Query: 709 FSSPNQNKDP 718
            +       P
Sbjct: 236 GALSGYGISP 245



 Score =  161 bits (407), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 85/191 (44%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  ++ +        +K    VS  P V+ E  YY  +I  I T+D+F  D RL++YA+K
Sbjct: 1   MTTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+   +   +  + +
Sbjct: 61  AHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQ 120

Query: 121 TII-----QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             +     +   +    +E   +  + YF++    I +  ++  D  L   V     +  
Sbjct: 121 KGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLPA 180

Query: 176 KYISLPFLKDV 186
           ++ +    +  
Sbjct: 181 EFAAADVDRQA 191



 Score =  109 bits (272), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/233 (15%), Positives = 87/233 (37%), Gaps = 7/233 (3%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
             +   ++ I  D  +S +    +     E++Y+   I  I ++D  F D RL +Y +++
Sbjct: 2   TTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
             +     +  F++ VL  G+ +   +  +  D R++A+ E+  F   G  +   +    
Sbjct: 62  HGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQK 121

Query: 231 MQIEKIVSNYFNNTI-DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP 289
              EK           +    V    Y++    ++++  + + D  L  +++  L     
Sbjct: 122 GVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLPAE 181

Query: 290 EITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYK 342
              AD    + ++ D   + + +    +  +      +     +I    D Y 
Sbjct: 182 FAAAD----VDRQADAYEAAIDFKDFQDPQKIAEFLDRFTALWEIDNSSDGYD 230



 Score = 78.8 bits (192), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 64/213 (30%), Gaps = 33/213 (15%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             DL K   ++     +    + Y   +G IK++D+  +                   +A
Sbjct: 12  TADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSR-------------LYNYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + A+ L      +  +R VL       D++ANK  D R   L  + NF   G        
Sbjct: 59  MKAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFER 118

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
             +       +    +K                                Y+     TI +
Sbjct: 119 AQKGVAEKYTRQTLEQK--------------------AGEENTGVRLALYFQRMAPTIAN 158

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
             E++A++ + + +     + ++    D   + 
Sbjct: 159 GYEIIADEALSSVVRTVLQLPAEFAAADVDRQA 191


>gi|15964408|ref|NP_384761.1| hypothetical protein SMc03023 [Sinorhizobium meliloti 1021]
 gi|307318905|ref|ZP_07598336.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
 gi|15073585|emb|CAC45227.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306895319|gb|EFN26074.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
          Length = 259

 Score =  223 bits (567), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 59/250 (23%), Positives = 107/250 (42%), Gaps = 11/250 (4%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            + + +       + +   +     ++  E +YY   I +I + ++  A+ R+ N+ +++
Sbjct: 2   TTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKA 61

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G++     + F+ ++    +    +FAN   D RYK ++ S NF  HGE +        
Sbjct: 62  HGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAF----- 116

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKK 653
                    + Y  Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV   
Sbjct: 117 -ERAQKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTV 175

Query: 654 LKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-----DHQSIDYKKAL 708
           L+L   FA     ++    +  I   DF+D +K+ +FL    A+          D     
Sbjct: 176 LQLPAEFAAADVDRQADAYEAAIDFKDFQDPQKIAEFLDRFTALWEIDNSSDGYDPLAVF 235

Query: 709 FSSPNQNKDP 718
            +S      P
Sbjct: 236 GASSGYGISP 245



 Score =  161 bits (406), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 85/191 (44%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  ++ +        +K    VS  P V+ E  YY  +I  I T+D+F  D RL++YA+K
Sbjct: 1   MTTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+   +   +  + +
Sbjct: 61  AHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQ 120

Query: 121 TII-----QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             +     +   +    +E   +  + YF++    I +  ++  D  L   V     +  
Sbjct: 121 KGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLPA 180

Query: 176 KYISLPFLKDV 186
           ++ +    +  
Sbjct: 181 EFAAADVDRQA 191



 Score =  109 bits (271), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 73/185 (39%), Gaps = 3/185 (1%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
             +   ++ I  D  +S +    +     E++Y+   I  I ++D  F D RL +Y +++
Sbjct: 2   TTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
             +     +  F++ VL  G+ +   +  +  D R++A+ E+  F   G  +   +    
Sbjct: 62  HGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQK 121

Query: 231 MQIEKIVSNYFNNTI-DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP 289
              EK           +    V    Y++    ++++  + + D  L  +++  L     
Sbjct: 122 GVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLPAE 181

Query: 290 EITAD 294
              AD
Sbjct: 182 FAAAD 186



 Score = 78.8 bits (192), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/213 (14%), Positives = 64/213 (30%), Gaps = 33/213 (15%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             DL K   ++     +    + Y   +G IK++D+  +                   +A
Sbjct: 12  TADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSR-------------LYNYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + A+ L      +  +R VL       D++ANK  D R   L  + NF   G        
Sbjct: 59  MKAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFER 118

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
             +       +    +K                                Y+     TI +
Sbjct: 119 AQKGVAEKYTRQTLEQK--------------------AGEENTGVRLALYFQRMAPTIAN 158

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
             E++A++ + + +     + ++    D   + 
Sbjct: 159 GYEIIADEALSSVVRTVLQLPAEFAAADVDRQA 191


>gi|325291946|ref|YP_004277810.1| hypothetical protein AGROH133_03954 [Agrobacterium sp. H13-3]
 gi|325059799|gb|ADY63490.1| hypothetical protein AGROH133_03954 [Agrobacterium sp. H13-3]
          Length = 259

 Score =  222 bits (566), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 52/250 (20%), Positives = 100/250 (40%), Gaps = 11/250 (4%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            S + +       + +   +     ++  E +YY   I ++ S ++ +A+ R+ N+ L++
Sbjct: 2   TSTYTSYRLISQDIGKSLERVSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYALKA 61

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G++     + F+ ++      D  +FAN   D+RY ++  S +F   G  +        
Sbjct: 62  NGLEDMAYAKAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATATEAA-- 119

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKK 653
                      Y  Q +E++    +  + LALYF+R  P I++  + L D  L +V    
Sbjct: 120 ----QSGIISKYTRQTLEQEAGGDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTA 175

Query: 654 LKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-----DHQSIDYKKAL 708
             L    A     K+  +++K I I D ++ +KV   L     M        + D     
Sbjct: 176 YNLPDEIAAGSVEKQAALIEKSINIKDLQNPEKVGKLLERFTIMWEMQNPSTTYDPLAVF 235

Query: 709 FSSPNQNKDP 718
            SS      P
Sbjct: 236 GSSSGYGISP 245



 Score =  170 bits (429), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 47/191 (24%), Positives = 86/191 (45%), Gaps = 5/191 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  ++ +         K    VSK P V+ E  YYR +I  + ++D+F+ D RL++YALK
Sbjct: 1   MTSTYTSYRLISQDIGKSLERVSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYALK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A GL DM++A+ FI+K+L    +D  +  N+L+  +Y   A+S DF+       +    +
Sbjct: 61  ANGLEDMAYAKAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATATEAAQ 120

Query: 121 TII-----QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + I     +   +     +   +  + YF +    I S      D  L      ++++  
Sbjct: 121 SGIISKYTRQTLEQEAGGDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTAYNLPD 180

Query: 176 KYISLPFLKDV 186
           +  +    K  
Sbjct: 181 EIAAGSVEKQA 191



 Score =  122 bits (305), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 43/188 (22%), Positives = 84/188 (44%), Gaps = 12/188 (6%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
             +   ++ I QD  +S +   K+     E++Y+R  I  + SVD    D RL +Y L++
Sbjct: 2   TSTYTSYRLISQDIGKSLERVSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYALKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
             +     +  F++ VLT G A+   +  +  D+R+  +A++  F   G+ +   +    
Sbjct: 62  NGLEDMAYAKAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATATE---- 117

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
                I+S Y   T++      +       Y++    ++ S  DFL D  L ++ + + +
Sbjct: 118 AAQSGIISKYTRQTLEQEAGGDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTA-Y 176

Query: 286 PLNPEITA 293
            L  EI A
Sbjct: 177 NLPDEIAA 184



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 29/203 (14%), Positives = 62/203 (30%), Gaps = 33/203 (16%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +     +    + Y+  +G +KS+D+ ++                   +AL A  L    
Sbjct: 22  VSKQPDVARETEYYRSKIGSVKSVDDFMADTR-------------LYNYALKANGLEDMA 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R VLT   +D +++ANK  D R   L  + +F + G+            I    
Sbjct: 69  YAKAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATATEAAQSGIISKYT 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +    ++    +                           Y+     TI S  + LA+  +
Sbjct: 129 RQTLEQEAGGDNNG--------------------VRLALYFERKAPTIKSGLDFLADDAL 168

Query: 527 LNFLLESKGIDSQKVREDFLCEI 549
                 +  +  +        + 
Sbjct: 169 AQVFRTAYNLPDEIAAGSVEKQA 191



 Score = 46.8 bits (109), Expect = 0.015,   Method: Composition-based stats.
 Identities = 28/166 (16%), Positives = 56/166 (33%), Gaps = 13/166 (7%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN---- 288
           I + +            +  +  YY+  I SV S  DF+ D +L+     +    +    
Sbjct: 11  ISQDIGKSLERVSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYALKANGLEDMAYA 70

Query: 289 --------PEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL 340
                    E TADK     + +D   S +            +++T+  Q   I K    
Sbjct: 71  KAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATATEAAQSGIISKYTRQ 130

Query: 341 YKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSA 386
             +      ++ ++ L   ++     IKS  + L+     +   +A
Sbjct: 131 TLEQEAGGDNNGVR-LALYFERKAPTIKSGLDFLADDALAQVFRTA 175


>gi|254500914|ref|ZP_05113065.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436985|gb|EEE43664.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 276

 Score =  220 bits (560), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 100/224 (44%), Gaps = 7/224 (3%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           N+M++       +  ++ + +YY  NI  I S ++ +A+ RI  + + + G++     + 
Sbjct: 26  NNMDRSLATVAADPVVDRQTEYYRENIRNIKSVDDFMADDRIYRYAMTAMGLEDMIYAKA 85

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++         +FAN   D++Y+    +FNF  +GE +     + Q+        D 
Sbjct: 86  FMRKVLTEGTASRAAFANQLADSKYRNFAETFNFANYGETAT-SFSRTQEG-----IVDK 139

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           +  Q +E KE  ++  + LALYF+R    I   ++IL D  L + V   L L   FA+  
Sbjct: 140 FHRQTLEVKEGAQNDGVRLALYFERKASEITGPFDILADRALAETVRTALGLPDAFALTD 199

Query: 665 ERKKIRILKKHIKINDF-KDSKKVEDFLYAAKAMDHQSIDYKKA 707
             K+     KH+       D + +  FL    AM   S   + A
Sbjct: 200 IDKQAEYFDKHLDYEKLSSDPEYLSKFLERFSAMYDLSNGAQTA 243



 Score =  170 bits (431), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 46/180 (25%), Positives = 89/180 (49%), Gaps = 5/180 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI +       ++   +  +TV+ DP+V  +  YYRE I++I ++D+F+ D R++ YA+ 
Sbjct: 14  MINTLTQVQIVRNNMDRSLATVAADPVVDRQTEYYRENIRNIKSVDDFMADDRIYRYAMT 73

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A GL DM +A+ F++K+L    +   +  NQL   KY+ FA +++F+   +   S  + +
Sbjct: 74  AMGLEDMIYAKAFMRKVLTEGTASRAAFANQLADSKYRNFAETFNFANYGETATSFSRTQ 133

Query: 121 TIIQDYK-----QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             I D       +  +  +   +  + YF +   +I     +  DR L + V  +  +  
Sbjct: 134 EGIVDKFHRQTLEVKEGAQNDGVRLALYFERKASEITGPFDILADRALAETVRTALGLPD 193



 Score =  113 bits (281), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/175 (21%), Positives = 72/175 (41%), Gaps = 9/175 (5%)

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
           D   +    + V   +++Y+R+NI  I SVD    D R+  Y + +  +     +  F++
Sbjct: 29  DRSLATVAADPVVDRQTEYYRENIRNIKSVDDFMADDRIYRYAMTAMGLEDMIYAKAFMR 88

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNT 244
            VLT G A+   +  +  D+++R  AE F F   G  +           E IV  +   T
Sbjct: 89  KVLTEGTASRAAFANQLADSKYRNFAETFNFANYGETATSFSRT----QEGIVDKFHRQT 144

Query: 245 IDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
           ++      +       Y++   + ++   D L D  L + ++ +L   +     D
Sbjct: 145 LEVKEGAQNDGVRLALYFERKASEITGPFDILADRALAETVRTALGLPDAFALTD 199



 Score = 88.0 bits (216), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 61/205 (29%), Gaps = 33/205 (16%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
             +  D  +    + Y+  +  IKS+D+ ++                  ++A+ A  L  
Sbjct: 33  ATVAADPVVDRQTEYYRENIRNIKSVDDFMADDR-------------IYRYAMTAMGLED 79

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R VLT   +   ++AN+  D +       FNF   G             +  
Sbjct: 80  MIYAKAFMRKVLTEGTASRAAFANQLADSKYRNFAETFNFANYGETATSFSRTQEGIVDK 139

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
             +     K    +                    +      Y+    + I    ++LA++
Sbjct: 140 FHRQTLEVKEGAQN--------------------DGVRLALYFERKASEITGPFDILADR 179

Query: 525 RILNFLLESKGIDSQKVREDFLCEI 549
            +   +  + G+       D   + 
Sbjct: 180 ALAETVRTALGLPDAFALTDIDKQA 204



 Score = 50.3 bits (118), Expect = 0.001,   Method: Composition-based stats.
 Identities = 33/233 (14%), Positives = 77/233 (33%), Gaps = 27/233 (11%)

Query: 222 SKRDKILTDMQIEKIVSNYFNNTIDCVPIV-SDQNYYKLAINSVSSFSDFLKDPKLFKML 280
           +     LT +QI +   +    T+   P+V     YY+  I ++ S  DF+ D ++++  
Sbjct: 12  ADMINTLTQVQIVRNNMDRSLATVAADPVVDRQTEYYRENIRNIKSVDDFMADDRIYRYA 71

Query: 281 QLSLFPLNPEITADKFLTLMQENDPIVSQVKY----------FFQINFHRDNSSSTKIQQ 330
             ++   +          ++ E     +                  NF     ++T   +
Sbjct: 72  MTAMGLEDMIYAKAFMRKVLTEGTASRAAFANQLADSKYRNFAETFNFANYGETATSFSR 131

Query: 331 DSQIQKMLDLYKKNCQILHDDKMQS---LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAE 387
               + ++D + +    + +        L   ++    +I    ++L+ +   E   +A 
Sbjct: 132 TQ--EGIVDKFHRQTLEVKEGAQNDGVRLALYFERKASEITGPFDILADRALAETVRTAL 189

Query: 388 EPIITLQFALDAYNLNMQDLDRDQLRNVL--TSNPSDPDSYANKSKDDRLIKL 438
                     DA+ L   D   +     L      SDP+  +     +R   +
Sbjct: 190 GLP-------DAFALTDIDKQAEYFDKHLDYEKLSSDPEYLSKFL--ERFSAM 233


>gi|319409193|emb|CBI82837.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 266

 Score =  219 bits (557), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 67/272 (24%), Positives = 118/272 (43%), Gaps = 30/272 (11%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S + +   + ++M+Q S+Q     ++  E DYY  +I  I S ++ LA+ RI  + +++ 
Sbjct: 3   STYMSYRSTIDNMKQTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDRIYRYAMKAY 62

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G++     +  + ++      DP  +A+   D RY++  ++FNF ++GE +       Q 
Sbjct: 63  GLEDMIYAKGMMRKVL----SDPD-YASQLTDRRYQQFAAAFNFSVYGEEAT------QR 111

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN---------HYEILGDSK 645
                 T + Y  Q +E K  E++    LALYF RTI  +            Y+ILGD  
Sbjct: 112 ESAKTGTVNKYMQQTLEIKVGEENEGTRLALYFTRTIGEMTKSGVLSEKSWAYQILGDKA 171

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYK 705
           L  VV   L +           +  +L+  + + D +D KK+E F+    AM     D +
Sbjct: 172 LSAVVFTALNIPESVRSSKIEAQKSLLESRMSLGDLEDPKKLEQFIARFSAM----YDAQ 227

Query: 706 KALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQ 737
                    + +P      D      L  SP+
Sbjct: 228 NR------TDTNPALTLLQDSNLGSGLAFSPE 253



 Score =  169 bits (427), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 61/235 (25%), Positives = 104/235 (44%), Gaps = 28/235 (11%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++++   + D   +  S +  +P V  E  YY   I  I ++D+F+ D R++ YA+K
Sbjct: 1   MISTYMSYRSTIDNMKQTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDRIYRYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM +A+  ++K+L    SDP    +QL   +YQ FA +++FS    +  Q +   
Sbjct: 61  AYGLEDMIYAKGMMRKVL----SDPD-YASQLTDRRYQQFAAAFNFSVYGEEATQRESAK 115

Query: 120 KTIIQDYKQSHQH----KEEVALEESKYFRKNIHKIN---------SVDQLFKDRRLLDY 166
              +  Y Q        +E      + YF + I ++             Q+  D+ L   
Sbjct: 116 TGTVNKYMQQTLEIKVGEENEGTRLALYFTRTIGEMTKSGVLSEKSWAYQILGDKALSAV 175

Query: 167 VLQSFSITPKYIS------LPFLKDVLTL-GLANPKKYFIESRDNRFRAMAENFR 214
           V  + +I     S         L+  ++L  L +PKK   E    RF AM +   
Sbjct: 176 VFTALNIPESVRSSKIEAQKSLLESRMSLGDLEDPKKL--EQFIARFSAMYDAQN 228



 Score = 90.7 bits (223), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 32/184 (17%), Positives = 69/184 (37%), Gaps = 17/184 (9%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I + + +++ I + KQ+      E     E+ Y+  +I  I SVD    D R+  Y +++
Sbjct: 2   ISTYMSYRSTIDNMKQTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDRIYRYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           + +     +   ++ VL    ++P  Y  +  D R++  A  F F   G  + + +    
Sbjct: 62  YGLEDMIYAKGMMRKVL----SDPD-YASQLTDRRYQQFAAAFNFSVYGEEATQRESAKT 116

Query: 231 MQIEKIVSNYFNNTI-DCVPIVSDQNYYKLAINSVSS---------FSDFLKDPKLFKML 280
             + K +       + +         Y+   I  ++              L D  L  ++
Sbjct: 117 GTVNKYMQQTLEIKVGEENEGTRLALYFTRTIGEMTKSGVLSEKSWAYQILGDKALSAVV 176

Query: 281 QLSL 284
             +L
Sbjct: 177 FTAL 180



 Score = 79.9 bits (195), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 40/243 (16%), Positives = 87/243 (35%), Gaps = 38/243 (15%)

Query: 342 KKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
           + + Q+ ++ +++     Y   +  I+S+D+ L+                  ++A+ AY 
Sbjct: 17  QTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDR-------------IYRYAMKAYG 63

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
           L      +  +R VL    SDPD YA++  D R  +   AFNF+  G            T
Sbjct: 64  LEDMIYAKGMMRKVL----SDPD-YASQLTDRRYQQFAAAFNFSVYGEEATQRESAKTGT 118

Query: 462 IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL 521
           +   ++     K    +   +      +   +   +  ++ +   Y           ++L
Sbjct: 119 VNKYMQQTLEIKVGEENEGTRLALYFTRTIGEMTKSGVLSEKSWAY-----------QIL 167

Query: 522 ANKRILNFLLESKGI-DSQKVREDFLCEIFKS------DLKDPKSFANTYKDNRYKEIIS 574
            +K +   +  +  I +S +  +    +          DL+DPK         R+  +  
Sbjct: 168 GDKALSAVVFTALNIPESVRSSKIEAQKSLLESRMSLGDLEDPKKLEQFIA--RFSAMYD 225

Query: 575 SFN 577
           + N
Sbjct: 226 AQN 228



 Score = 47.6 bits (111), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 53/132 (40%), Gaps = 12/132 (9%)

Query: 246 DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDP 305
           +   +  + +YY   I  + S  DFL D ++++   +  + L   I A   +  +  +  
Sbjct: 24  NEPQVKRETDYYVSHIIGIRSVDDFLADDRIYRY-AMKAYGLEDMIYAKGMMRKVLSDPD 82

Query: 306 IVSQV------KYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNC---QILHDDKMQSL 356
             SQ+      ++    NF      +T  Q++S     ++ Y +     ++  +++   L
Sbjct: 83  YASQLTDRRYQQFAAAFNFSVYGEEAT--QRESAKTGTVNKYMQQTLEIKVGEENEGTRL 140

Query: 357 IKDYQLPLGKIK 368
              +   +G++ 
Sbjct: 141 ALYFTRTIGEMT 152


>gi|115523169|ref|YP_780080.1| hypothetical protein RPE_1148 [Rhodopseudomonas palustris BisA53]
 gi|115517116|gb|ABJ05100.1| protein of unknown function DUF1217 [Rhodopseudomonas palustris
           BisA53]
          Length = 257

 Score =  217 bits (552), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 58/228 (25%), Positives = 105/228 (46%), Gaps = 6/228 (2%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S   +      ++ +   Q     +++ E  YY  +I+ + S E+ + + R+ ++ +++ 
Sbjct: 3   STVTSYQFITQNLARSLAQTASKPDVSHETTYYLAHIHNVTSVEQFVGDFRLFSYAMKAY 62

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G+      + FL ++    + DP SFAN   D RY+E  ++FNF   GE + +       
Sbjct: 63  GLADMTYAKAFLRKVLTEGVADPSSFANKLVDTRYREFAAAFNFASLGEQATRTTAAT-- 120

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
                 T + Y  Q +E+   E D  + LALYF+R  P ++  Y+IL D  L +V    L
Sbjct: 121 ----SGTVERYVRQSLEQDAGETDQGVQLALYFERKAPTLKTAYQILADKALLQVAQTTL 176

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSI 702
            +SP  ++    ++  +L K I  +DF+   K+  FL    A      
Sbjct: 177 GISPLTSMASIDRQAAMLAKKIDFSDFQHPTKLRAFLQRFSARWETEY 224



 Score =  163 bits (412), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 55/259 (21%), Positives = 120/259 (46%), Gaps = 9/259 (3%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++  +  +  P VS E  YY   I +++++++F+ D RLFSYA+K
Sbjct: 1   MVSTVTSYQFITQNLARSLAQTASKPDVSHETTYYLAHIHNVTSVEQFVGDFRLFSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL+DM++A+ F++K+L   ++DP S  N+L   +Y+ FA +++F+    +  ++    
Sbjct: 61  AYGLADMTYAKAFLRKVLTEGVADPSSFANKLVDTRYREFAAAFNFASLGEQATRTTAAT 120

Query: 120 KTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
              ++ Y +    ++    +  ++ + YF +    + +  Q+  D+ LL     +  I+P
Sbjct: 121 SGTVERYVRQSLEQDAGETDQGVQLALYFERKAPTLKTAYQILADKALLQVAQTTLGISP 180

Query: 176 KYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR--FQPDGSLSKRDKILTDMQI 233
                   +      LA    +       + RA  + F   ++ +   +    IL +  I
Sbjct: 181 LTSMASIDRQ--AAMLAKKIDFSDFQHPTKLRAFLQRFSARWETEYGQTTTPSILINQTI 238

Query: 234 EKIVSNYFNNTIDCVPIVS 252
              VS     ++  + + S
Sbjct: 239 TTAVSASTLASLQNLKLGS 257



 Score =  126 bits (316), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/238 (18%), Positives = 88/238 (36%), Gaps = 22/238 (9%)

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANP 194
                E+ Y+  +IH + SV+Q   D RL  Y ++++ +     +  FL+ VLT G+A+P
Sbjct: 26  PDVSHETTYYLAHIHNVTSVEQFVGDFRLFSYAMKAYGLADMTYAKAFLRKVLTEGVADP 85

Query: 195 KKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNN-TIDCVPIVSD 253
             +  +  D R+R  A  F F   G  + R    T   +E+ V         +    V  
Sbjct: 86  SSFANKLVDTRYREFAAAFNFASLGEQATRTTAATSGTVERYVRQSLEQDAGETDQGVQL 145

Query: 254 QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF--PLNPEITADKFLTLMQENDPIVSQVK 311
             Y++    ++ +    L D  L ++ Q +L   PL    + D+   ++ +         
Sbjct: 146 ALYFERKAPTLKTAYQILADKALLQVAQTTLGISPLTSMASIDRQAAMLAKK-------- 197

Query: 312 YFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKS 369
                         +  Q  ++++  L  +    +  +       I   Q     + +
Sbjct: 198 -----------IDFSDFQHPTKLRAFLQRFSARWETEYGQTTTPSILINQTITTAVSA 244



 Score = 91.9 bits (226), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 43/261 (16%), Positives = 81/261 (31%), Gaps = 38/261 (14%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             +L +   Q      +      Y   +  + S++  +                    +A
Sbjct: 12  TQNLARSLAQTASKPDVSHETTYYLAHIHNVTSVEQFVGD-------------FRLFSYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + AY L      +  LR VLT   +DP S+ANK  D R  +   AFNF + G        
Sbjct: 59  MKAYGLADMTYAKAFLRKVLTEGVADPSSFANKLVDTRYREFAAAFNFASLGEQATRTTA 118

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
            +  T+   V+    +     D   +                       Y+     T+ +
Sbjct: 119 ATSGTVERYVRQSLEQDAGETDQGVQL--------------------ALYFERKAPTLKT 158

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSF 576
             ++LA+K +L     + GI           +     L     F++     + +  +  F
Sbjct: 159 AYQILADKALLQVAQTTLGISPLTSMASIDRQAAM--LAKKIDFSDFQHPTKLRAFLQRF 216

Query: 577 NF---DIHGELSHKKIGKVQD 594
           +      +G+ +   I   Q 
Sbjct: 217 SARWETEYGQTTTPSILINQT 237


>gi|218680748|ref|ZP_03528645.1| hypothetical protein RetlC8_18559 [Rhizobium etli CIAT 894]
          Length = 262

 Score =  215 bits (548), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 88/264 (33%), Positives = 143/264 (54%), Gaps = 2/264 (0%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ ++V+        +   S V+    VS +  YY+E I  ++T+DEF+ D +L+SYA+K
Sbjct: 1   MVSTYVSYLAVARNLNTSLSNVASQATVSRDSAYYKENIDKVTTVDEFMGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ FS   K  QSD+Q  
Sbjct: 61  AYGLDDMTYAKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGETKTAQSDVQRD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            ++  Y+ S   + E   +E+ YF +NI  I SVD      RL +Y L +F ++ +Y S 
Sbjct: 121 NLLDAYETSFDTEAENIADETDYFEENISSITSVDDFLSSSRLKNYALTAFGLSTEYTSS 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLK VLT  L +P  +  +  D+ + ++A+ F F  DGS      ++++ QI  + S Y
Sbjct: 181 SFLKQVLTSDLDDPDSFVNQLGDDVYVSLAKAFNFNEDGSTD--GDVMSEDQISLVTSGY 238

Query: 241 FNNTIDCVPIVSDQNYYKLAINSV 264
              +       + + Y       +
Sbjct: 239 AVASSTIASSDTGEAYDTYFAAQI 262



 Score =  114 bits (285), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 48/250 (19%), Positives = 99/250 (39%), Gaps = 27/250 (10%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           ++    +       ++ +  YY  NI+ + + +E + + ++ ++ +++ G+D     + F
Sbjct: 14  NLNTSLSNVASQATVSRDSAYYKENIDKVTTVDEFMGDYKLYSYAMKAYGLDDMTYAKAF 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++ +SDL D  SFAN+  D+RY E  ++F F              Q +   D+  D Y
Sbjct: 74  MKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGE-------TKTAQSDVQRDNLLDAY 126

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
           +     + E   D       YF+  I +I +  + L  S+L         LS  +     
Sbjct: 127 ETSFDTEAENIADETD----YFEENISSITSVDDFLSSSRLKNYALTAFGLSTEYTSSSF 182

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDD 725
            K++         +D  D             ++    D   +L  + N N+D   +    
Sbjct: 183 LKQVLT-------SDLDDPD---------SFVNQLGDDVYVSLAKAFNFNEDGSTDGDVM 226

Query: 726 PQNNVSLQLS 735
            ++ +SL  S
Sbjct: 227 SEDQISLVTS 236



 Score =  113 bits (281), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 60/269 (22%), Positives = 108/269 (40%), Gaps = 27/269 (10%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           + + ++   +N      +  D  YYK  I+ V++  +F+ D KL+    +  + L+    
Sbjct: 11  VARNLNTSLSNVASQATVSRDSAYYKENIDKVTTVDEFMGDYKLYSY-AMKAYGLDDMTY 69

Query: 293 ADKFLTLMQENDPIVSQVKYF---------FQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           A  F+  + E+D   S              F   F     + T  Q D Q   +LD Y+ 
Sbjct: 70  AKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGETKT-AQSDVQRDNLLDAYET 128

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
           +      + +      ++  +  I S+D+ LS                   +AL A+ L+
Sbjct: 129 SFDT-EAENIADETDYFEENISSITSVDDFLSSSR-------------LKNYALTAFGLS 174

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
            +      L+ VLTS+  DPDS+ N+  DD  + L  AFNFN DGS     M + ++++ 
Sbjct: 175 TEYTSSSFLKQVLTSDLDDPDSFVNQLGDDVYVSLAKAFNFNEDGSTDGDVMSEDQISLV 234

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQIST 492
            +   YA    +I  ++          + 
Sbjct: 235 TSG--YAVASSTIASSDTGEAYDTYFAAQ 261


>gi|114762157|ref|ZP_01441625.1| flagellar protein, putative [Pelagibaca bermudensis HTCC2601]
 gi|114545181|gb|EAU48184.1| flagellar protein, putative [Roseovarius sp. HTCC2601]
          Length = 405

 Score =  215 bits (546), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 68/390 (17%), Positives = 140/390 (35%), Gaps = 49/390 (12%)

Query: 334 IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           +Q  +D  +       +   ++    +   +G I S + L+  +               L
Sbjct: 18  LQNTMDTQRTAFNKTPEITREAA--YFTETIGSIGSAEELVGNRR-------------LL 62

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNF-------NA 446
             AL A+ +  +   +  +R ++     D ++ ANK  D R + L  AF+F         
Sbjct: 63  SVALTAFGMEDELDSKYLVRRLIEEGTKDDEALANKLNDSRFVALADAFDFEPVITRKTQ 122

Query: 447 DGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDY 506
           +       +++    IR N+         + D +  +       + Q   NLEI+    Y
Sbjct: 123 EEGFAETVLVRYEERIRANLAQTLTEPDYVADPDYAAL-----FAAQVEENLEISR--AY 175

Query: 507 YTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKD 566
           +T NI  I S EELL +  +      +  +  +      L    + D  +  + +N   D
Sbjct: 176 FTENIGRITSAEELLLDPELRQVATTAFDLGDRARSTTLLRRALEEDPAEATALSNVLND 235

Query: 567 NRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALY 626
              +    +F F        +    +Q      +  + ++ Q  E    + +  I  AL 
Sbjct: 236 RNLRAFSMAFAF-----YETETSTVLQTEGFASNITEQFRWQRFEDAVSDVNEAIGAALK 290

Query: 627 FKRTIPNI--------RNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK- 677
           F+R++P +           Y +LG + + +V    L L   F+ +   K++ ++    + 
Sbjct: 291 FQRSLPELAANDLSETAKWYNVLGSTMMREVFETALSLPDGFSQIDLDKQVEVISDRARQ 350

Query: 678 ------INDFKDSKKVEDFLYAAKAMDHQS 701
                  +D +D K +   + +    D  S
Sbjct: 351 RFGIETFSDLQDPKTLNGIIQSYLLQDQIS 380



 Score =  160 bits (405), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 68/378 (17%), Positives = 134/378 (35%), Gaps = 54/378 (14%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           + D Q   F+   K P ++ E  Y+ E I  I + +E + ++RL S AL AFG+ D   +
Sbjct: 21  TMDTQRTAFN---KTPEITREAAYFTETIGSIGSAEELVGNRRLLSVALTAFGMEDELDS 77

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTII------- 123
           +  +++++E    D ++L N+LN  ++   A ++DF P       +      +       
Sbjct: 78  KYLVRRLIEEGTKDDEALANKLNDSRFVALADAFDFEPVITRKTQEEGFAETVLVRYEER 137

Query: 124 -----------------QDYKQSHQHKEEVALEESK-YFRKNIHKINSVDQLFKDRRLLD 165
                             DY      + E  LE S+ YF +NI +I S ++L  D  L  
Sbjct: 138 IRANLAQTLTEPDYVADPDYAALFAAQVEENLEISRAYFTENIGRITSAEELLLDPELRQ 197

Query: 166 YVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD 225
               +F +  +  S   L+  L    A          D   RA +  F F          
Sbjct: 198 VATTAFDLGDRARSTTLLRRALEEDPAEATALSNVLNDRNLRAFSMAFAFYE---TETST 254

Query: 226 KILTDMQIEKIVSNYFNNTIDCVPIVSDQNY-----YKLAINSV--------SSFSDFLK 272
            + T+     I   +     +      ++       ++ ++  +        + + + L 
Sbjct: 255 VLQTEGFASNITEQFRWQRFEDAVSDVNEAIGAALKFQRSLPELAANDLSETAKWYNVLG 314

Query: 273 DPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDS 332
              + ++ + +L   +     D    +   +D    + +  F I    D      +Q   
Sbjct: 315 STMMREVFETALSLPDGFSQIDLDKQVEVISD----RARQRFGIETFSD------LQDPK 364

Query: 333 QIQKMLDLYKKNCQILHD 350
            +  ++  Y    QI   
Sbjct: 365 TLNGIIQSYLLQDQISQS 382



 Score =  111 bits (277), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 49/270 (18%), Positives = 106/270 (39%), Gaps = 30/270 (11%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           N+M+   T      EI  E  Y+T  I +I S EEL+ N+R+L+  L + G++ +   + 
Sbjct: 20  NTMDTQRTAFNKTPEITREAAYFTETIGSIGSAEELVGNRRLLSVALTAFGMEDELDSKY 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            +  + +   KD ++ AN   D+R+  +  +F+F+           K Q+    +     
Sbjct: 80  LVRRLIEEGTKDDEALANKLNDSRFVALADAFDFEP------VITRKTQEEGFAETVLVR 133

Query: 605 YKHQ---------------------MIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
           Y+ +                      +   + E++  I+ A YF   I  I +  E+L D
Sbjct: 134 YEERIRANLAQTLTEPDYVADPDYAALFAAQVEENLEISRA-YFTENIGRITSAEELLLD 192

Query: 644 SKLFKVVSKKLKLSPYFAVLPERKKI--RILKKHIKINDFKDSKKVEDFLYAAKAMDHQS 701
            +L +V +    L          ++       +   +++  + + +  F  A    + ++
Sbjct: 193 PELRQVATTAFDLGDRARSTTLLRRALEEDPAEATALSNVLNDRNLRAFSMAFAFYETET 252

Query: 702 IDYKKALFSSPNQNKDPWNNSFDDPQNNVS 731
               +    + N  +      F+D  ++V+
Sbjct: 253 STVLQTEGFASNITEQFRWQRFEDAVSDVN 282



 Score = 97.6 bits (241), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 54/314 (17%), Positives = 117/314 (37%), Gaps = 33/314 (10%)

Query: 117 IQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            Q      D +++  +K      E+ YF + I  I S ++L  +RRLL   L +F +  +
Sbjct: 15  WQILQNTMDTQRTAFNKTPEITREAAYFTETIGSIGSAEELVGNRRLLSVALTAFGMEDE 74

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQI--- 233
             S   ++ ++  G  + +    +  D+RF A+A+ F F+P  +   +++   +  +   
Sbjct: 75  LDSKYLVRRLIEEGTKDDEALANKLNDSRFVALADAFDFEPVITRKTQEEGFAETVLVRY 134

Query: 234 EKIVSNYFNNTIDCVPIVSD------------------QNYYKLAINSVSSFSDFLKDPK 275
           E+ +      T+     V+D                  + Y+   I  ++S  + L DP+
Sbjct: 135 EERIRANLAQTLTEPDYVADPDYAALFAAQVEENLEISRAYFTENIGRITSAEELLLDPE 194

Query: 276 LFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKY---------FFQINFHR-DNSSS 325
           L ++   + F L     +   L    E DP  +              F + F   +  +S
Sbjct: 195 LRQVATTA-FDLGDRARSTTLLRRALEEDPAEATALSNVLNDRNLRAFSMAFAFYETETS 253

Query: 326 TKIQQDSQIQKMLDLYK-KNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPN 384
           T +Q +     + + ++ +  +    D  +++    +      +   N LS   +     
Sbjct: 254 TVLQTEGFASNITEQFRWQRFEDAVSDVNEAIGAALKFQRSLPELAANDLSETAKWYNVL 313

Query: 385 SAEEPIITLQFALD 398
            +       + AL 
Sbjct: 314 GSTMMREVFETALS 327


>gi|319406970|emb|CBI80607.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 266

 Score =  212 bits (538), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 62/252 (24%), Positives = 110/252 (43%), Gaps = 22/252 (8%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S + +   + ++M+Q   +     ++  E DYY  +I  + S +E LAN +I N+ +++ 
Sbjct: 3   STYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDEFLANDKIYNYAMKAY 62

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G++     +  + ++      DP+ +A+   D RY++   +FNF  +GE +       Q 
Sbjct: 63  GLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKAT------QR 111

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNH-YEILGDSK 645
                 T + Y  Q +E +  E +    LALYF RTI  +        +N  Y+IL D  
Sbjct: 112 ESAKTVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKA 171

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSID-- 703
           L  V+ K   +S      P   +  +L+  + + D +D KK+E  +    AM        
Sbjct: 172 LSAVIFKAFNISENVLTSPIEVQKSLLESRMSLKDLQDPKKLEHLIAKFSAMYDVQNQTV 231

Query: 704 YKKALFSSPNQN 715
              AL      N
Sbjct: 232 VNPALMILQGSN 243



 Score =  168 bits (426), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 62/230 (26%), Positives = 108/230 (46%), Gaps = 28/230 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + + P V  E  YY + I  + ++DEF+ + ++++YA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDEFLANDKIYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM  A+  I+K+L    SDP+   +QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAK 115

Query: 120 KTIIQDYKQSHQHKEEVALEE----SKYFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y Q     E   + E    + YF + I  +         N   Q+  D+ L   
Sbjct: 116 TVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLP--FLKDVLTL-----GLANPKKYFIESRDNRFRAM 209
           + ++F+I+   ++ P    K +L        L +PKK   E    +F AM
Sbjct: 176 IFKAFNISENVLTSPIEVQKSLLESRMSLKDLQDPKKL--EHLIAKFSAM 223



 Score = 91.9 bits (226), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 76/197 (38%), Gaps = 25/197 (12%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   +++ I + KQ+     ++     E+ Y+ K+I  + SVD+   + ++ +Y +++
Sbjct: 2   ISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDEFLANDKIYNYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           + +     +   ++ VL    ++P+ Y  +  D R++  AE F F   G          +
Sbjct: 62  YGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGE----KATQRE 112

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSS---------FSDFLKDPKL 276
                 V+ Y   T++      ++      Y+   I  +               L D  L
Sbjct: 113 SAKTVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKAL 172

Query: 277 FKMLQLSLFPLNPEITA 293
             ++  +       +T+
Sbjct: 173 SAVIFKAFNISENVLTS 189



 Score = 80.3 bits (196), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 74/212 (34%), Gaps = 38/212 (17%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              Y   +  +KS+D  L+                   +A+ AY L      +  +R VL
Sbjct: 32  TDYYVKHIIGVKSVDEFLANDK-------------IYNYAMKAYGLEDMIFAKGMIRKVL 78

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN-RKRS 475
               SDP+ YA++  D R  +   AFNF+  G           +T+   ++         
Sbjct: 79  ----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAKTVTVNKYMQQTLEVEVGE 133

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
           +++    +      I    + N+       Y            ++L++K +   + ++  
Sbjct: 134 VNEGTRLALYFTRTIGGMVQNNVLTEKNWAY------------QILSDKALSAVIFKAFN 181

Query: 536 I------DSQKVREDFLC-EIFKSDLKDPKSF 560
           I         +V++  L   +   DL+DPK  
Sbjct: 182 ISENVLTSPIEVQKSLLESRMSLKDLQDPKKL 213


>gi|319403954|emb|CBI77542.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 266

 Score =  211 bits (537), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 61/252 (24%), Positives = 110/252 (43%), Gaps = 22/252 (8%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S + +   + ++M+Q   +     ++  E DYY  +I  + S ++ LAN +I N+ +++ 
Sbjct: 3   STYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKIYNYAMKAY 62

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G++     +  + ++      DP+ +A+   D RY++   +FNF  +GE +       Q 
Sbjct: 63  GLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKAT------QR 111

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNH-YEILGDSK 645
                 T + Y  Q +E +  E +    LALYF RTI  +        +N  Y+IL D  
Sbjct: 112 ESAKTVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKA 171

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSID-- 703
           L  V+ K   +S      P   +  +L+  + + D +D KK+E  +    AM        
Sbjct: 172 LSAVIFKAFNISENVLTSPIEVQKSLLESRMSLKDLQDPKKLEHLIAKFSAMYDVQNQTV 231

Query: 704 YKKALFSSPNQN 715
              AL      N
Sbjct: 232 VNPALMILQGSN 243



 Score =  168 bits (426), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 61/230 (26%), Positives = 108/230 (46%), Gaps = 28/230 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + + P V  E  YY + I  + ++D+F+ + ++++YA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKIYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM  A+  I+K+L    SDP+   +QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAK 115

Query: 120 KTIIQDYKQSHQHKEEVALEE----SKYFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y Q     E   + E    + YF + I  +         N   Q+  D+ L   
Sbjct: 116 TVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLP--FLKDVLTL-----GLANPKKYFIESRDNRFRAM 209
           + ++F+I+   ++ P    K +L        L +PKK   E    +F AM
Sbjct: 176 IFKAFNISENVLTSPIEVQKSLLESRMSLKDLQDPKKL--EHLIAKFSAM 223



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 75/197 (38%), Gaps = 25/197 (12%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   +++ I + KQ+     ++     E+ Y+ K+I  + SVD    + ++ +Y +++
Sbjct: 2   ISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKIYNYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           + +     +   ++ VL    ++P+ Y  +  D R++  AE F F   G          +
Sbjct: 62  YGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGE----KATQRE 112

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSS---------FSDFLKDPKL 276
                 V+ Y   T++      ++      Y+   I  +               L D  L
Sbjct: 113 SAKTVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKAL 172

Query: 277 FKMLQLSLFPLNPEITA 293
             ++  +       +T+
Sbjct: 173 SAVIFKAFNISENVLTS 189



 Score = 82.2 bits (201), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 38/212 (17%), Positives = 75/212 (35%), Gaps = 38/212 (17%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              Y   +  +KS+D+ L+                   +A+ AY L      +  +R VL
Sbjct: 32  TDYYVKHIIGVKSVDDFLANDK-------------IYNYAMKAYGLEDMIFAKGMIRKVL 78

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN-RKRS 475
               SDP+ YA++  D R  +   AFNF+  G           +T+   ++         
Sbjct: 79  ----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAKTVTVNKYMQQTLEVEVGE 133

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
           +++    +      I    + N+       Y            ++L++K +   + ++  
Sbjct: 134 VNEGTRLALYFTRTIGGMVQNNVLTEKNWAY------------QILSDKALSAVIFKAFN 181

Query: 536 I------DSQKVREDFLC-EIFKSDLKDPKSF 560
           I         +V++  L   +   DL+DPK  
Sbjct: 182 ISENVLTSPIEVQKSLLESRMSLKDLQDPKKL 213


>gi|114706759|ref|ZP_01439659.1| hypothetical protein FP2506_18124 [Fulvimarina pelagi HTCC2506]
 gi|114537707|gb|EAU40831.1| hypothetical protein FP2506_18124 [Fulvimarina pelagi HTCC2506]
          Length = 260

 Score =  211 bits (537), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 51/245 (20%), Positives = 98/245 (40%), Gaps = 10/245 (4%)

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
              +       +     +   +  +      Y   I  I S +E LAN R+  + +++ G
Sbjct: 4   ASLSYRLISRDLPASLERTAQDPTVERASQRYLEEIGKISSIDEFLANDRVYRYAMKAMG 63

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           ++     + F+ ++ +  + D ++FAN   D+RYK+   +FNF+ +GE +       Q  
Sbjct: 64  LEDMTYAKAFMRKVMEEGIDDREAFANKLTDSRYKDFAETFNFNRYGEAALAFERTQQ-- 121

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
                  D Y  Q +E+    +     LALYF+R    + ++Y +L D  + KV+     
Sbjct: 122 ----GIVDKYVRQTLEENTGTESEGARLALYFERKASTVTSYYGLLADPAILKVMQTAFS 177

Query: 656 LSPYFAVLPERKKIRILKKHI-KINDFKDSKKVEDFLYAAKAM---DHQSIDYKKALFSS 711
           +      L   K+  + +K +  I D KD +KV + L     +   ++        L   
Sbjct: 178 IPAETGTLDIDKQADLFRKALPNIEDLKDPQKVSELLQRFTTLWDVNNVQAAPTSPLLQL 237

Query: 712 PNQNK 716
                
Sbjct: 238 FGNGS 242



 Score =  165 bits (417), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 50/192 (26%), Positives = 98/192 (51%), Gaps = 7/192 (3%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ + ++    S+D+ + L    ++DP V    + Y E I  IS+IDEF+ + R++ YA+
Sbjct: 1   MLDASLSYRLISRDLPASL-ERTAQDPTVERASQRYLEEIGKISSIDEFLANDRVYRYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQ 118
           KA GL DM++A+ F++K++E  + D ++  N+L   +Y+ FA +++F+   +   + +  
Sbjct: 60  KAMGLEDMTYAKAFMRKVMEEGIDDREAFANKLTDSRYKDFAETFNFNRYGEAALAFERT 119

Query: 119 HKTIIQDYKQSHQHK----EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
            + I+  Y +    +    E      + YF +    + S   L  D  +L  +  +FSI 
Sbjct: 120 QQGIVDKYVRQTLEENTGTESEGARLALYFERKASTVTSYYGLLADPAILKVMQTAFSIP 179

Query: 175 PKYISLPFLKDV 186
            +  +L   K  
Sbjct: 180 AETGTLDIDKQA 191



 Score =  113 bits (281), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/187 (18%), Positives = 79/187 (42%), Gaps = 7/187 (3%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               ++      S+ + + I KI+S+D+   + R+  Y +++  +     +  F++ V+ 
Sbjct: 20  ERTAQDPTVERASQRYLEEIGKISSIDEFLANDRVYRYAMKAMGLEDMTYAKAFMRKVME 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF-NNTIDC 247
            G+ + + +  +  D+R++  AE F F   G  +   +      ++K V      NT   
Sbjct: 80  EGIDDREAFANKLTDSRYKDFAETFNFNRYGEAALAFERTQQGIVDKYVRQTLEENTGTE 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL------FPLNPEITADKFLTLMQ 301
                   Y++   ++V+S+   L DP + K++Q +         L+ +  AD F   + 
Sbjct: 140 SEGARLALYFERKASTVTSYYGLLADPAILKVMQTAFSIPAETGTLDIDKQADLFRKALP 199

Query: 302 ENDPIVS 308
             + +  
Sbjct: 200 NIEDLKD 206



 Score = 94.2 bits (232), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 69/219 (31%), Gaps = 41/219 (18%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
              D  ++   + Y   +GKI SID  L+                  ++A+ A  L    
Sbjct: 22  TAQDPTVERASQRYLEEIGKISSIDEFLANDR-------------VYRYAMKAMGLEDMT 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R V+     D +++ANK  D R       FNFN  G          +  +   V
Sbjct: 69  YAKAFMRKVMEEGIDDREAFANKLTDSRYKDFAETFNFNRYGEAALAFERTQQGIVDKYV 128

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
           +                               E      Y+    +T+ S+  LLA+  I
Sbjct: 129 RQTLEENTGT--------------------ESEGARLALYFERKASTVTSYYGLLADPAI 168

Query: 527 LNFLLESKGIDSQKVR------EDFLCEIF--KSDLKDP 557
           L  +  +  I ++          D   +      DLKDP
Sbjct: 169 LKVMQTAFSIPAETGTLDIDKQADLFRKALPNIEDLKDP 207


>gi|319898630|ref|YP_004158723.1| hypothetical protein BARCL_0458 [Bartonella clarridgeiae 73]
 gi|319402594|emb|CBI76139.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 266

 Score =  210 bits (533), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 58/254 (22%), Positives = 113/254 (44%), Gaps = 24/254 (9%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S + +   + ++M+Q   +     ++  E DYY  +I  + S ++ LAN ++ ++ +++ 
Sbjct: 3   STYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKVYSYAMKAY 62

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G++     +  + ++      DP+ +A+   D RY++   +FNF  +GE +       Q 
Sbjct: 63  GLEDMIFAKGMIRKVL----SDPQ-YASQLVDKRYQQFAEAFNFSKYGEKAT------QR 111

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNH-YEILGDSK 645
                 T + Y  Q +E +  + +    LALYF RT+  +        +N  Y+IL D  
Sbjct: 112 ESAKTVTVNKYMQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILKEKNWAYQILSDKA 171

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM----DHQS 701
           L  VV K   +S      P   +  +L+  + + D +D KK+E  +    AM    +   
Sbjct: 172 LSAVVFKAFNISENVLTSPIESQKSLLESRMSLKDLQDPKKLEHLIAKFSAMYDVQNQTM 231

Query: 702 IDYKKALFSSPNQN 715
           I+    +   PN  
Sbjct: 232 INPALMILQGPNMG 245



 Score =  167 bits (423), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 61/230 (26%), Positives = 109/230 (47%), Gaps = 28/230 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + + P V  E  YY + I  + ++D+F+ + +++SYA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKVYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM  A+  I+K+L    SDP+   +QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKVL----SDPQ-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAK 115

Query: 120 KTIIQDYKQSHQHKEEVALEE----SKYFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y Q     E   + E    + YF + +  +         N   Q+  D+ L   
Sbjct: 116 TVTVNKYMQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILKEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYIS------LPFLKDVLTL-GLANPKKYFIESRDNRFRAM 209
           V ++F+I+   ++         L+  ++L  L +PKK   E    +F AM
Sbjct: 176 VFKAFNISENVLTSPIESQKSLLESRMSLKDLQDPKKL--EHLIAKFSAM 223



 Score = 90.7 bits (223), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 31/197 (15%), Positives = 74/197 (37%), Gaps = 25/197 (12%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   +++ I + KQ+     ++     E+ Y+ K+I  + SVD    + ++  Y +++
Sbjct: 2   ISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKVYSYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           + +     +   ++ VL    ++P+ Y  +  D R++  AE F F   G          +
Sbjct: 62  YGLEDMIFAKGMIRKVL----SDPQ-YASQLVDKRYQQFAEAFNFSKYGE----KATQRE 112

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSS---------FSDFLKDPKL 276
                 V+ Y   T++      ++      Y+   +  +               L D  L
Sbjct: 113 SAKTVTVNKYMQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILKEKNWAYQILSDKAL 172

Query: 277 FKMLQLSLFPLNPEITA 293
             ++  +       +T+
Sbjct: 173 SAVVFKAFNISENVLTS 189



 Score = 80.3 bits (196), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 73/212 (34%), Gaps = 38/212 (17%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              Y   +  +KS+D+ L+                   +A+ AY L      +  +R VL
Sbjct: 32  TDYYVKHIIGVKSVDDFLANDK-------------VYSYAMKAYGLEDMIFAKGMIRKVL 78

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN-RKRS 475
               SDP  YA++  D R  +   AFNF+  G           +T+   ++         
Sbjct: 79  ----SDPQ-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAKTVTVNKYMQQTLEVEAGQ 133

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
           +++    +      +    + N+       Y            ++L++K +   + ++  
Sbjct: 134 VNEGTRLALYFTRTVGGMVKDNILKEKNWAY------------QILSDKALSAVVFKAFN 181

Query: 536 I------DSQKVREDFLC-EIFKSDLKDPKSF 560
           I         + ++  L   +   DL+DPK  
Sbjct: 182 ISENVLTSPIESQKSLLESRMSLKDLQDPKKL 213


>gi|158424043|ref|YP_001525335.1| hypothetical protein AZC_2419 [Azorhizobium caulinodans ORS 571]
 gi|158330932|dbj|BAF88417.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 325

 Score =  207 bits (527), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 55/254 (21%), Positives = 101/254 (39%), Gaps = 18/254 (7%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S +   +    + ++   Q+        E   +  +I +I S ++ + N R+  + +++ 
Sbjct: 74  STYLTYSYLSKNYDKALEQEATTGSTKLETANFEKSIGSITSVDDFVNNYRVFTYAMKAY 133

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G++     + ++ ++ +SDL D  SFAN+  D R+K    +F    +GE           
Sbjct: 134 GLEDMAYAKAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQSLTYGEAVSSDT----- 188

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
              +      Y  Q +E      D  + LALYFKR    + + Y IL D  L+KVV    
Sbjct: 189 ---VSTVETKYAQQTMEDNAGASDTGVQLALYFKRNASTVTSAYSILADEALYKVVKATY 245

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQ 714
            +    +      +  ++ KHI I + +D   V+  L           D +       N 
Sbjct: 246 NIPDEMSNAGIEAQAALISKHIDIEELQDPDYVDKLLKQFS----IKYDIEN------NS 295

Query: 715 NKDPWNNSFDDPQN 728
             DP    F+D  +
Sbjct: 296 ASDPVLQLFNDTSS 309



 Score =  159 bits (402), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 41/180 (22%), Positives = 88/180 (48%), Gaps = 3/180 (1%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
            +++          K     +       E   + + I  I+++D+F+ + R+F+YA+KA+
Sbjct: 74  STYLTYSYLSKNYDKALEQEATTGSTKLETANFEKSIGSITSVDDFVNNYRVFTYAMKAY 133

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD---IQH 119
           GL DM++A+ ++KK+LESDL+D  S  N L+  +++ FA+++      + + SD      
Sbjct: 134 GLEDMAYAKAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQSLTYGEAVSSDTVSTVE 193

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
               Q   + +    +  ++ + YF++N   + S   +  D  L   V  +++I  +  +
Sbjct: 194 TKYAQQTMEDNAGASDTGVQLALYFKRNASTVTSAYSILADEALYKVVKATYNIPDEMSN 253



 Score =  114 bits (286), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/263 (15%), Positives = 104/263 (39%), Gaps = 31/263 (11%)

Query: 114 QSDIQHKTIIQDYKQSHQHKEEVALE--ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSF 171
            + + +  + ++Y ++ + +        E+  F K+I  I SVD    + R+  Y ++++
Sbjct: 74  STYLTYSYLSKNYDKALEQEATTGSTKLETANFEKSIGSITSVDDFVNNYRVFTYAMKAY 133

Query: 172 SITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
            +     +  ++K VL   L +   +     D RF+A A+ F+    G      + ++  
Sbjct: 134 GLEDMAYAKAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQSLTYG------EAVSSD 187

Query: 232 QIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFP 286
            +  + + Y   T++     SD       Y+K   ++V+S    L D  L+K+++ + + 
Sbjct: 188 TVSTVETKYAQQTMEDNAGASDTGVQLALYFKRNASTVTSAYSILADEALYKVVKAT-YN 246

Query: 287 LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQ 346
           +  E++           +   + +     I          ++Q    + K+L  +     
Sbjct: 247 IPDEMSNAGI-------EAQAALISKHIDI---------EELQDPDYVDKLLKQFSIKYD 290

Query: 347 ILHDDKMQSLIKDYQLPLGKIKS 369
           I ++     +++ +      + S
Sbjct: 291 IENNSASDPVLQLF-NDTSSVSS 312



 Score =  102 bits (254), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 47/290 (16%), Positives = 94/290 (32%), Gaps = 49/290 (16%)

Query: 325 STKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPN 384
            +     S + K  D   +        K+++   +++  +G I S+D+ ++         
Sbjct: 73  GSTYLTYSYLSKNYDKALEQEATTGSTKLETA--NFEKSIGSITSVDDFVNN-------- 122

Query: 385 SAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNF 444
                     +A+ AY L      +  ++ VL S+ +D  S+AN   D R      AF  
Sbjct: 123 -----YRVFTYAMKAYGLEDMAYAKAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQS 177

Query: 445 NADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEV 504
              G         S  T+      YA +             +ME  +      +++    
Sbjct: 178 LTYGE------AVSSDTVSTVETKYAQQ-------------TMEDNAGASDTGVQLA--- 215

Query: 505 DYYTLNINTIHSFEELLANKRILNFLLESKGI-DSQKVREDFLCEIFKS------DLKDP 557
            Y+  N +T+ S   +LA++ +   +  +  I D              S      +L+DP
Sbjct: 216 LYFKRNASTVTSAYSILADEALYKVVKATYNIPDEMSNAGIEAQAALISKHIDIEELQDP 275

Query: 558 KSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKH 607
                 Y D   K+    ++ + +             +    DT     +
Sbjct: 276 D-----YVDKLLKQFSIKYDIENNSASDPVLQLFNDTSSVSSDTAGAILN 320



 Score = 52.2 bits (123), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/264 (10%), Positives = 80/264 (30%), Gaps = 38/264 (14%)

Query: 220 SLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKM 279
           ++      LT   + K                 +   ++ +I S++S  DF+ + ++F  
Sbjct: 69  TIDLGSTYLTYSYLSKNYDKALEQEATTGSTKLETANFEKSIGSITSVDDFVNNYRVFTY 128

Query: 280 LQLSLFPLNPEITADKFLTLMQENDPIVSQV-------KYFFQINFHRDNSSSTKIQQDS 332
             +  + L     A  ++  + E+D               F        + +  +     
Sbjct: 129 -AMKAYGLEDMAYAKAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQSLTYGEAVSSD 187

Query: 333 QIQKMLDLYKKNC---QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEP 389
            +  +   Y +          D    L   ++     + S  ++L+ +            
Sbjct: 188 TVSTVETKYAQQTMEDNAGASDTGVQLALYFKRNASTVTSAYSILADEA----------- 236

Query: 390 IITLQFALDAYNLNMQDLDRDQL--------RNVLTSNPSDPDSYANKSKDDRLIKLNHA 441
               +     YN+   ++    +        +++      DPD Y +K     L + +  
Sbjct: 237 --LYKVVKATYNI-PDEMSNAGIEAQAALISKHIDIEELQDPD-YVDKL----LKQFSIK 288

Query: 442 FNFNADGSIGPIPMMQSRLTIRDN 465
           ++   + +  P+  + +  +   +
Sbjct: 289 YDIENNSASDPVLQLFNDTSSVSS 312


>gi|288962700|ref|YP_003452994.1| flagellar basal-body rod protein [Azospirillum sp. B510]
 gi|288914966|dbj|BAI76450.1| flagellar basal-body rod protein [Azospirillum sp. B510]
          Length = 263

 Score =  207 bits (527), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 56/215 (26%), Positives = 101/215 (46%), Gaps = 6/215 (2%)

Query: 483 SFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVR 542
           +  + ++     R    +   + Y+  NI  I S E+ + + ++  F+L++  + SQ   
Sbjct: 10  ANKNHDRYDQAVRSRPAVQRAISYFQDNIGKITSTEDFMKDDKLYRFVLDAFDLGSQARS 69

Query: 543 EDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTC 602
              + ++ +  + D  S AN   D++++E+ +   F  +   + KK   VQ         
Sbjct: 70  RGLIRKVLEEGVGDKSSTANRMSDSKFREMATILGFAENQGDNLKKPAVVQ------AII 123

Query: 603 DLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAV 662
           D Y    +E + E+++P + L LYF+R   NI N Y+++ D+ L KVV   L L    A+
Sbjct: 124 DRYVAVTLEVESEDRNPAVRLGLYFQRRSANISNWYQVMADNALRKVVYTALGLPEQTAL 183

Query: 663 LPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           L   K+  +L+K + I D K   KV   L    AM
Sbjct: 184 LDVDKQKALLEKRMDIADLKKPDKVAKLLDRFAAM 218



 Score =  142 bits (357), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 45/225 (20%), Positives = 88/225 (39%), Gaps = 14/225 (6%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + + V    +     +    V   P V     Y+++ I  I++ ++F+KD +L+ + L A
Sbjct: 1   MTTLVDLRVANKNHDRYDQAVRSRPAVQRAISYFQDNIGKITSTEDFMKDDKLYRFVLDA 60

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS-PPPKVIQSDIQHK 120
           F L   + +   I+K+LE  + D  S  N+++  K++  A    F+      ++     +
Sbjct: 61  FDLGSQARSRGLIRKVLEEGVGDKSSTANRMSDSKFREMATILGFAENQGDNLKKPAVVQ 120

Query: 121 TIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            II  Y       E      A+    YF++    I++  Q+  D  L   V  +  +  +
Sbjct: 121 AIIDRYVAVTLEVESEDRNPAVRLGLYFQRRSANISNWYQVMADNALRKVVYTALGLPEQ 180

Query: 177 YI------SLPFLKDVLTL-GLANPKKYFIESRDNRFRAMAENFR 214
                       L+  + +  L  P K       +RF AM +   
Sbjct: 181 TALLDVDKQKALLEKRMDIADLKKPDKVAKLL--DRFAAMYDMRN 223



 Score =  102 bits (253), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/163 (21%), Positives = 66/163 (40%), Gaps = 1/163 (0%)

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
           D                 YF+ NI KI S +   KD +L  +VL +F +  +  S   ++
Sbjct: 15  DRYDQAVRSRPAVQRAISYFQDNIGKITSTEDFMKDDKLYRFVLDAFDLGSQARSRGLIR 74

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-N 243
            VL  G+ +         D++FR MA    F  +   + +   +    I++ V+      
Sbjct: 75  KVLEEGVGDKSSTANRMSDSKFREMATILGFAENQGDNLKKPAVVQAIIDRYVAVTLEVE 134

Query: 244 TIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFP 286
           + D  P V    Y++    ++S++   + D  L K++  +L  
Sbjct: 135 SEDRNPAVRLGLYFQRRSANISNWYQVMADNALRKVVYTALGL 177



 Score = 78.8 bits (192), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 42/264 (15%), Positives = 80/264 (30%), Gaps = 42/264 (15%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
             +     +Q  I  +Q  +GKI S ++ +                   +F LDA++L  
Sbjct: 19  QAVRSRPAVQRAISYFQDNIGKITSTEDFMKDDK-------------LYRFVLDAFDLGS 65

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
           Q   R  +R VL     D  S AN+  D +  ++     F  +           +  I  
Sbjct: 66  QARSRGLIRKVLEEGVGDKSSTANRMSDSKFREMATILGFAENQGDNLKKPAVVQAIIDR 125

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V      +    +                           Y+      I ++ +++A+ 
Sbjct: 126 YVAVTLEVESEDRNPA--------------------VRLGLYFQRRSANISNWYQVMADN 165

Query: 525 RILNFLLESKGIDSQKV------REDFLCEIFK-SDLKDPKSFANTYKDNRYKEIISSFN 577
            +   +  + G+  Q        ++  L +    +DLK P   A     +R+  +    N
Sbjct: 166 ALRKVVYTALGLPEQTALLDVDKQKALLEKRMDIADLKKPDKVAKLL--DRFAAMYDMRN 223

Query: 578 FDIHGELSHKKIGKVQDNFHIDDT 601
            D     +   IG V         
Sbjct: 224 GDAAAAAAIPSIGPVSRRGRASII 247


>gi|319405395|emb|CBI79014.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 266

 Score =  206 bits (523), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 60/272 (22%), Positives = 114/272 (41%), Gaps = 20/272 (7%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S + +   + ++M+Q   +     ++  E DYY  +I  + S ++ LAN +I N+ +++ 
Sbjct: 3   STYTSYRSTIDNMKQTFDRLFKKPQVKHETDYYVKHIIGVKSVDDFLANDKIYNYAMKAY 62

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G++     +  + ++      DP+ +A    D RY++   +FNF  +GE +       Q 
Sbjct: 63  GLEDMIFAKGMIRKVL----SDPQ-YAAQLVDKRYQQFAEAFNFSKYGEKTT------QR 111

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNH-YEILGDSK 645
                 T + Y  Q +E +  + +    LALYF RT+  +        +N  Y+IL D  
Sbjct: 112 ESAKTITVNKYIQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILTEKNWAYQILSDKA 171

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYK 705
           L  V+ K   +S      P   +  +L+  + + D +D KK+E  +    AM        
Sbjct: 172 LSAVIFKAFNISENVLTSPIEAQKSLLESRMSLKDLQDPKKLEHLIAKFSAMYDVQNQTV 231

Query: 706 KALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQ 737
                   Q  +         +  ++LQ   Q
Sbjct: 232 VNPALMILQGSNVGRGLTFSNETIMALQFFKQ 263



 Score =  162 bits (410), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 60/230 (26%), Positives = 108/230 (46%), Gaps = 28/230 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + K P V  E  YY + I  + ++D+F+ + ++++YA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFKKPQVKHETDYYVKHIIGVKSVDDFLANDKIYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A+GL DM  A+  I+K+L    SDP+    QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKVL----SDPQ-YAAQLVDKRYQQFAEAFNFSKYGEKTTQRESAK 115

Query: 120 KTIIQDYKQSHQHKEEVALEE----SKYFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y Q     E   + E    + YF + +  +         N   Q+  D+ L   
Sbjct: 116 TITVNKYIQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILTEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYIS------LPFLKDVLTL-GLANPKKYFIESRDNRFRAM 209
           + ++F+I+   ++         L+  ++L  L +PKK   E    +F AM
Sbjct: 176 IFKAFNISENVLTSPIEAQKSLLESRMSLKDLQDPKKL--EHLIAKFSAM 223



 Score = 91.1 bits (224), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 32/197 (16%), Positives = 76/197 (38%), Gaps = 25/197 (12%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   +++ I + KQ+     K+     E+ Y+ K+I  + SVD    + ++ +Y +++
Sbjct: 2   ISTYTSYRSTIDNMKQTFDRLFKKPQVKHETDYYVKHIIGVKSVDDFLANDKIYNYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           + +     +   ++ VL    ++P+ Y  +  D R++  AE F F   G  +       +
Sbjct: 62  YGLEDMIFAKGMIRKVL----SDPQ-YAAQLVDKRYQQFAEAFNFSKYGEKTT----QRE 112

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSS---------FSDFLKDPKL 276
                 V+ Y   T++      ++      Y+   +  +               L D  L
Sbjct: 113 SAKTITVNKYIQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILTEKNWAYQILSDKAL 172

Query: 277 FKMLQLSLFPLNPEITA 293
             ++  +       +T+
Sbjct: 173 SAVIFKAFNISENVLTS 189



 Score = 81.8 bits (200), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 36/212 (16%), Positives = 72/212 (33%), Gaps = 38/212 (17%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              Y   +  +KS+D+ L+                   +A+ AY L      +  +R VL
Sbjct: 32  TDYYVKHIIGVKSVDDFLANDK-------------IYNYAMKAYGLEDMIFAKGMIRKVL 78

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN-RKRS 475
               SDP  YA +  D R  +   AFNF+  G           +T+   ++         
Sbjct: 79  ----SDPQ-YAAQLVDKRYQQFAEAFNFSKYGEKTTQRESAKTITVNKYIQQTLEVEAGQ 133

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
           +++    +      +    + N+       Y            ++L++K +   + ++  
Sbjct: 134 VNEGTRLALYFTRTVGGMVKDNILTEKNWAY------------QILSDKALSAVIFKAFN 181

Query: 536 IDSQKVRE--DFLCEIFKS-----DLKDPKSF 560
           I    +    +    + +S     DL+DPK  
Sbjct: 182 ISENVLTSPIEAQKSLLESRMSLKDLQDPKKL 213


>gi|182679721|ref|YP_001833867.1| hypothetical protein Bind_2809 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635604|gb|ACB96378.1| protein of unknown function DUF1217 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 259

 Score =  203 bits (517), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 55/255 (21%), Positives = 100/255 (39%), Gaps = 13/255 (5%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           +     N +     +          ++ E  YY  NI+ + + +  L N R+  + +++ 
Sbjct: 3   TTALYYNMTVRDYTKTLATTASEPSVSRESKYYLDNISKVTTIDGFLNNNRLFTYAMKAF 62

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G+      +  + +I +    DP++ ANT  D+RYK +  +F+F   G  +       Q+
Sbjct: 63  GLGDMVYAKGMVRQILQQGTSDPRALANTLNDSRYKALAQTFDFANLGANATSTTTAGQN 122

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
                   D Y    +E    +  P   +ALY KR  P I + Y IL D  L ++V    
Sbjct: 123 ------VVDKYVEMQLEDNVGKNSPGAEMALYLKRVAPTITSAYSILADKTLLQIVQTTF 176

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-------DHQSIDYKKA 707
            L    + L    + +++   +KI+D +D  K++ F     AM          S      
Sbjct: 177 NLPSSMSALDIDVQAKMINSKMKISDLQDPTKLQTFTNRFIAMYDINNPNTGPSTPTNAL 236

Query: 708 LFSSPNQNKDPWNNS 722
           L  S   + D   + 
Sbjct: 237 LAQSSGLSSDLLMSL 251



 Score =  160 bits (405), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 111/237 (46%), Gaps = 14/237 (5%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ + +    +    +K  +T + +P VS E +YY + I  ++TID F+ + RLF+YA+K
Sbjct: 1   MLTTALYYNMTVRDYTKTLATTASEPSVSRESKYYLDNISKVTTIDGFLNNNRLFTYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           AFGL DM +A+  +++IL+   SDP++L N LN  +Y+  A+++DF+        +    
Sbjct: 61  AFGLGDMVYAKGMVRQILQQGTSDPRALANTLNDSRYKALAQTFDFANLGANATSTTTAG 120

Query: 120 KTIIQDYK----QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + ++  Y     + +  K     E + Y ++    I S   +  D+ LL  V  +F++  
Sbjct: 121 QNVVDKYVEMQLEDNVGKNSPGAEMALYLKRVAPTITSAYSILADKTLLQIVQTTFNLPS 180

Query: 176 KYISLP-------FLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD 225
              +L            +    L +P K   ++  NRF AM +        S     
Sbjct: 181 SMSALDIDVQAKMINSKMKISDLQDPTKL--QTFTNRFIAMYDINNPNTGPSTPTNA 235



 Score =  110 bits (275), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 44/257 (17%), Positives = 95/257 (36%), Gaps = 16/257 (6%)

Query: 113 IQSDIQHKTIIQDYKQS--HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           + + + +   ++DY ++      E     ESKY+  NI K+ ++D    + RL  Y +++
Sbjct: 2   LTTALYYNMTVRDYTKTLATTASEPSVSRESKYYLDNISKVTTIDGFLNNNRLFTYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           F +     +   ++ +L  G ++P+       D+R++A+A+ F F   G+ +        
Sbjct: 62  FGLGDMVYAKGMVRQILQQGTSDPRALANTLNDSRYKALAQTFDFANLGANATSTTTAGQ 121

Query: 231 MQIEKIVSNYFNNTI-DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP 289
             ++K V     + +    P      Y K    +++S    L D  L +++Q +    + 
Sbjct: 122 NVVDKYVEMQLEDNVGKNSPGAEMALYLKRVAPTITSAYSILADKTLLQIVQTTFNLPSS 181

Query: 290 EITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILH 349
               D  +     N  +              D    TK+Q      + + +Y  N     
Sbjct: 182 MSALDIDVQAKMINSKMKI-----------SDLQDPTKLQTF--TNRFIAMYDINNPNTG 228

Query: 350 DDKMQSLIKDYQLPLGK 366
                + +      L  
Sbjct: 229 PSTPTNALLAQSSGLSS 245



 Score = 78.8 bits (192), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 45/277 (16%), Positives = 82/277 (29%), Gaps = 44/277 (15%)

Query: 336 KMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQF 395
            + D  K       +  +    K Y   + K+ +ID  L+                   +
Sbjct: 11  TVRDYTKTLATTASEPSVSRESKYYLDNISKVTTIDGFLNNNR-------------LFTY 57

Query: 396 ALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPM 455
           A+ A+ L      +  +R +L    SDP + AN   D R   L   F+F   G+      
Sbjct: 58  AMKAFGLGDMVYAKGMVRQILQQGTSDPRALANTLNDSRYKALAQTFDFANLGANATSTT 117

Query: 456 MQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNIN-TI 514
              +  +   V+         +                        +E+  Y   +  TI
Sbjct: 118 TAGQNVVDKYVEMQLEDNVGKNSP---------------------GAEMALYLKRVAPTI 156

Query: 515 HSFEELLANKRILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDN 567
            S   +LA+K +L  +  +         +D     +    ++  SDL+DP         N
Sbjct: 157 TSAYSILADKTLLQIVQTTFNLPSSMSALDIDVQAKMINSKMKISDLQDPTKL--QTFTN 214

Query: 568 RYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           R+  +    N +         +         D    L
Sbjct: 215 RFIAMYDINNPNTGPSTPTNALLAQSSGLSSDLLMSL 251


>gi|27381994|ref|NP_773523.1| hypothetical protein blr6883 [Bradyrhizobium japonicum USDA 110]
 gi|27355164|dbj|BAC52148.1| blr6883 [Bradyrhizobium japonicum USDA 110]
          Length = 270

 Score =  202 bits (512), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 51/223 (22%), Positives = 100/223 (44%), Gaps = 6/223 (2%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S      +    + +  TQ     +++ E DY+  +I  + + ++ L + R+  + +++ 
Sbjct: 11  STIADYTRLTKDLGKSMTQVATQPDVSRETDYFLSHIGNVKTIDDFLKDYRLYTYAMKAY 70

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G+      + F+ ++    + +  +FAN   D RY+E  ++FNF   G+ + +       
Sbjct: 71  GLSDMTYAKAFMRKVLTEGVSNKDAFANKLTDARYREFATAFNFAALGDKATQTTAATTG 130

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
                     Y  Q +E+K  +++  + LALYF R    I N Y+IL D  L +VV   +
Sbjct: 131 TATQ------YVTQTMEQKAGDQNEGLRLALYFTRKASTITNAYQILADKALTQVVQTAM 184

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
             S   +      + +++   I + DF+D  KV  F+    AM
Sbjct: 185 GWSSTISSSDIDAQAKMITDKIDLTDFQDPTKVTKFVQRFAAM 227



 Score =  161 bits (406), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 104/235 (44%), Gaps = 16/235 (6%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +       +KD+  K  + V+  P VS E  Y+   I ++ TID+F+KD RL++YA+
Sbjct: 9   MLSTIADYTRLTKDL-GKSMTQVATQPDVSRETDYFLSHIGNVKTIDDFLKDYRLYTYAM 67

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-----VIQ 114
           KA+GLSDM++A+ F++K+L   +S+  +  N+L   +Y+ FA +++F+            
Sbjct: 68  KAYGLSDMTYAKAFMRKVLTEGVSNKDAFANKLTDARYREFATAFNFAALGDKATQTTAA 127

Query: 115 SDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           +       +    +     +   L  + YF +    I +  Q+  D+ L   V  +   +
Sbjct: 128 TTGTATQYVTQTMEQKAGDQNEGLRLALYFTRKASTITNAYQILADKALTQVVQTAMGWS 187

Query: 175 PKYI-------SLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLS 222
                      +      +      +P K        RF AM +  + Q D S +
Sbjct: 188 STISSSDIDAQAKMITDKIDLTDFQDPTKV--TKFVQRFAAMWDATQAQSDNSTN 240



 Score =  114 bits (284), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 73/177 (41%), Gaps = 1/177 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           +    +     E+ YF  +I  + ++D   KD RL  Y ++++ ++    +  F++ VLT
Sbjct: 28  TQVATQPDVSRETDYFLSHIGNVKTIDDFLKDYRLYTYAMKAYGLSDMTYAKAFMRKVLT 87

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI-DC 247
            G++N   +  +  D R+R  A  F F   G  + +    T     + V+        D 
Sbjct: 88  EGVSNKDAFANKLTDARYREFATAFNFAALGDKATQTTAATTGTATQYVTQTMEQKAGDQ 147

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND 304
              +    Y+    +++++    L D  L +++Q ++   +   ++D         D
Sbjct: 148 NEGLRLALYFTRKASTITNAYQILADKALTQVVQTAMGWSSTISSSDIDAQAKMITD 204



 Score = 88.8 bits (218), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 42/199 (21%), Positives = 69/199 (34%), Gaps = 33/199 (16%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             DL K   Q+     +      +   +G +K+ID+ L                    +A
Sbjct: 20  TKDLGKSMTQVATQPDVSRETDYFLSHIGNVKTIDDFLKD-------------YRLYTYA 66

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + AY L+     +  +R VLT   S+ D++ANK  D R  +   AFNF A G        
Sbjct: 67  MKAYGLSDMTYAKAFMRKVLTEGVSNKDAFANKLTDARYREFATAFNFAALGDKATQTTA 126

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
            +  T    V     +K                         E      Y+T   +TI +
Sbjct: 127 ATTGTATQYVTQTMEQK--------------------AGDQNEGLRLALYFTRKASTITN 166

Query: 517 FEELLANKRILNFLLESKG 535
             ++LA+K +   +  + G
Sbjct: 167 AYQILADKALTQVVQTAMG 185



 Score = 42.5 bits (98), Expect = 0.27,   Method: Composition-based stats.
 Identities = 24/185 (12%), Positives = 57/185 (30%), Gaps = 15/185 (8%)

Query: 215 FQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDP 274
               G+      I    ++ K +            +  + +Y+   I +V +  DFLKD 
Sbjct: 1   MATRGARVMLSTIADYTRLTKDLGKSMTQVATQPDVSRETDYFLSHIGNVKTIDDFLKDY 60

Query: 275 KLFKMLQLSLFPLNPEITADKFLTLMQE-------------NDPIVSQVKYFFQINFHRD 321
           +L+    +  + L+    A  F+  +                D    +    F      D
Sbjct: 61  RLYTY-AMKAYGLSDMTYAKAFMRKVLTEGVSNKDAFANKLTDARYREFATAFNFAALGD 119

Query: 322 NSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLE 381
            ++ T         + +    +      ++ ++ L   +      I +   +L+ K   +
Sbjct: 120 KATQTTAATTGTATQYVTQTMEQKAGDQNEGLR-LALYFTRKASTITNAYQILADKALTQ 178

Query: 382 GPNSA 386
              +A
Sbjct: 179 VVQTA 183


>gi|217977818|ref|YP_002361965.1| protein of unknown function DUF1217 [Methylocella silvestris BL2]
 gi|217503194|gb|ACK50603.1| protein of unknown function DUF1217 [Methylocella silvestris BL2]
          Length = 259

 Score =  202 bits (512), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 50/212 (23%), Positives = 90/212 (42%), Gaps = 6/212 (2%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
              +       +     E  YY  NI  + S ++L+ N+R+  ++L++ G+      +  
Sbjct: 14  DFSKSLATAASDTVAKRETAYYEANIGKVKSVDDLMKNQRLYAYVLKAYGLSDMAYAKGL 73

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++  SD+ D  S ANT    RYK + +++NF   G +                T D Y
Sbjct: 74  IRKVLTSDVTDGASLANTLSGGRYKALAAAYNFSAKGAVGT------ISAEAQKTTKDNY 127

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
             Q +E    +++    +ALYFKR  P +++ Y IL D  L  VV     LS   +    
Sbjct: 128 VEQTLEANVGKQNDGAKMALYFKRIAPTVKSAYGILADKTLLGVVQTAFGLSASMSQQNI 187

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
             + + +    KI D ++  K++  +    A 
Sbjct: 188 DVQAKTINALFKIGDLQNPAKLQKLIQRFTAN 219



 Score =  154 bits (388), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 48/179 (26%), Positives = 92/179 (51%), Gaps = 6/179 (3%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
            +      ++D  SK  +T + D +   E  YY   I  + ++D+ +K++RL++Y LKA+
Sbjct: 4   STLYYTMLTRDF-SKSLATAASDTVAKRETAYYEANIGKVKSVDDLMKNQRLYAYVLKAY 62

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ-----SDI 117
           GLSDM++A+  I+K+L SD++D  SL N L+  +Y+  A +Y+FS    V          
Sbjct: 63  GLSDMAYAKGLIRKVLTSDVTDGASLANTLSGGRYKALAAAYNFSAKGAVGTISAEAQKT 122

Query: 118 QHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
                ++   +++  K+    + + YF++    + S   +  D+ LL  V  +F ++  
Sbjct: 123 TKDNYVEQTLEANVGKQNDGAKMALYFKRIAPTVKSAYGILADKTLLGVVQTAFGLSAS 181



 Score =  118 bits (294), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/166 (21%), Positives = 69/166 (41%), Gaps = 9/166 (5%)

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
               + VA  E+ Y+  NI K+ SVD L K++RL  YVL+++ ++    +   ++ VLT 
Sbjct: 21  TAASDTVAKRETAYYEANIGKVKSVDDLMKNQRLYAYVLKAYGLSDMAYAKGLIRKVLTS 80

Query: 190 GLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP 249
            + +           R++A+A  + F   G++      ++    +    NY   T++   
Sbjct: 81  DVTDGASLANTLSGGRYKALAAAYNFSAKGAVGT----ISAEAQKTTKDNYVEQTLEANV 136

Query: 250 IVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
              +       Y+K    +V S    L D  L  ++Q +       
Sbjct: 137 GKQNDGAKMALYFKRIAPTVKSAYGILADKTLLGVVQTAFGLSASM 182



 Score = 95.7 bits (236), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 41/198 (20%), Positives = 73/198 (36%), Gaps = 34/198 (17%)

Query: 341 YKKNCQILHDDKMQS-LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
           + K+      D +       Y+  +GK+KS+D+L+  +                 + L A
Sbjct: 15  FSKSLATAASDTVAKRETAYYEANIGKVKSVDDLMKNQR-------------LYAYVLKA 61

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           Y L+     +  +R VLTS+ +D  S AN     R   L  A+NF+A G++G I     +
Sbjct: 62  YGLSDMAYAKGLIRKVLTSDVTDGASLANTLSGGRYKALAAAYNFSAKGAVGTISAEAQK 121

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
            T  + V+                               +      Y+     T+ S   
Sbjct: 122 TTKDNYVEQTLE--------------------ANVGKQNDGAKMALYFKRIAPTVKSAYG 161

Query: 520 LLANKRILNFLLESKGID 537
           +LA+K +L  +  + G+ 
Sbjct: 162 ILADKTLLGVVQTAFGLS 179



 Score = 45.6 bits (106), Expect = 0.035,   Method: Composition-based stats.
 Identities = 23/166 (13%), Positives = 51/166 (30%), Gaps = 13/166 (7%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           + +  S              +  YY+  I  V S  D +K+ +L+  + L  + L+    
Sbjct: 11  LTRDFSKSLATAASDTVAKRETAYYEANIGKVKSVDDLMKNQRLYAYV-LKAYGLSDMAY 69

Query: 293 ADKFLTLMQENDPIVSQV-----------KYFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
           A   +  +  +D                       NF    +  T   +  +  K   + 
Sbjct: 70  AKGLIRKVLTSDVTDGASLANTLSGGRYKALAAAYNFSAKGAVGTISAEAQKTTKDNYVE 129

Query: 342 KK-NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSA 386
           +     +   +    +   ++     +KS   +L+ K  L    +A
Sbjct: 130 QTLEANVGKQNDGAKMALYFKRIAPTVKSAYGILADKTLLGVVQTA 175


>gi|121601650|ref|YP_989406.1| hypothetical protein BARBAKC583_1147 [Bartonella bacilliformis
           KC583]
 gi|120613827|gb|ABM44428.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 264

 Score =  201 bits (510), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 57/251 (22%), Positives = 113/251 (45%), Gaps = 20/251 (7%)

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
            + +   + ++M++   +     ++  E DYY  NI ++ S +E LAN ++  + +++ G
Sbjct: 4   TYTSYRSTIDNMKKTLDRLLKEPQVKRETDYYVRNIASVQSVDEFLANDKLYRYAMQAHG 63

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           ++     +  + ++      DP+ +A+   D RY++  ++FNF+++GE +       Q N
Sbjct: 64  LEDMIYAKGMMRKVLL----DPR-YASQLSDQRYQQFAAAFNFNLYGEKAT------QQN 112

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIR--------NH-YEILGDSKL 646
                T + Y  Q +E +  + +    LALYF RT+  +         N  Y+ILGD  L
Sbjct: 113 SAQTATVNKYMQQTLEVQVGQDNEGARLALYFTRTVGGMARDGLLSEKNWAYQILGDKAL 172

Query: 647 FKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKK 706
             VV   L +     +     +  +L+  + + D KD K++E F+    A+       + 
Sbjct: 173 SAVVFTALDIPENVRLSKIEAQKSLLESRMSLKDLKDPKRLEHFIAQFSALYDAKNQEEI 232

Query: 707 ALFSSPNQNKD 717
                  QN  
Sbjct: 233 NPALMILQNSS 243



 Score =  160 bits (403), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 54/235 (22%), Positives = 101/235 (42%), Gaps = 28/235 (11%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   K    + K+P V  E  YY   I  + ++DEF+ + +L+ YA++
Sbjct: 1   MIGTYTSYRSTIDNMKKTLDRLLKEPQVKRETDYYVRNIASVQSVDEFLANDKLYRYAMQ 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQH 119
           A GL DM +A+  ++K+L     DP+   +QL+  +YQ FA +++F+    K  Q +   
Sbjct: 61  AHGLEDMIYAKGMMRKVL----LDPR-YASQLSDQRYQQFAAAFNFNLYGEKATQQNSAQ 115

Query: 120 KTIIQDYKQSHQH----KEEVALEESKYFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y Q        ++      + YF + +  +         N   Q+  D+ L   
Sbjct: 116 TATVNKYMQQTLEVQVGQDNEGARLALYFTRTVGGMARDGLLSEKNWAYQILGDKALSAV 175

Query: 167 VLQSFSITPKY------ISLPFLKDVLTL-GLANPKKYFIESRDNRFRAMAENFR 214
           V  +  I               L+  ++L  L +PK+   E    +F A+ +   
Sbjct: 176 VFTALDIPENVRLSKIEAQKSLLESRMSLKDLKDPKRL--EHFIAQFSALYDAKN 228



 Score = 89.5 bits (220), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 68/184 (36%), Gaps = 17/184 (9%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   +++ I + K++     KE     E+ Y+ +NI  + SVD+   + +L  Y +Q+
Sbjct: 2   IGTYTSYRSTIDNMKKTLDRLLKEPQVKRETDYYVRNIASVQSVDEFLANDKLYRYAMQA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
             +     +   ++ VL     +P+ Y  +  D R++  A  F F   G  + +      
Sbjct: 62  HGLEDMIYAKGMMRKVLL----DPR-YASQLSDQRYQQFAAAFNFNLYGEKATQQNSAQT 116

Query: 231 MQIEKIVSNYFNNTIDCV-PIVSDQNYYKLAINSVSS---------FSDFLKDPKLFKML 280
             + K +       +           Y+   +  ++              L D  L  ++
Sbjct: 117 ATVNKYMQQTLEVQVGQDNEGARLALYFTRTVGGMARDGLLSEKNWAYQILGDKALSAVV 176

Query: 281 QLSL 284
             +L
Sbjct: 177 FTAL 180



 Score = 74.1 bits (180), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 41/264 (15%), Positives = 87/264 (32%), Gaps = 46/264 (17%)

Query: 322 NSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLE 381
            + ++       ++K LD   K  Q+  +         Y   +  ++S+D  L+      
Sbjct: 3   GTYTSYRSTIDNMKKTLDRLLKEPQVKRET------DYYVRNIASVQSVDEFLANDK--- 53

Query: 382 GPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHA 441
                       ++A+ A+ L      +  +R VL     DP  YA++  D R  +   A
Sbjct: 54  ----------LYRYAMQAHGLEDMIYAKGMMRKVL----LDPR-YASQLSDQRYQQFAAA 98

Query: 442 FNFNADGSIGPIPMMQSRLTIRDNVKHYAN-RKRSIHDAENKSFNSMEQISTQKRINLEI 500
           FNFN  G            T+   ++     +    ++    +      +    R  L  
Sbjct: 99  FNFNLYGEKATQQNSAQTATVNKYMQQTLEVQVGQDNEGARLALYFTRTVGGMARDGLLS 158

Query: 501 NSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI-DSQKVREDFLCEIFKS------D 553
                Y            ++L +K +   +  +  I ++ ++ +    +          D
Sbjct: 159 EKNWAY------------QILGDKALSAVVFTALDIPENVRLSKIEAQKSLLESRMSLKD 206

Query: 554 LKDPKSFANTYKDNRYKEIISSFN 577
           LKDPK   +     ++  +  + N
Sbjct: 207 LKDPKRLEHFIA--QFSALYDAKN 228



 Score = 49.1 bits (115), Expect = 0.002,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 73/199 (36%), Gaps = 17/199 (8%)

Query: 239 NYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLT 298
              +  +    +  + +YY   I SV S  +FL + KL++   +    L   I A   + 
Sbjct: 17  KTLDRLLKEPQVKRETDYYVRNIASVQSVDEFLANDKLYRY-AMQAHGLEDMIYAKGMMR 75

Query: 299 LMQENDPIVSQV------KYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNC---QILH 349
            +  +    SQ+      ++    NF+     +T  QQ+S     ++ Y +     Q+  
Sbjct: 76  KVLLDPRYASQLSDQRYQQFAAAFNFNLYGEKAT--QQNSAQTATVNKYMQQTLEVQVGQ 133

Query: 350 DDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA---YNLNMQD 406
           D++   L   +   +G +   D LLS K         +     +  ALD      L+  +
Sbjct: 134 DNEGARLALYFTRTVGGMAR-DGLLSEKNWAYQILGDKALSAVVFTALDIPENVRLSKIE 192

Query: 407 LDRDQLR-NVLTSNPSDPD 424
             +  L   +   +  DP 
Sbjct: 193 AQKSLLESRMSLKDLKDPK 211


>gi|296444947|ref|ZP_06886909.1| protein of unknown function DUF1217 [Methylosinus trichosporium
           OB3b]
 gi|296257615|gb|EFH04680.1| protein of unknown function DUF1217 [Methylosinus trichosporium
           OB3b]
          Length = 266

 Score =  200 bits (507), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 50/213 (23%), Positives = 100/213 (46%), Gaps = 6/213 (2%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           N+     +      ++ ++  Y+  NI  + S ++ + N R+ N+ + + G+      + 
Sbjct: 12  NNQSLWQSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTAFGLGDMTYAKG 71

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            + ++ +  + D  + ANT  +   K   ++F+F  +G  +         +  +D+    
Sbjct: 72  MMQKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTTS------SSTLVDNVVSR 125

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +E  + +++P + LALYF+R  P+I + Y IL DSK+  VV   L +S       
Sbjct: 126 YAEQSLEDNQGQQNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTALGISTQTTSQS 185

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
              +  +L   + I DF+D KK++ F+    AM
Sbjct: 186 IDSQAAMLTSKLDITDFQDPKKLQQFISRFAAM 218



 Score =  160 bits (404), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 56/231 (24%), Positives = 107/231 (46%), Gaps = 7/231 (3%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + +        + QS   S  +K P V+ + +Y+ + I  + ++D+F+K+ RLF+YA+ A
Sbjct: 1   MTTLSTYLQIANNQSLWQSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTA 60

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-----D 116
           FGL DM++A+  ++K+LE  +SD  +L N LN+   + FA ++DF+       S     D
Sbjct: 61  FGLGDMTYAKGMMQKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTTSSSTLVD 120

Query: 117 IQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
                  +   + +Q ++   ++ + YF++N   I SV  +  D ++L  V  +  I+ +
Sbjct: 121 NVVSRYAEQSLEDNQGQQNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTALGISTQ 180

Query: 177 YISLPFLKD--VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD 225
             S        +LT  L        +         A  + +   GS +   
Sbjct: 181 TTSQSIDSQAAMLTSKLDITDFQDPKKLQQFISRFAAMYDYNNSGSDANSQ 231



 Score =  114 bits (285), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/166 (22%), Positives = 69/166 (41%), Gaps = 1/166 (0%)

Query: 128 QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVL 187
           QS   K+     +++YF  NI K+ SVD   K+ RL +Y + +F +     +   ++ VL
Sbjct: 18  QSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTAFGLGDMTYAKGMMQKVL 77

Query: 188 TLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTID 246
             G+++         +   +A A  F F  +G+ +     L D  + +        N   
Sbjct: 78  EQGVSDNSALANTLNNANIKAFATAFDFADNGASTTSSSTLVDNVVSRYAEQSLEDNQGQ 137

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
             P V    Y++    S++S    L D K+  ++Q +L       +
Sbjct: 138 QNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTALGISTQTTS 183



 Score = 84.1 bits (206), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 35/201 (17%), Positives = 76/201 (37%), Gaps = 33/201 (16%)

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
                    + +  + ++  +GK++S+D+ +                    +A+ A+ L 
Sbjct: 18  QSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDR-------------LFNYAMTAFGLG 64

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
                +  ++ VL    SD  + AN   +  +     AF+F  +G+        S   + 
Sbjct: 65  DMTYAKGMMQKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTT----SSSTLVD 120

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
           + V  YA +             S+E    Q+   +++     Y+  N  +I S   +LA+
Sbjct: 121 NVVSRYAEQ-------------SLEDNQGQQNPGVQLA---LYFQRNAPSITSVYGILAD 164

Query: 524 KRILNFLLESKGIDSQKVRED 544
            +IL+ +  + GI +Q   + 
Sbjct: 165 SKILSVVQTALGISTQTTSQS 185



 Score = 46.8 bits (109), Expect = 0.012,   Method: Composition-based stats.
 Identities = 28/174 (16%), Positives = 58/174 (33%), Gaps = 13/174 (7%)

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
             + T +QI    S + + T     + +   Y++  I  V S  DF+K+ +LF     + 
Sbjct: 2   TTLSTYLQIANNQSLWQSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTA- 60

Query: 285 FPLNPEITADKFLTLMQENDPIVSQVKY---------FFQINFHRDNSSSTKIQQDSQIQ 335
           F L     A   +  + E     +              F   F   ++ ++     + + 
Sbjct: 61  FGLGDMTYAKGMMQKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTTSSSTLVD 120

Query: 336 KMLDLYKKNC---QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSA 386
            ++  Y +          +    L   +Q     I S+  +L+    L    +A
Sbjct: 121 NVVSRYAEQSLEDNQGQQNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTA 174


>gi|323139683|ref|ZP_08074724.1| protein of unknown function DUF1217 [Methylocystis sp. ATCC 49242]
 gi|322395062|gb|EFX97622.1| protein of unknown function DUF1217 [Methylocystis sp. ATCC 49242]
          Length = 266

 Score =  198 bits (504), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 52/219 (23%), Positives = 98/219 (44%), Gaps = 7/219 (3%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           N + +  +      ++  E  Y+  NI    S E  L ++R+ N+ +++ G+  +     
Sbjct: 12  NDLGRWRSITAKAPDVALETKYFKENIGKATSIEAFLKDRRLFNYAMKAFGLGDRTFAIG 71

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            + ++ +  + DPK+ A T  +        +F+F   G         V     I D    
Sbjct: 72  LMRKVMEQGVDDPKALARTLNNPNILAFAKAFDFSAKGA-------GVPSATLIQDVTAR 124

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           +  Q ++ ++ +++P + LALYF+   P + + Y +L D KL +VV   L +SP  +   
Sbjct: 125 FVEQAMQAEQGKRNPGVELALYFREKAPGLTSIYGVLADKKLVQVVQTALDISPRTSAQN 184

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSID 703
              + R+LK  + + DFKD KK+  F+    AM      
Sbjct: 185 IDTQARLLKAKVNVEDFKDPKKLTAFIARFSAMYDMQNQ 223



 Score =  160 bits (404), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 64/240 (26%), Positives = 116/240 (48%), Gaps = 16/240 (6%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + +  +     +   +  S  +K P V+ E +Y++E I   ++I+ F+KD+RLF+YA+KA
Sbjct: 1   MTTIASYLSIANDLGRWRSITAKAPDVALETKYFKENIGKATSIEAFLKDRRLFNYAMKA 60

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKT 121
           FGL D + A   ++K++E  + DPK+L   LN+     FA+++DFS     + S    + 
Sbjct: 61  FGLGDRTFAIGLMRKVMEQGVDDPKALARTLNNPNILAFAKAFDFSAKGAGVPSATLIQD 120

Query: 122 I----IQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           +    ++   Q+ Q K    +E + YFR+    + S+  +  D++L+  V  +  I+P+ 
Sbjct: 121 VTARFVEQAMQAEQGKRNPGVELALYFREKAPGLTSIYGVLADKKLVQVVQTALDISPRT 180

Query: 178 ISLP------FLK-DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
            +         LK  V      +PKK    +   RF AM   +  Q  G++S        
Sbjct: 181 SAQNIDTQARLLKAKVNVEDFKDPKKL--TAFIARFSAM---YDMQNQGTVSSATASSNA 235



 Score =  117 bits (293), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 48/228 (21%), Positives = 90/228 (39%), Gaps = 13/228 (5%)

Query: 128 QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVL 187
           +S   K      E+KYF++NI K  S++   KDRRL +Y +++F +  +  ++  ++ V+
Sbjct: 18  RSITAKAPDVALETKYFKENIGKATSIEAFLKDRRLFNYAMKAFGLGDRTFAIGLMRKVM 77

Query: 188 TLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDC 247
             G+ +PK       +    A A+ F F   G+      ++ D+    +           
Sbjct: 78  EQGVDDPKALARTLNNPNILAFAKAFDFSAKGAGVPSATLIQDVTARFVEQAMQAEQGKR 137

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIV 307
            P V    Y++     ++S    L D KL +++Q +L  ++P  +A       Q  D   
Sbjct: 138 NPGVELALYFREKAPGLTSIYGVLADKKLVQVVQTAL-DISPRTSA-------QNIDTQA 189

Query: 308 SQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS 355
             +K    +   +D    T       I +   +Y    Q        S
Sbjct: 190 RLLKAKVNVEDFKDPKKLTAF-----IARFSAMYDMQNQGTVSSATAS 232



 Score = 81.8 bits (200), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 38/254 (14%), Positives = 78/254 (30%), Gaps = 43/254 (16%)

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
                    +    K ++  +GK  SI+  L  +                 +A+ A+ L 
Sbjct: 18  RSITAKAPDVALETKYFKENIGKATSIEAFLKDRR-------------LFNYAMKAFGLG 64

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
            +      +R V+     DP + A    +  ++    AF+F+A G+  P     S   I+
Sbjct: 65  DRTFAIGLMRKVMEQGVDDPKALARTLNNPNILAFAKAFDFSAKGAGVP-----SATLIQ 119

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
           D    +  +                  + Q + N  +   + Y+      + S   +LA+
Sbjct: 120 DVTARFVEQAM---------------QAEQGKRNPGVELAL-YFREKAPGLTSIYGVLAD 163

Query: 524 KRILNFLLESKGIDS-------QKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSF 576
           K+++  +  +  I                  ++   D KDPK         R+  +    
Sbjct: 164 KKLVQVVQTALDISPRTSAQNIDTQARLLKAKVNVEDFKDPKKLTAFIA--RFSAMYDMQ 221

Query: 577 NFDIHGELSHKKIG 590
           N       +     
Sbjct: 222 NQGTVSSATASSNA 235


>gi|13472569|ref|NP_104136.1| hypothetical protein mlr2906 [Mesorhizobium loti MAFF303099]
 gi|14023315|dbj|BAB49922.1| mlr2906 [Mesorhizobium loti MAFF303099]
          Length = 210

 Score =  197 bits (499), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 55/204 (26%), Positives = 96/204 (47%), Gaps = 6/204 (2%)

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
           ++N R+  + L + G+DS    +  + ++ +  ++DP S AN  K+  Y  + S+FNF+ 
Sbjct: 1   MSNSRLYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQ 60

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
           +GE +   +   Q       T D Y  Q +E+     +  + LALYF+R  P+I + Y++
Sbjct: 61  YGENATTIVPAQQP------TVDKYMRQSLEEDAGNTNAGVRLALYFQRKAPDITSWYDV 114

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQ 700
           L D+ L  VV   L L   FA     K+ ++ ++ + I+DF D  K+  FL    +M   
Sbjct: 115 LADTALASVVRTALGLPDSFATADIDKQAQLFEQKLDISDFTDPVKLGKFLTRFTSMYEI 174

Query: 701 SIDYKKALFSSPNQNKDPWNNSFD 724
           +     A+ S       P      
Sbjct: 175 NNPTSTAVTSVSVLFAQPVTAGIS 198



 Score =  101 bits (250), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/143 (18%), Positives = 61/143 (42%), Gaps = 5/143 (3%)

Query: 49  IKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP 108
           + + RL++YAL A+GL   +  +  IK++L+  + DP S+ N+  +  Y   A +++F  
Sbjct: 1   MSNSRLYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQ 60

Query: 109 PPKVIQSDI-QHKTIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRL 163
             +   + +   +  +  Y +    ++       +  + YF++    I S   +  D  L
Sbjct: 61  YGENATTIVPAQQPTVDKYMRQSLEEDAGNTNAGVRLALYFQRKAPDITSWYDVLADTAL 120

Query: 164 LDYVLQSFSITPKYISLPFLKDV 186
              V  +  +   + +    K  
Sbjct: 121 ASVVRTALGLPDSFATADIDKQA 143



 Score = 92.6 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 54/138 (39%), Gaps = 1/138 (0%)

Query: 158 FKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP 217
             + RL  Y L ++ +         +K VL  G+ +P     + ++  + A+A  F F+ 
Sbjct: 1   MSNSRLYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQ 60

Query: 218 DGSLSKRDKILTDMQIEKIVSNYFNN-TIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKL 276
            G  +          ++K +         +    V    Y++     ++S+ D L D  L
Sbjct: 61  YGENATTIVPAQQPTVDKYMRQSLEEDAGNTNAGVRLALYFQRKAPDITSWYDVLADTAL 120

Query: 277 FKMLQLSLFPLNPEITAD 294
             +++ +L   +   TAD
Sbjct: 121 ASVVRTALGLPDSFATAD 138



 Score = 75.7 bits (184), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 61/173 (35%), Gaps = 27/173 (15%)

Query: 392 TLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIG 451
              +AL AY L+    D+  ++ VL     DP+S ANK K+     L  AFNF   G   
Sbjct: 6   LYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQYGENA 65

Query: 452 PIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNI 511
              +   + T+   ++          +A                          Y+    
Sbjct: 66  TTIVPAQQPTVDKYMRQSLEEDAGNTNAG--------------------VRLALYFQRKA 105

Query: 512 NTIHSFEELLANKRILNFLLESKGIDS-------QKVREDFLCEIFKSDLKDP 557
             I S+ ++LA+  + + +  + G+          K  + F  ++  SD  DP
Sbjct: 106 PDITSWYDVLADTALASVVRTALGLPDSFATADIDKQAQLFEQKLDISDFTDP 158


>gi|209963548|ref|YP_002296463.1| hypothetical protein RC1_0201 [Rhodospirillum centenum SW]
 gi|209957014|gb|ACI97650.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 508

 Score =  196 bits (497), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 77/526 (14%), Positives = 179/526 (34%), Gaps = 59/526 (11%)

Query: 214 RFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPI-VSDQNYYKLAINSVSSFSDFLK 272
            F            +T  ++    ++     +   P+  +D  Y +  + SV +  + + 
Sbjct: 5   GFGAATVSGGTGSSITQWRLLGRTADRQKTVMMSDPVNKADTQYARAKLASVGTVDELMS 64

Query: 273 DPKLFKMLQLSLFPLNPEITADKFLTLMQEND-------------PIVSQVKYFFQINFH 319
           D +L+  + +  F L  +I +   +  +  +D             P   ++   F     
Sbjct: 65  DRRLYSYV-MRAFGLEDQINSQALVRKILTSDLSDPSSAANRIADPRFRELAAAFNFGAD 123

Query: 320 RDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQ 379
             + S T     +QI  +    +    +   ++   ++ D+   L   +S   +++ +  
Sbjct: 124 SKSKSKTSPSFINQIADLYVRERYEESVSSKNESLGMMLDFTRNLPTKRSWAEVMADEGM 183

Query: 380 LEGPN---SAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLI 436
            +         +PI  +  A  A +L         ++  + +  +   S           
Sbjct: 184 AQVVRIIYDLPKPIGPVDAAEQAKSLE------ATIKFSVFTTVTSVQS----------- 226

Query: 437 KLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRI 496
                F F+   + G          ++  +          +D E  +F +          
Sbjct: 227 AFRDDF-FDVWDANGNPRGSSIPSKVQWEML------ARSYDREKAAFATRYD------- 272

Query: 497 NLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKD 556
              + S+V   T  I T+ S ++LL ++++L  +L++  ++ +   + +L ++ +SD   
Sbjct: 273 ---VKSDVAALTKTIPTLDSVDDLLNDRKLLPIVLKAFDLEDKATDKTYLRKVLESDPNS 329

Query: 557 PKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEE 616
             SFA        K +  +F     G               ++D  + Y  Q  E     
Sbjct: 330 ATSFAAK-AGPEEKALALAFGMTNSGAKRRG------SPAFVEDIVNRYTTQSFEVSAGN 382

Query: 617 KDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHI 676
            +  + L LYF+R    + + Y++L D  L KV    L L    A +   +++ +L   +
Sbjct: 383 ANEALRLGLYFQRKAGGLTSWYQVLADQALAKVARLALNLPSQSAQIDLDRQVDMLSSKL 442

Query: 677 KINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNS 722
            I   +D  +V   +     M   + +      ++    +    N 
Sbjct: 443 DIKKLQDPAEVGKLIEKFLLMWDVTGEDNGNSAAASPLVQLLSGNG 488



 Score =  181 bits (460), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 80/464 (17%), Positives = 175/464 (37%), Gaps = 61/464 (13%)

Query: 107 SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDY 166
           S       +  +      D +++    + V   +++Y R  +  + +VD+L  DRRL  Y
Sbjct: 12  SGGTGSSITQWRLLGRTADRQKTVMMSDPVNKADTQYARAKLASVGTVDELMSDRRLYSY 71

Query: 167 VLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD- 225
           V+++F +  +  S   ++ +LT  L++P        D RFR +A  F F  D     +  
Sbjct: 72  VMRAFGLEDQINSQALVRKILTSDLSDPSSAANRIADPRFRELAAAFNFGADSKSKSKTS 131

Query: 226 ----KILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQ 281
                 + D+ + +      ++  + + ++ D   +   + +  S+++ + D  + ++++
Sbjct: 132 PSFINQIADLYVRERYEESVSSKNESLGMMLD---FTRNLPTKRSWAEVMADEGMAQVVR 188

Query: 282 L------SLFPLNPEITADKFLTLMQEN-DPIVSQVKYFFQINF---------HRDNSSS 325
           +       + P++    A      ++ +    V+ V+  F+ +F          R +S  
Sbjct: 189 IIYDLPKPIGPVDAAEQAKSLEATIKFSVFTTVTSVQSAFRDDFFDVWDANGNPRGSSIP 248

Query: 326 TKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNS 385
           +K+Q    + +  D  K      +D K           +  + S+D+LL+ +        
Sbjct: 249 SKVQW-EMLARSYDREKAAFATRYDVKSDVAALTKT--IPTLDSVDDLLNDRK------- 298

Query: 386 AEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFN 445
                  L   L A++L  +  D+  LR VL S+P+   S+A K+  +    L  AF   
Sbjct: 299 ------LLPIVLKAFDLEDKATDKTYLRKVLESDPNSATSFAAKAGPEE-KALALAFGMT 351

Query: 446 ADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVD 505
             G+        S   + D V  Y  +                          E      
Sbjct: 352 NSGA----KRRGSPAFVEDIVNRYTTQS----------------FEVSAGNANEALRLGL 391

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
           Y+      + S+ ++LA++ +      +  + SQ  + D   ++
Sbjct: 392 YFQRKAGGLTSWYQVLADQALAKVARLALNLPSQSAQIDLDRQV 435



 Score =  156 bits (395), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 71/383 (18%), Positives = 151/383 (39%), Gaps = 21/383 (5%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
            DP+   + +Y R ++  + T+DE + D+RL+SY ++AFGL D  +++  ++KIL SDLS
Sbjct: 38  SDPVNKADTQYARAKLASVGTVDELMSDRRLYSYVMRAFGLEDQINSQALVRKILTSDLS 97

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQ------HKTIIQDYKQSHQHKEEVA 137
           DP S  N++   +++  A +++F    K                 +++  +     +  +
Sbjct: 98  DPSSAANRIADPRFRELAAAFNFGADSKSKSKTSPSFINQIADLYVRERYEESVSSKNES 157

Query: 138 LEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY 197
           L     F +N+    S  ++  D  +   V   + +      +   +   +L        
Sbjct: 158 LGMMLDFTRNLPTKRSWAEVMADEGMAQVVRIIYDLPKPIGPVDAAEQAKSLEATIKFSV 217

Query: 198 FIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNT---IDCVPIVSDQ 254
           F      +     + F         +   I + +Q E +  +Y            + SD 
Sbjct: 218 FTTVTSVQSAFRDDFFDVWDANGNPRGSSIPSKVQWEMLARSYDREKAAFATRYDVKSDV 277

Query: 255 NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQV---- 310
                 I ++ S  D L D KL  ++ L  F L  + T   +L  + E+DP  +      
Sbjct: 278 AALTKTIPTLDSVDDLLNDRKLLPIV-LKAFDLEDKATDKTYLRKVLESDPNSATSFAAK 336

Query: 311 ----KYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK-NCQILHDDKMQSLIKD--YQLP 363
               +    + F   NS + +    + ++ +++ Y   + ++   +  ++L     +Q  
Sbjct: 337 AGPEEKALALAFGMTNSGAKRRGSPAFVEDIVNRYTTQSFEVSAGNANEALRLGLYFQRK 396

Query: 364 LGKIKSIDNLLSGKCQLEGPNSA 386
            G + S   +L+ +   +    A
Sbjct: 397 AGGLTSWYQVLADQALAKVARLA 419



 Score =  103 bits (257), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 37/198 (18%), Positives = 77/198 (38%), Gaps = 8/198 (4%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           IPS V          +  +  +    V  +     + I  + ++D+ + D++L    LKA
Sbjct: 247 IPSKVQWEMLARSYDREKAAFATRYDVKSDVAALTKTIPTLDSVDDLLNDRKLLPIVLKA 306

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHK 120
           F L D +  + +++K+LESD +   S   +    + +  A ++   +   K   S    +
Sbjct: 307 FDLEDKATDKTYLRKVLESDPNSATSFAAK-AGPEEKALALAFGMTNSGAKRRGSPAFVE 365

Query: 121 TIIQDY----KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            I+  Y     +        AL    YF++    + S  Q+  D+ L      + ++  +
Sbjct: 366 DIVNRYTTQSFEVSAGNANEALRLGLYFQRKAGGLTSWYQVLADQALAKVARLALNLPSQ 425

Query: 177 YISLPFLKDV--LTLGLA 192
              +   + V  L+  L 
Sbjct: 426 SAQIDLDRQVDMLSSKLD 443


>gi|84502363|ref|ZP_01000499.1| hypothetical protein OB2597_20146 [Oceanicola batsensis HTCC2597]
 gi|84389175|gb|EAQ01972.1| hypothetical protein OB2597_20146 [Oceanicola batsensis HTCC2597]
          Length = 274

 Score =  194 bits (492), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 44/254 (17%), Positives = 110/254 (43%), Gaps = 13/254 (5%)

Query: 495 RINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDL 554
           R + +    ++++  NI  + + ++LL ++ +  F++ +  ++ Q   +  + ++ KS++
Sbjct: 28  RNSAQHKRAIEHFKANIKDVETVDQLLEDQELYAFVMRAFDLEDQIFGKAMIEKVLKSNI 87

Query: 555 KDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKE 614
           ++  +  N   D R++E+ +   F   GE +   I     N       D Y  +      
Sbjct: 88  EENDALVNRLTDPRFREMYNELGFGTDGEGNLNTILNTWQNR----MVDRYVERQFINFT 143

Query: 615 EEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKK 674
           EE++  + +AL F+  + +I + ++IL D+++ +     L L    + +   K+  +L+ 
Sbjct: 144 EEQNETVGIALEFRNKVGDINSVFDILKDNQMTRFFQTALGLPSQMSGIDIDKQAELLES 203

Query: 675 HIKINDFKDSKKVEDFLYAA----KAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNV 730
            I ++   D + V+  +        A+   S     AL      + +   +  +     +
Sbjct: 204 KIDLDTLSDPEVVDKLVRKYVAISDALSGTSTQSNGALQMLTGNSGNAAASIIE-----I 258

Query: 731 SLQLSPQKKSNGRF 744
           ++ + P   S  RF
Sbjct: 259 TMNIDPVSYSASRF 272



 Score =  136 bits (343), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 37/255 (14%), Positives = 103/255 (40%), Gaps = 24/255 (9%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++D Q      +           +++  IK + T+D+ ++D+ L+++ ++AF L D    
Sbjct: 19  TRDTQ---LDLIRNSAQHKRAIEHFKANIKDVETVDQLLEDQELYAFVMRAFDLEDQIFG 75

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK----VIQSDIQHKTIIQDY 126
           +  I+K+L+S++ +  +LVN+L   +++       F    +     I +  Q++ + +  
Sbjct: 76  KAMIEKVLKSNIEENDALVNRLTDPRFREMYNELGFGTDGEGNLNTILNTWQNRMVDRYV 135

Query: 127 KQS---HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
           ++       ++   +  +  FR  +  INSV  + KD ++  +   +  +  +   +   
Sbjct: 136 ERQFINFTEEQNETVGIALEFRNKVGDINSVFDILKDNQMTRFFQTALGLPSQMSGIDID 195

Query: 184 KD--VLTLGLA---NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVS 238
           K   +L   +          ++    ++ A+++                 ++  ++ +  
Sbjct: 196 KQAELLESKIDLDTLSDPEVVDKLVRKYVAISDAL---------SGTSTQSNGALQMLTG 246

Query: 239 NYFNNTIDCVPIVSD 253
           N  N     + I  +
Sbjct: 247 NSGNAAASIIEITMN 261



 Score = 70.7 bits (171), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 39/239 (16%), Positives = 85/239 (35%), Gaps = 44/239 (18%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           I +  + +  I+ ++  +  ++++D LL             E      F + A++L  Q 
Sbjct: 27  IRNSAQHKRAIEHFKANIKDVETVDQLL-------------EDQELYAFVMRAFDLEDQI 73

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNAD--GSIGPIPMMQSRLTIRD 464
             +  +  VL SN  + D+  N+  D R  ++ +   F  D  G++  I        +  
Sbjct: 74  FGKAMIEKVLKSNIEENDALVNRLTDPRFREMYNELGFGTDGEGNLNTILNTWQNRMVDR 133

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+                       + ++   + I  E   +   +  I+S  ++L + 
Sbjct: 134 YVER-----------------QFINFTEEQNETVGIALE---FRNKVGDINSVFDILKDN 173

Query: 525 RILNFLLESKGIDSQKVREDFLCEI--FKS-----DLKDPKSFANTYKDNRYKEIISSF 576
           ++  F   + G+ SQ    D   +    +S      L DP+   +     +Y  I  + 
Sbjct: 174 QMTRFFQTALGLPSQMSGIDIDKQAELLESKIDLDTLSDPE-VVDKLV-RKYVAISDAL 230


>gi|159184366|ref|NP_353586.2| hypothetical protein Atu0559 [Agrobacterium tumefaciens str. C58]
 gi|2459707|gb|AAB71783.1| OrfX [Agrobacterium tumefaciens]
 gi|159139680|gb|AAK86371.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 211

 Score =  193 bits (491), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 49/203 (24%), Positives = 82/203 (40%), Gaps = 11/203 (5%)

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
           +A+ R+ N+ L++ G++     + F+ ++      D  +FAN   DNRY E+  S +F  
Sbjct: 1   MADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAG 60

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
                                   Y  Q +E++  + +  + LALYF+R  P I++  + 
Sbjct: 61  ------LGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDF 114

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM--- 697
           L D  L +V      L   FA     K+  +++K I I D +D +KV   L     M   
Sbjct: 115 LADDALAQVFRTTFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLLERFTIMWEM 174

Query: 698 --DHQSIDYKKALFSSPNQNKDP 718
                + D      SS      P
Sbjct: 175 QNPSTTYDPLAVFGSSSGYGISP 197



 Score =  116 bits (290), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/143 (24%), Positives = 63/143 (44%), Gaps = 5/143 (3%)

Query: 49  IKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP 108
           + D RL++YALKA GL DM++A+ FI+K+L    SD  +  N+L+  +Y   A+S DF+ 
Sbjct: 1   MADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAG 60

Query: 109 PPKVIQSDIQHKTII-----QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRL 163
                 +    K+ +     +   +     +   +  + YF +    I S      D  L
Sbjct: 61  LGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDAL 120

Query: 164 LDYVLQSFSITPKYISLPFLKDV 186
                 +F++   + +    K  
Sbjct: 121 AQVFRTTFNLPDAFAAADVDKQA 143



 Score = 94.2 bits (232), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 58/142 (40%), Gaps = 9/142 (6%)

Query: 158 FKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP 217
             D RL +Y L++  +     +  F++ VLT G ++   +  +  DNR+  +A++  F  
Sbjct: 1   MADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAG 60

Query: 218 DGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN-----YYKLAINSVSSFSDFLK 272
                      T+     ++ NY   T++      +       Y++    ++ S  DFL 
Sbjct: 61  ----LGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLA 116

Query: 273 DPKLFKMLQLSLFPLNPEITAD 294
           D  L ++ + +    +    AD
Sbjct: 117 DDALAQVFRTTFNLPDAFAAAD 138



 Score = 78.4 bits (191), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/162 (16%), Positives = 50/162 (30%), Gaps = 20/162 (12%)

Query: 388 EPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNAD 447
                  +AL A+ L      +  +R VLT   SD +++ANK  D+R  +L  + +F   
Sbjct: 2   ADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGL 61

Query: 448 GSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYY 507
           G+            I +  +    ++    +                           Y+
Sbjct: 62  GAAATATEAAKSGVIGNYARQTLEQEAGDDNNG--------------------VRLALYF 101

Query: 508 TLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
                TI S  + LA+  +      +  +       D   + 
Sbjct: 102 ERKAPTIKSGLDFLADDALAQVFRTTFNLPDAFAAADVDKQA 143


>gi|312115256|ref|YP_004012852.1| hypothetical protein Rvan_2538 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220385|gb|ADP71753.1| protein of unknown function DUF1217 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 264

 Score =  192 bits (488), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 64/236 (27%), Positives = 111/236 (47%), Gaps = 12/236 (5%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           N+  + +        + S+ +YY  NI  I S +EL+ + ++ ++ L + G+  +   + 
Sbjct: 13  NNYSKWTEITAAEPSVASQTEYYKANIGNITSADELVGDYKLFSYALTAYGLGDEVYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
              ++      D  S ++        E+  +FNF+ +G  S      VQ+     D  DL
Sbjct: 73  LYKKVLSEG-TDKGSLSSKLGKLGVTELAKTFNFEENGT-STTTSDAVQN-----DVVDL 125

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y  Q +E+K+ E +    +ALYF R    I + Y+IL D  L K V   L LS Y A + 
Sbjct: 126 YLAQTLEEKQGETNEGAQMALYFYRNASKIDSVYDILADKTLLKTVYTALGLSEYTAAMN 185

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-----DHQSIDYKKALFSSPNQN 715
             K+  +L K + +NDFKD +K+  F+     +     ++ + DY  ALF + + N
Sbjct: 186 IDKQASLLSKALDLNDFKDPQKLTSFIAKFSTLYDSENNNTASDYVSALFGTSSSN 241



 Score =  143 bits (359), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 54/259 (20%), Positives = 106/259 (40%), Gaps = 8/259 (3%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  +        +  SK     + +P V+ +  YY+  I +I++ DE + D +LFSYAL 
Sbjct: 1   MTSTLTTFLSISNNYSKWTEITAAEPSVASQTEYYKANIGNITSADELVGDYKLFSYALT 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL D  +A+   KK+L     D  SL ++L  L     A++++F        +    +
Sbjct: 61  AYGLGDEVYAKALYKKVLSEGT-DKGSLSSKLGKLGVTELAKTFNFEENGTSTTTSDAVQ 119

Query: 121 TIIQDYK-----QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             + D       +  Q +     + + YF +N  KI+SV  +  D+ LL  V  +  ++ 
Sbjct: 120 NDVVDLYLAQTLEEKQGETNEGAQMALYFYRNASKIDSVYDILADKTLLKTVYTALGLSE 179

Query: 176 KYISLPFLKD--VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQI 233
              ++   K   +L+  L        +   +     +  +  + + + S     L     
Sbjct: 180 YTAAMNIDKQASLLSKALDLNDFKDPQKLTSFIAKFSTLYDSENNNTASDYVSALFGTSS 239

Query: 234 EKIVSNYFNNTIDCVPIVS 252
              V ++  + +  V  +S
Sbjct: 240 SNGVVSFSVDLLSSVQGLS 258



 Score = 98.0 bits (242), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 45/249 (18%), Positives = 84/249 (33%), Gaps = 23/249 (9%)

Query: 128 QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVL 187
                 E     +++Y++ NI  I S D+L  D +L  Y L ++ +  +  +    K VL
Sbjct: 19  TEITAAEPSVASQTEYYKANIGNITSADELVGDYKLFSYALTAYGLGDEVYAKALYKKVL 78

Query: 188 TLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDC 247
           + G  +      +        +A+ F F+ +G+ +      +D     +V  Y   T++ 
Sbjct: 79  SEG-TDKGSLSSKLGKLGVTELAKTFNFEENGTSTT----TSDAVQNDVVDLYLAQTLEE 133

Query: 248 VPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
               +++      Y+    + + S  D L D  L K +  +L             T    
Sbjct: 134 KQGETNEGAQMALYFYRNASKIDSVYDILADKTLLKTVYTALGLSE--------YTAAMN 185

Query: 303 NDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL 362
            D   S +     +N           +  S I K   LY         D + +L      
Sbjct: 186 IDKQASLLSKALDLN-----DFKDPQKLTSFIAKFSTLYDSENNNTASDYVSALFGTSSS 240

Query: 363 PLGKIKSID 371
                 S+D
Sbjct: 241 NGVVSFSVD 249



 Score = 69.9 bits (169), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 44/265 (16%), Positives = 85/265 (32%), Gaps = 43/265 (16%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
              +  + S  + Y+  +G I S D L+                    +AL AY L  + 
Sbjct: 22  TAAEPSVASQTEYYKANIGNITSADELVGD-------------YKLFSYALTAYGLGDEV 68

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +   + VL+   +D  S ++K     + +L   FNF  +G+            +   +
Sbjct: 69  YAKALYKKVLSEG-TDKGSLSSKLGKLGVTELAKTFNFEENGTSTTTSDAVQNDVVDLYL 127

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
                 K+                        E      Y+  N + I S  ++LA+K +
Sbjct: 128 AQTLEEKQG--------------------ETNEGAQMALYFYRNASKIDSVYDILADKTL 167

Query: 527 LNFLLESKGIDSQKVR------EDFLCEIF-KSDLKDPKSFANTYKDNRYKEIISSFNFD 579
           L  +  + G+               L +    +D KDP+   +     ++  +  S N +
Sbjct: 168 LKTVYTALGLSEYTAAMNIDKQASLLSKALDLNDFKDPQKLTSFIA--KFSTLYDSENNN 225

Query: 580 IHGELSHKKIGKVQDNFHIDDTCDL 604
              +      G    N  +  + DL
Sbjct: 226 TASDYVSALFGTSSSNGVVSFSVDL 250



 Score = 54.1 bits (128), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 63/176 (35%), Gaps = 16/176 (9%)

Query: 224 RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLS 283
              + T + I    S +   T     + S   YYK  I +++S  + + D KLF     +
Sbjct: 2   TSTLTTFLSISNNYSKWTEITAAEPSVASQTEYYKANIGNITSADELVGDYKLFSYALTA 61

Query: 284 LFPLNPEITADKFLTLMQENDPIVSQVKY----------FFQINFHRDNSSSTKIQQDSQ 333
            + L  E+ A      +         +                NF  + +S+T    D+ 
Sbjct: 62  -YGLGDEVYAKALYKKVLSEGTDKGSLSSKLGKLGVTELAKTFNFEENGTSTTT--SDAV 118

Query: 334 IQKMLDLYKKNC---QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSA 386
              ++DLY       +    ++   +   +     KI S+ ++L+ K  L+   +A
Sbjct: 119 QNDVVDLYLAQTLEEKQGETNEGAQMALYFYRNASKIDSVYDILADKTLLKTVYTA 174


>gi|149912827|ref|ZP_01901361.1| flagellar protein, putative [Roseobacter sp. AzwK-3b]
 gi|149813233|gb|EDM73059.1| flagellar protein, putative [Roseobacter sp. AzwK-3b]
          Length = 267

 Score =  190 bits (483), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 51/252 (20%), Positives = 93/252 (36%), Gaps = 24/252 (9%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            +M+           I+S+  Y+   I  I + EEL+ ++R+L   L + G+        
Sbjct: 20  ATMDAQRKAFDAGPRISSDTAYFEARIRDISTAEELVNDRRLLRVALGAFGLQDDIDSRF 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            + ++ +    DP + AN   D RYK++  +F F   G        + Q      D  DL
Sbjct: 80  LIRKVLEGGTADPDALANRLTDRRYKDLADAFGFGATGG------PETQSPGFGKDIVDL 133

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKL 656
           ++ +  E    E D  + LAL  +R +  + N           I+G   L KV    L L
Sbjct: 134 FRRRSFENAVGESDQGLRLALNAQRELAILANDTGQGDTGWLRIMGTPPLRKVFETALGL 193

Query: 657 SPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAA---KAMDHQSIDYKK 706
              FA L   +++ + K           +    D  + +  +        +   ++    
Sbjct: 194 PDGFAQLDLDRQLDVFKARAADRLGITDLRQLADEGERDKLVERFLLQDQIRGITVQSSS 253

Query: 707 ALFSSPNQNKDP 718
           A+  +  Q   P
Sbjct: 254 AIALTLLQAVQP 265



 Score =  134 bits (338), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 49/200 (24%), Positives = 78/200 (39%), Gaps = 10/200 (5%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
            + D Q K F      P +S +  Y+  RI+ IST +E + D+RL   AL AFGL D   
Sbjct: 20  ATMDAQRKAFDA---GPRISSDTAYFEARIRDISTAEELVNDRRLLRVALGAFGLQDDID 76

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQS 129
           +   I+K+LE   +DP +L N+L   +Y+  A ++ F                I D  + 
Sbjct: 77  SRFLIRKVLEGGTADPDALANRLTDRRYKDLADAFGFGATGGPETQSPGFGKDIVDLFRR 136

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
              +  V  E  +  R  ++    +  L  D    D          + +  P L+ V   
Sbjct: 137 RSFENAVG-ESDQGLRLALNAQRELAILANDTGQGDTGWL------RIMGTPPLRKVFET 189

Query: 190 GLANPKKYFIESRDNRFRAM 209
            L  P  +     D +    
Sbjct: 190 ALGLPDGFAQLDLDRQLDVF 209



 Score = 89.2 bits (219), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 31/173 (17%), Positives = 64/173 (36%), Gaps = 9/173 (5%)

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
           D ++           ++ YF   I  I++ ++L  DRRLL   L +F +     S   ++
Sbjct: 23  DAQRKAFDAGPRISSDTAYFEARIRDISTAEELVNDRRLLRVALGAFGLQDDIDSRFLIR 82

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNT 244
            VL  G A+P        D R++ +A+ F F   G    +        ++      F N 
Sbjct: 83  KVLEGGTADPDALANRLTDRRYKDLADAFGFGATGGPETQSPGFGKDIVDLFRRRSFENA 142

Query: 245 I-DCVPIVSDQNYYKLAINSV--------SSFSDFLKDPKLFKMLQLSLFPLN 288
           + +    +      +  +  +        + +   +  P L K+ + +L   +
Sbjct: 143 VGESDQGLRLALNAQRELAILANDTGQGDTGWLRIMGTPPLRKVFETALGLPD 195



 Score = 74.9 bits (182), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 54/279 (19%), Positives = 92/279 (32%), Gaps = 59/279 (21%)

Query: 334 IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           +   +D   +        ++ S    ++  +  I + + L++ +               L
Sbjct: 18  LNATMDA--QRKAFDAGPRISSDTAYFEARIRDISTAEELVNDRR-------------LL 62

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           + AL A+ L      R  +R VL    +DPD+ AN+  D R   L  AF F A G     
Sbjct: 63  RVALGAFGLQDDIDSRFLIRKVLEGGTADPDALANRLTDRRYKDLADAFGFGATGG---- 118

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
           P  QS    +D V  +  R+RS  +A       + +     R+ L    E+         
Sbjct: 119 PETQSPGFGKDIVDLF--RRRSFENA-------VGESDQGLRLALNAQRELA-------- 161

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKVREDF----LCEIFKSDLKDPKSFANTYKDNRY 569
                 +LAN           G              L ++F++ L  P  FA    D + 
Sbjct: 162 ------ILANDT---------GQGDTGWLRIMGTPPLRKVFETALGLPDGFAQLDLDRQL 206

Query: 570 KEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQ 608
                 F       L    + ++ D    D   + +  Q
Sbjct: 207 ----DVFKARAADRLGITDLRQLADEGERDKLVERFLLQ 241


>gi|158422870|ref|YP_001524162.1| hypothetical protein AZC_1246 [Azorhizobium caulinodans ORS 571]
 gi|158329759|dbj|BAF87244.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 303

 Score =  190 bits (481), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 56/206 (27%), Positives = 94/206 (45%), Gaps = 8/206 (3%)

Query: 492 TQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
             K     + +++ Y+  NI  + + +E + N R+ NF + + G+      + ++ ++  
Sbjct: 63  KTKAAEPIVKNDIAYFRANITKVKTVDEFVGNYRLFNFAMNAFGLSEMANAKAYMKKVLN 122

Query: 552 SDLKDPKSFANTYKDNRYKEIISSF-NFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMI 610
           SDL D  SF N   D+++K    +F N +    L+             DD    Y +Q I
Sbjct: 123 SDLSDSSSFVNKLADDKFKVFARAFSNLNPTNALTTVPATA-------DDVVGYYLNQSI 175

Query: 611 EKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIR 670
           E +  + D  + LALYFKR    I++ Y ILGD  L+KVV     L      +   ++ R
Sbjct: 176 ETELGQTDQGVQLALYFKRNAATIKSAYSILGDPALYKVVKTVFNLPDNMGKVDIAQQKR 235

Query: 671 ILKKHIKINDFKDSKKVEDFLYAAKA 696
           I+   + +ND +D  KV   L    A
Sbjct: 236 IVDAKLNVNDLQDPTKVNKLLQRFAA 261



 Score =  143 bits (359), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 51/207 (24%), Positives = 100/207 (48%), Gaps = 8/207 (3%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
            +       +   +    T + +PIV  +  Y+R  I  + T+DEF+ + RLF++A+ AF
Sbjct: 46  STFATYNYYQKNSAMALKTKAAEPIVKNDIAYFRANITKVKTVDEFVGNYRLFNFAMNAF 105

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSY-DFSPPPKVIQSDIQHKT 121
           GLS+M++A+ ++KK+L SDLSD  S VN+L   K++ FAR++ + +P   +         
Sbjct: 106 GLSEMANAKAYMKKVLNSDLSDSSSFVNKLADDKFKVFARAFSNLNPTNALTTVPATADD 165

Query: 122 IIQDY----KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           ++  Y     ++   + +  ++ + YF++N   I S   +  D  L   V   F++    
Sbjct: 166 VVGYYLNQSIETELGQTDQGVQLALYFKRNAATIKSAYSILGDPALYKVVKTVFNLPDNM 225

Query: 178 ISLPFLKDVLTLGLANPKKYFIESRDN 204
             +   +      + + K    + +D 
Sbjct: 226 GKVDIAQQ---KRIVDAKLNVNDLQDP 249



 Score =  101 bits (251), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 86/219 (39%), Gaps = 17/219 (7%)

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
             DP      +   ++   A + DF        +   +           +  E +   + 
Sbjct: 22  TQDPG--ATTMRWRRWGLSAMAIDFG----STFATYNYYQKNSAMALKTKAAEPIVKNDI 75

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
            YFR NI K+ +VD+   + RL ++ + +F ++    +  ++K VL   L++   +  + 
Sbjct: 76  AYFRANITKVKTVDEFVGNYRLFNFAMNAFGLSEMANAKAYMKKVLNSDLSDSSSFVNKL 135

Query: 202 RDNRFRAMAENF-RFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN----- 255
            D++F+  A  F    P  +L+       D     +V  Y N +I+     +DQ      
Sbjct: 136 ADDKFKVFARAFSNLNPTNALTTVPATADD-----VVGYYLNQSIETELGQTDQGVQLAL 190

Query: 256 YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
           Y+K    ++ S    L DP L+K+++      +     D
Sbjct: 191 YFKRNAATIKSAYSILGDPALYKVVKTVFNLPDNMGKVD 229



 Score = 73.4 bits (178), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 80/238 (33%), Gaps = 43/238 (18%)

Query: 336 KMLDLYKKNCQILHDDKMQ-----SLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPI 390
              + Y+KN  +    K       + I  ++  + K+K++D  +                
Sbjct: 49  ATYNYYQKNSAMALKTKAAEPIVKNDIAYFRANITKVKTVDEFVGN-------------Y 95

Query: 391 ITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAF-NFNADGS 449
               FA++A+ L+     +  ++ VL S+ SD  S+ NK  DD+      AF N N   +
Sbjct: 96  RLFNFAMNAFGLSEMANAKAYMKKVLNSDLSDSSSFVNKLADDKFKVFARAFSNLNPTNA 155

Query: 450 IGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTL 509
           +  +P         D V +Y N+       +                  +      Y+  
Sbjct: 156 LTTVPATAD-----DVVGYYLNQSIETELGQ----------------TDQGVQLALYFKR 194

Query: 510 NINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDN 567
           N  TI S   +L +  +   +     +     + D   +     + D K   N  +D 
Sbjct: 195 NAATIKSAYSILGDPALYKVVKTVFNLPDNMGKVDIAQQ---KRIVDAKLNVNDLQDP 249


>gi|114765258|ref|ZP_01444390.1| hypothetical protein 1100011001307_R2601_00475 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542393|gb|EAU45421.1| hypothetical protein R2601_00475 [Roseovarius sp. HTCC2601]
          Length = 274

 Score =  189 bits (479), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 89/209 (42%), Gaps = 4/209 (1%)

Query: 495 RINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDL 554
           R   +   E+ Y+  NI  + + E+L  + R+ +F++++  ++ Q   +  + ++ +SD+
Sbjct: 28  RNEPQHAREIAYFLDNIGNVENVEDLTEDYRLYSFVMKAYDLEDQIFGKAMMEKLLESDI 87

Query: 555 KDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKE 614
            D  +  N   D+R+K+  ++  F   G+ +   +             D Y        +
Sbjct: 88  NDSSALVNRLTDSRFKDFHNAMGFGPEGQGNLNTLDASWKAA----VVDKYVDTQYVNGK 143

Query: 615 EEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKK 674
            +++  I   L F+R   +I + Y+IL DS L +       L    A +   ++  I+  
Sbjct: 144 GDENEAIGTVLEFRRKAGSINSAYDILRDSDLSEFFRTAFGLPEALAGIDIDRQAAIIND 203

Query: 675 HIKINDFKDSKKVEDFLYAAKAMDHQSID 703
            + +    D   V+D +    A+   + D
Sbjct: 204 RLDLETLSDPDVVDDLVRRYVAISDATSD 232



 Score =  145 bits (366), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 51/272 (18%), Positives = 108/272 (39%), Gaps = 18/272 (6%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + S VA       + K    +  +P  + E  Y+ + I ++  +++  +D RL+S+ +KA
Sbjct: 7   MSSSVALQLVNATEDKDQELIRNEPQHAREIAYFLDNIGNVENVEDLTEDYRLYSFVMKA 66

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH-- 119
           + L D    +  ++K+LESD++D  +LVN+L   +++ F  +  F P  +   + +    
Sbjct: 67  YDLEDQIFGKAMMEKLLESDINDSSALVNRLTDSRFKDFHNAMGFGPEGQGNLNTLDASW 126

Query: 120 -----KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
                   +     + +  E  A+     FR+    INS   + +D  L ++   +F + 
Sbjct: 127 KAAVVDKYVDTQYVNGKGDENEAIGTVLEFRRKAGSINSAYDILRDSDLSEFFRTAFGLP 186

Query: 175 PKYISLPFLKDVLTLG-------LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKI 227
                +   +    +        L++P    ++    R+ A+++        + S     
Sbjct: 187 EALAGIDIDRQAAIINDRLDLETLSDPD--VVDDLVRRYVAISDA--TSDIATSSNAAVT 242

Query: 228 LTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKL 259
           L    +     +Y   TID   I     Y   
Sbjct: 243 LLSGALSAASGSYIPATIDIDAIQGFSGYKAR 274



 Score = 73.7 bits (179), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/210 (16%), Positives = 62/210 (29%), Gaps = 27/210 (12%)

Query: 373 LLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKD 432
            L     +E      E      F + AY+L  Q   +  +  +L S+ +D  +  N+  D
Sbjct: 40  FLDNIGNVENVEDLTEDYRLYSFVMKAYDLEDQIFGKAMMEKLLESDINDSSALVNRLTD 99

Query: 433 DRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQIST 492
            R    ++A  F  +G        Q  L   D     A   + +            +   
Sbjct: 100 SRFKDFHNAMGFGPEG--------QGNLNTLDASWKAAVVDKYVDTQYVNGKGDENEAIG 151

Query: 493 QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIF-- 550
                      V  +     +I+S  ++L +  +  F   + G+       D   +    
Sbjct: 152 T----------VLEFRRKAGSINSAYDILRDSDLSEFFRTAFGLPEALAGIDIDRQAAII 201

Query: 551 -----KSDLKDPKSFANTYKDNRYKEIISS 575
                   L DP    +     RY  I  +
Sbjct: 202 NDRLDLETLSDPDVVDDLV--RRYVAISDA 229



 Score = 41.8 bits (96), Expect = 0.39,   Method: Composition-based stats.
 Identities = 32/234 (13%), Positives = 74/234 (31%), Gaps = 24/234 (10%)

Query: 223 KRDKILTDMQIEKIVSNYFNNTIDCVPI-VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQ 281
                   +Q+     +     I   P    +  Y+   I +V +  D  +D +L+  + 
Sbjct: 5   AGMSSSVALQLVNATEDKDQELIRNEPQHAREIAYFLDNIGNVENVEDLTEDYRLYSFV- 63

Query: 282 LSLFPLNPEITADKFLTLMQENDPIVSQV-----------KYFFQINFHRDNSSSTKIQQ 330
           +  + L  +I     +  + E+D   S              +   + F  +   +     
Sbjct: 64  MKAYDLEDQIFGKAMMEKLLESDINDSSALVNRLTDSRFKDFHNAMGFGPEGQGNLNTLD 123

Query: 331 DSQIQKMLDLY-KKNCQILHDDKMQS--LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAE 387
            S    ++D Y          D+ ++   + +++   G I S  ++L      E   +A 
Sbjct: 124 ASWKAAVVDKYVDTQYVNGKGDENEAIGTVLEFRRKAGSINSAYDILRDSDLSEFFRTAF 183

Query: 388 EPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHA 441
                L        +++          +     SDPD   +  +  R + ++ A
Sbjct: 184 GLPEALA------GIDIDRQAAIINDRLDLETLSDPDVVDDLVR--RYVAISDA 229


>gi|89068718|ref|ZP_01156104.1| hypothetical protein OG2516_06756 [Oceanicola granulosus HTCC2516]
 gi|89045681|gb|EAR51743.1| hypothetical protein OG2516_06756 [Oceanicola granulosus HTCC2516]
          Length = 274

 Score =  187 bits (475), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 37/195 (18%), Positives = 81/195 (41%), Gaps = 4/195 (2%)

Query: 501 NSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSF 560
              +D +   +  I + E+LLA++ +  F++ +  ++ Q   +  + ++ + D+ D K+ 
Sbjct: 34  ARAIDTFRERVGGIETVEDLLADQDVYAFVMRAYDLEDQIFGKALVGKVLEGDITDSKAL 93

Query: 561 ANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPN 620
            N   D R +E+ +   F   G  +   +             D Y  Q     + +++  
Sbjct: 94  INRLTDPRMRELYTGLGFTEGGTKNANTLDPAWQEA----MVDRYVEQHFINAQADQNAT 149

Query: 621 IALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIND 680
           + +AL F+R  P I    ++L D+ L  ++   L +    A L   K+  +  +   I  
Sbjct: 150 VGVALEFRRAAPEISTWMDVLKDADLSTLMRTALGVPSSVAQLDIDKQAELFARKFDITK 209

Query: 681 FKDSKKVEDFLYAAK 695
            +D  +VE  +    
Sbjct: 210 LQDPAEVEKLVRKYA 224



 Score =  124 bits (312), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 75/184 (40%), Gaps = 10/184 (5%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
            ++D Q      +      +     +RER+  I T+++ + D+ ++++ ++A+ L D   
Sbjct: 18  ATRDQQ---LEMIGSSTRHARAIDTFRERVGGIETVEDLLADQDVYAFVMRAYDLEDQIF 74

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP-------KVIQSDIQHKTI 122
            +  + K+LE D++D K+L+N+L   + +       F+               +      
Sbjct: 75  GKALVGKVLEGDITDSKALINRLTDPRMRELYTGLGFTEGGTKNANTLDPAWQEAMVDRY 134

Query: 123 IQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
           ++ +  + Q  +   +  +  FR+   +I++   + KD  L   +  +  +      L  
Sbjct: 135 VEQHFINAQADQNATVGVALEFRRAAPEISTWMDVLKDADLSTLMRTALGVPSSVAQLDI 194

Query: 183 LKDV 186
            K  
Sbjct: 195 DKQA 198



 Score = 89.5 bits (220), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/189 (15%), Positives = 66/189 (34%), Gaps = 3/189 (1%)

Query: 109 PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVL 168
                 + ++     +D +                FR+ +  I +V+ L  D+ +  +V+
Sbjct: 5   TGLATPAALKLVDATRDQQLEMIGSSTRHARAIDTFRERVGGIETVEDLLADQDVYAFVM 64

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD--- 225
           +++ +  +      +  VL   + + K       D R R +     F   G+ +      
Sbjct: 65  RAYDLEDQIFGKALVGKVLEGDITDSKALINRLTDPRMRELYTGLGFTEGGTKNANTLDP 124

Query: 226 KILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
                M    +  ++ N   D    V     ++ A   +S++ D LKD  L  +++ +L 
Sbjct: 125 AWQEAMVDRYVEQHFINAQADQNATVGVALEFRRAAPEISTWMDVLKDADLSTLMRTALG 184

Query: 286 PLNPEITAD 294
             +     D
Sbjct: 185 VPSSVAQLD 193



 Score = 68.7 bits (166), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 33/220 (15%), Positives = 73/220 (33%), Gaps = 38/220 (17%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
            I    +    I  ++  +G I+++++LL+ +                 F + AY+L  Q
Sbjct: 26  MIGSSTRHARAIDTFRERVGGIETVEDLLADQ-------------DVYAFVMRAYDLEDQ 72

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +  VL  + +D  +  N+  D R+ +L     F   G+     +          
Sbjct: 73  IFGKALVGKVLEGDITDSKALINRLTDPRMRELYTGLGFTEGGTKNANTL--DPAWQEAM 130

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
           V  Y  +      A+  +   +     +                    I ++ ++L +  
Sbjct: 131 VDRYVEQHFINAQADQNATVGVALEFRRAAPE----------------ISTWMDVLKDAD 174

Query: 526 ILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPK 558
           +   +  + G       +D  K  E F  +   + L+DP 
Sbjct: 175 LSTLMRTALGVPSSVAQLDIDKQAELFARKFDITKLQDPA 214


>gi|218528724|ref|YP_002419540.1| hypothetical protein Mchl_0691 [Methylobacterium chloromethanicum
           CM4]
 gi|218521027|gb|ACK81612.1| protein of unknown function DUF1217 [Methylobacterium
           chloromethanicum CM4]
          Length = 417

 Score =  185 bits (470), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 78/403 (19%), Positives = 133/403 (33%), Gaps = 60/403 (14%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             +  +      Y+  +G++KS+D+LL  +                 +A+ AY L     
Sbjct: 23  AAEPTVARETAYYEAHIGQVKSVDDLLGDQR-------------LYAYAMKAYGLEDMTY 69

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R VL    +   S+AN+  DDR      AF+F            Q       +  
Sbjct: 70  AKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPA 118

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI- 526
            +  + R+   +  K        S +   +  + S +D  T    TI    + LA +   
Sbjct: 119 RFGEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVAN 178

Query: 527 ---------------LNFLLESKGIDSQKVRED---FLCEIFKSDLKDPKSFANT--YKD 566
                                 KG     +  D   F      +DL    ++  T  Y D
Sbjct: 179 PAKVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYAD 238

Query: 567 NRYKEIISSFNFDIHGELSHKKIGKVQDNFHID--------DTCDLYKHQMIEKKEEEKD 618
                  S+    I           V   F  D             Y  Q +E +  + D
Sbjct: 239 TLVNAGGSNRTLTIRNAALSANRTAVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDAD 298

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP---ERKKIRILKKH 675
             + LALYF R    I + Y+ILGD+ L +V +  + L             K+ +++   
Sbjct: 299 TGVRLALYFARKASTIASAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIAGK 358

Query: 676 IKINDFKDSKKVEDFLYAA----KAMDHQSIDYKKALFSSPNQ 714
           I I  F+D  K++ F+        A ++ +     ALF+    
Sbjct: 359 IDIASFRDPAKLDAFVRRFAAIWDAQNNTASAPILALFTGTGS 401



 Score =  136 bits (342), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 114/345 (33%), Gaps = 50/345 (14%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  +  +            S  + +P V+ E  YY   I  + ++D+ + D+RL++YA+K
Sbjct: 1   MTDTLTSYRLIAKDLPASLSRKAAEPTVARETAYYEAHIGQVKSVDDLLGDQRLYAYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDI--- 117
           A+GL DM++A+ F++K+LE   +   S  N+L   +Y  FA+++ F        +D    
Sbjct: 61  AYGLEDMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPARF 120

Query: 118 --QHKTIIQDYKQSHQHKEEVALEESKYF----RKNIHKINSVDQLFKDRRLLDYVLQSF 171
             Q +       +      + +      F    R +     SV      + L   V    
Sbjct: 121 GEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVANPA 180

Query: 172 SITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK-------- 223
            +TP  I+      +    L    +  + +  + F           DG+           
Sbjct: 181 KVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYADTL 240

Query: 224 ----------------------------RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN 255
                                          +  D   + +   Y   +++     +D  
Sbjct: 241 VNAGGSNRTLTIRNAALSANRTAVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDADTG 300

Query: 256 -----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADK 295
                Y+    ++++S  D L D  L ++    +        A  
Sbjct: 301 VRLALYFARKASTIASAYDILGDAALSQVANTVIGLPATSGAATS 345



 Score = 99.2 bits (245), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 45/97 (46%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
             +    ++K     +  E  YY  +I  + S ++LL ++R+  + +++ G++     + 
Sbjct: 13  KDLPASLSRKAAEPTVARETAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEDMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
           F+ ++ +       SFAN   D+RY     +F+F   
Sbjct: 73  FMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQG 109


>gi|254559265|ref|YP_003066360.1| hypothetical protein METDI0661 [Methylobacterium extorquens DM4]
 gi|254266543|emb|CAX22307.1| hypothetical protein METDI0661 [Methylobacterium extorquens DM4]
          Length = 417

 Score =  185 bits (469), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 76/393 (19%), Positives = 131/393 (33%), Gaps = 60/393 (15%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              Y+  +G++K++D+LL  +                 +A+ AY L      +  +R VL
Sbjct: 32  TAYYEAHIGQVKTVDDLLGDQR-------------LYAYAMKAYGLEEMTYAKAFMRKVL 78

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSI 476
               +   S+AN+  DDR      AF+F            Q       +   +  + R+ 
Sbjct: 79  EEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPARFGEQARAA 127

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI---------- 526
             +  K        S +   +  + S +D  T    TI    + LA +            
Sbjct: 128 SLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVANPAKVTPAEI 187

Query: 527 ------LNFLLESKGIDSQKVRED---FLCEIFKSDLKDPKSFANT--YKDNRYKEIISS 575
                        KG     +  D   F      +DL    ++  T  Y D       S+
Sbjct: 188 AAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYADTLVNAGGSN 247

Query: 576 FNFDIHGELSHKKIGKVQDNFHID--------DTCDLYKHQMIEKKEEEKDPNIALALYF 627
               I           V   F  D             Y  Q +E +  + D  + LALYF
Sbjct: 248 RTLTIRNAALSANRTAVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDADTGVRLALYF 307

Query: 628 KRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP---ERKKIRILKKHIKINDFKDS 684
            R    + + Y+ILGD+ L +V +  + L             K+ +++   I I  F+D 
Sbjct: 308 ARKASTLTSAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIAGKIDIASFRDP 367

Query: 685 KKVEDFLYAA----KAMDHQSIDYKKALFSSPN 713
            K++ F+        A ++ +     ALF+   
Sbjct: 368 AKLDAFVRRFAAIWDAQNNTASAPILALFTGTG 400



 Score =  136 bits (343), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 57/345 (16%), Positives = 115/345 (33%), Gaps = 50/345 (14%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  +  +            S  + +P+V+ E  YY   I  + T+D+ + D+RL++YA+K
Sbjct: 1   MTDTLTSYRLIAKDLPASLSRKAAEPMVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDI--- 117
           A+GL +M++A+ F++K+LE   +   S  N+L   +Y  FA+++ F        +D    
Sbjct: 61  AYGLEEMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPARF 120

Query: 118 --QHKTIIQDYKQSHQHKEEVALEESKYF----RKNIHKINSVDQLFKDRRLLDYVLQSF 171
             Q +       +      + +      F    R +     SV      + L   V    
Sbjct: 121 GEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVANPA 180

Query: 172 SITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK-------- 223
            +TP  I+      +    L    +  + +  + F           DG+           
Sbjct: 181 KVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYADTL 240

Query: 224 ----------------------------RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN 255
                                          +  D   + +   Y   +++     +D  
Sbjct: 241 VNAGGSNRTLTIRNAALSANRTAVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDADTG 300

Query: 256 -----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADK 295
                Y+    ++++S  D L D  L ++    +        A  
Sbjct: 301 VRLALYFARKASTLTSAYDILGDAALSQVANTVIGLPATSGAATS 345



 Score = 98.0 bits (242), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 45/97 (46%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
             +    ++K     +  E  YY  +I  + + ++LL ++R+  + +++ G++     + 
Sbjct: 13  KDLPASLSRKAAEPMVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMKAYGLEEMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
           F+ ++ +       SFAN   D+RY     +F+F   
Sbjct: 73  FMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQG 109


>gi|240137254|ref|YP_002961723.1| hypothetical protein MexAM1_META1p0505 [Methylobacterium extorquens
           AM1]
 gi|240007220|gb|ACS38446.1| hypothetical protein MexAM1_META1p0505 [Methylobacterium extorquens
           AM1]
          Length = 417

 Score =  184 bits (467), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 76/403 (18%), Positives = 133/403 (33%), Gaps = 60/403 (14%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             +  +   I  Y+  +G++KS+D+LL  +                 +A+ AY L     
Sbjct: 23  AAEPTVAREIAYYEAHIGQVKSVDDLLGDQR-------------LYAYAMKAYGLEDMTY 69

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R VL    +   S+AN+  DDR      AF+F            Q       +  
Sbjct: 70  AKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPA 118

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI- 526
            +  + R+   +  K        S +   +  + S +D  T    TI    + LA +   
Sbjct: 119 RFGEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGQVAN 178

Query: 527 ---------------LNFLLESKGIDSQKVRED---FLCEIFKSDLKDPKSF--ANTYKD 566
                                 KG     +  D   F      +DL    ++       D
Sbjct: 179 PAKVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGRDAD 238

Query: 567 NRYKEIISSFNFDIHGELSHKKIGKVQDNFHID--------DTCDLYKHQMIEKKEEEKD 618
                   +    I           V   F  D             Y  Q +E +  + D
Sbjct: 239 TLVNAGGPNRTLTIRNAPLSANRTAVDVGFGTDLGPDSMAQAVTQAYLRQSLESEAGDAD 298

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP---ERKKIRILKKH 675
             + LALYF R   +I + Y+ILGD+ L +V +  + L             K+ +++ + 
Sbjct: 299 TGVRLALYFARKASSIASAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIDRK 358

Query: 676 IKINDFKDSKKVEDFLYAA----KAMDHQSIDYKKALFSSPNQ 714
           I I  F+D  K++ F+        A ++ +     ALF+    
Sbjct: 359 IDIASFRDPAKLDAFVRRFAAIWDAQNNTASAPILALFTGTGS 401



 Score =  137 bits (344), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 65/396 (16%), Positives = 132/396 (33%), Gaps = 55/396 (13%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  +  +            S  + +P V+ E  YY   I  + ++D+ + D+RL++YA+K
Sbjct: 1   MTDTLTSYRLIAKDLPASLSRKAAEPTVAREIAYYEAHIGQVKSVDDLLGDQRLYAYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDI--- 117
           A+GL DM++A+ F++K+LE   +   S  N+L   +Y  FA+++ F        +D    
Sbjct: 61  AYGLEDMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPARF 120

Query: 118 --QHKTIIQDYKQSHQHKEEVALEESKYF----RKNIHKINSVDQLFKDRRLLDYVLQSF 171
             Q +       +      + +      F    R +     SV      + L   V    
Sbjct: 121 GEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGQVANPA 180

Query: 172 SITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK-------- 223
            +TP  I+      +    L    +  + +  + F           DG+           
Sbjct: 181 KVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGRDADTL 240

Query: 224 ----------------------------RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN 255
                                          +  D   + +   Y   +++     +D  
Sbjct: 241 VNAGGPNRTLTIRNAPLSANRTAVDVGFGTDLGPDSMAQAVTQAYLRQSLESEAGDADTG 300

Query: 256 -----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFP--LNPEITADKFLTLMQENDPIVS 308
                Y+    +S++S  D L D  L ++    +     +   T++      Q  D  + 
Sbjct: 301 VRLALYFARKASSIASAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIDRKID 360

Query: 309 QVKY---FFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
              +        F R  ++    Q ++    +L L+
Sbjct: 361 IASFRDPAKLDAFVRRFAAIWDAQNNTASAPILALF 396



 Score = 99.2 bits (245), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 46/97 (47%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
             +    ++K     +  E+ YY  +I  + S ++LL ++R+  + +++ G++     + 
Sbjct: 13  KDLPASLSRKAAEPTVAREIAYYEAHIGQVKSVDDLLGDQRLYAYAMKAYGLEDMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
           F+ ++ +       SFAN   D+RY     +F+F   
Sbjct: 73  FMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQG 109


>gi|188579922|ref|YP_001923367.1| hypothetical protein Mpop_0654 [Methylobacterium populi BJ001]
 gi|179343420|gb|ACB78832.1| protein of unknown function DUF1217 [Methylobacterium populi BJ001]
          Length = 417

 Score =  184 bits (467), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 73/402 (18%), Positives = 132/402 (32%), Gaps = 60/402 (14%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             +  +      Y+  +G++K++D+LL  +                 +A+ AY L     
Sbjct: 23  AAEPTVARETAYYEAHIGQVKTVDDLLGDQR-------------LYAYAMKAYGLEEMTY 69

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R VL    +   S+AN+  DDR      AF+F            Q       +  
Sbjct: 70  AKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVSATGADAA 118

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR-- 525
            +  R R+   +  K        S +   +  + S +D  T    TI    + LA +   
Sbjct: 119 RFGERARAATLSAPKLLADAYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVQD 178

Query: 526 -----------ILNFLLESKGIDSQ------KVREDFLCEIFKSDLKDPKSFANTY--KD 566
                       +   +E   +  +           F      +DL    ++  +    D
Sbjct: 179 LSKVTPSEIATAVAAQIEGSDLKGKVQAGLAADGSLFFETTALTDLGADGAYGGSGLNAD 238

Query: 567 NRYKEIISSFNFDIHGELSHKKIGKVQDNFHID--------DTCDLYKHQMIEKKEEEKD 618
                  +     I           V   F  D             Y  Q +E    + D
Sbjct: 239 TLVSAGGAIRTLAIRNVPLSADRTAVDVGFGTDLGPDTMALTVTQAYLRQSLESDAGDTD 298

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP---ERKKIRILKKH 675
             + LALYF R  P++ + Y+ILGD+ L +V +  + L             K+ +++   
Sbjct: 299 TGVRLALYFARKGPSLSSAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIADK 358

Query: 676 IKINDFKDSKKVEDFLYAA----KAMDHQSIDYKKALFSSPN 713
           I I   +D  K++ FL        A ++ +     ALF+   
Sbjct: 359 IDIAGLRDPAKLDAFLRRFAAIWDAQNNTASAPVLALFTGAG 400



 Score =  141 bits (356), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 67/418 (16%), Positives = 133/418 (31%), Gaps = 53/418 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  +  +            +  + +P V+ E  YY   I  + T+D+ + D+RL++YA+K
Sbjct: 1   MTDTLTSYRLIAKDLPASLARKAAEPTVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH- 119
           A+GL +M++A+ F++K+LE   +   S  N+L   +Y  FA+++ F        +D    
Sbjct: 61  AYGLEEMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVSATGADAARF 120

Query: 120 ----KTIIQDYKQSHQHKEEVALEESKYF----RKNIHKINSVDQLFKDRRLLDYVLQSF 171
               +       +      + +      F    R +     SV      + L   V    
Sbjct: 121 GERARAATLSAPKLLADAYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVQDLS 180

Query: 172 SITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGS----------- 220
            +TP  I+      +    L    +  + +  + F           DG+           
Sbjct: 181 KVTPSEIATAVAAQIEGSDLKGKVQAGLAADGSLFFETTALTDLGADGAYGGSGLNADTL 240

Query: 221 LSKRDKILT-------------------------DMQIEKIVSNYFNNTIDCVPIVSDQN 255
           +S    I T                         D     +   Y   +++     +D  
Sbjct: 241 VSAGGAIRTLAIRNVPLSADRTAVDVGFGTDLGPDTMALTVTQAYLRQSLESDAGDTDTG 300

Query: 256 -----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQV 310
                Y+     S+SS  D L D  L   +  ++  L     A     L +    I  ++
Sbjct: 301 VRLALYFARKGPSLSSAYDILGDAAL-SQVANTVIGLPATSGAATSEALAKRAQLIADKI 359

Query: 311 KYFFQINFHRDNSSSTKIQ--QDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
                 +  + ++   +     D+Q                    + L+      +G 
Sbjct: 360 DIAGLRDPAKLDAFLRRFAAIWDAQNNTASAPVLALFTGAGGIDAELLLNRQTARIGA 417



 Score =  100 bits (248), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 19/117 (16%), Positives = 47/117 (40%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
             +     +K     +  E  YY  +I  + + ++LL ++R+  + +++ G++     + 
Sbjct: 13  KDLPASLARKAAEPTVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMKAYGLEEMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDT 601
           F+ ++ +       SFAN   D+RY     +F+F      +     +  +       
Sbjct: 73  FMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVSATGADAARFGERARAATL 129


>gi|85706198|ref|ZP_01037293.1| flagellar protein, putative [Roseovarius sp. 217]
 gi|85669362|gb|EAQ24228.1| flagellar protein, putative [Roseovarius sp. 217]
          Length = 267

 Score =  184 bits (467), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 48/232 (20%), Positives = 98/232 (42%), Gaps = 21/232 (9%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           + E+ S     + +I  + DY+   I  I + E+L++++R+L   L + G+        F
Sbjct: 21  TFERQSDLFNKSPQIVRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAFGLQEDIDSRAF 80

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           +  I +    +  S AN   D+RYK++  +F F      + + I + Q +    +  + +
Sbjct: 81  IRAILEGGTINEDSLANRLADDRYKQLAEAFAF------ADRPIPRTQLSTFGSEITEKF 134

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLS 657
           + +  E    ++D ++ LAL  +R + +I           + ILG++ L +V    L L 
Sbjct: 135 RRREFEVAVGDQDQSLRLALNARRELGDIAGDDAAEDTRWFRILGNTPLRRVFEVALGLP 194

Query: 658 PYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQSI 702
             FA     +++  +K           ++D  D+   E  L      D  + 
Sbjct: 195 ESFAQADLDRQLDEIKSRAARQLNIGSLSDLADTDVQEQLLRRFLLRDQMAS 246



 Score =  124 bits (311), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 43/213 (20%), Positives = 83/213 (38%), Gaps = 21/213 (9%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
            +K P +  +  Y+ + I  I+T ++ + D+RL   AL AFGL +   +  FI+ ILE  
Sbjct: 29  FNKSPQIVRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAFGLQEDIDSRAFIRAILEGG 88

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQ-----HKEEV 136
             +  SL N+L   +Y+  A ++ F+  P          + I +  +  +       ++ 
Sbjct: 89  TINEDSLANRLADDRYKQLAEAFAFADRPIPRTQLSTFGSEITEKFRRREFEVAVGDQDQ 148

Query: 137 ALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKK 196
           +L  +   R+ +  I   D   +D R             + +    L+ V  + L  P+ 
Sbjct: 149 SLRLALNARRELGDIA-GDDAAEDTRWF-----------RILGNTPLRRVFEVALGLPES 196

Query: 197 YFIESRDNRFRAM----AENFRFQPDGSLSKRD 225
           +     D +   +    A          L+  D
Sbjct: 197 FAQADLDRQLDEIKSRAARQLNIGSLSDLADTD 229



 Score = 86.1 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/175 (19%), Positives = 68/175 (38%), Gaps = 15/175 (8%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
           +K    + ++ YF + I KI + + L  DRRLL   L +F +     S  F++ +L  G 
Sbjct: 30  NKSPQIVRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAFGLQEDIDSRAFIRAILEGGT 89

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQ----PDGSLSKRDKILTDMQIEKIVSNYFNNTIDC 247
            N         D+R++ +AE F F     P   LS     +T+    +       +    
Sbjct: 90  INEDSLANRLADDRYKQLAEAFAFADRPIPRTQLSTFGSEITEKFRRREFEVAVGDQDQS 149

Query: 248 VPIVSDQNYYKLAINSV--------SSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
           + +  +    +  +  +        + +   L +  L ++ +++L        AD
Sbjct: 150 LRLALNA---RRELGDIAGDDAAEDTRWFRILGNTPLRRVFEVALGLPESFAQAD 201



 Score = 68.0 bits (164), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 32/196 (16%), Positives = 63/196 (32%), Gaps = 26/196 (13%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              ++  +GKI + ++L+S +               L+ AL A+ L      R  +R +L
Sbjct: 39  TDYFEQTIGKITTAEDLVSDRR-------------LLRVALGAFGLQEDIDSRAFIRAIL 85

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSI 476
                + DS AN+  DDR  +L  AF F AD  I    +      I +  +         
Sbjct: 86  EGGTINEDSLANRLADDRYKQLAEAFAF-ADRPIPRTQLSTFGSEITEKFRRREFEVAVG 144

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI 536
              ++       +         +   +  ++            +L N  +      + G+
Sbjct: 145 DQDQSLRLALNARRELGDIAGDDAAEDTRWFR-----------ILGNTPLRRVFEVALGL 193

Query: 537 DSQKVREDFLCEIFKS 552
             +   +  L      
Sbjct: 194 -PESFAQADLDRQLDE 208



 Score = 42.2 bits (97), Expect = 0.36,   Method: Composition-based stats.
 Identities = 32/202 (15%), Positives = 65/202 (32%), Gaps = 23/202 (11%)

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
             + +      +       IV D +Y++  I  +++  D + D +L ++  L  F L  +
Sbjct: 16  ALLARTFERQSDLFNKSPQIVRDTDYFEQTIGKITTAEDLVSDRRLLRV-ALGAFGLQED 74

Query: 291 ITADKFLTLMQEN-------------DPIVSQVKYFFQINFHRDNSSSTKIQQ-DSQIQK 336
           I +  F+  + E              D    Q+   F   F       T++    S+I +
Sbjct: 75  IDSRAFIRAILEGGTINEDSLANRLADDRYKQLAEAFA--FADRPIPRTQLSTFGSEITE 132

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
                +    +   D+   L  + +  LG I   D+            +     +  + A
Sbjct: 133 KFRRREFEVAVGDQDQSLRLALNARRELGDIAG-DDAAEDTRWFRILGNTPLRRV-FEVA 190

Query: 397 LDAYNLNMQDLDRDQLRNVLTS 418
           L    L  +   +  L   L  
Sbjct: 191 L---GL-PESFAQADLDRQLDE 208


>gi|209967005|ref|YP_002299920.1| flagellar basal-body rod protein FlgF, putative [Rhodospirillum
           centenum SW]
 gi|209960471|gb|ACJ01108.1| flagellar basal-body rod protein FlgF, putative [Rhodospirillum
           centenum SW]
          Length = 259

 Score =  183 bits (465), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 61/219 (27%), Positives = 95/219 (43%), Gaps = 8/219 (3%)

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
                N      +   T+ R    +   ++ +   I  I S E LL ++R L F+L S  
Sbjct: 7   ATVTYNILKKQGDTAVTRYRDQKTVEKTINDFKTRIEKIDSPEALLKDRRALEFVLTSFQ 66

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           ++S+  +   L ++   D  + KS AN   D RY ++ +S        LS K     Q+ 
Sbjct: 67  LESEIGKTGILRKLLTEDPTEEKSLANRLVDPRYTKLATS--------LSGKIPEAFQNE 118

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
             ++   + Y     EK   E +  +  ALYFKR I N+ +  +IL D  L  VV K L 
Sbjct: 119 SFVNGLINNYVTNTFEKSVGEGNTGLREALYFKRNIANVTSVSQILADRALSYVVRKGLN 178

Query: 656 LSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAA 694
           L   FA+    ++ R L+K + +  FKD   VE F    
Sbjct: 179 LPDSFAMQDFDQQKRYLEKKLDLTKFKDPGYVEKFTQRF 217



 Score =  124 bits (311), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 77/188 (40%), Gaps = 5/188 (2%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + + V     K       +       V      ++ RI+ I + +  +KD+R   + L +
Sbjct: 5   LGATVTYNILKKQGDTAVTRYRDQKTVEKTINDFKTRIEKIDSPEALLKDRRALEFVLTS 64

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKT 121
           F L         ++K+L  D ++ KSL N+L   +Y   A S      P+  Q++     
Sbjct: 65  FQLESEIGKTGILRKLLTEDPTEEKSLANRLVDPRYTKLATSLS-GKIPEAFQNESFVNG 123

Query: 122 IIQDYKQSH----QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           +I +Y  +       +    L E+ YF++NI  + SV Q+  DR L   V +  ++   +
Sbjct: 124 LINNYVTNTFEKSVGEGNTGLREALYFKRNIANVTSVSQILADRALSYVVRKGLNLPDSF 183

Query: 178 ISLPFLKD 185
               F + 
Sbjct: 184 AMQDFDQQ 191



 Score = 83.4 bits (204), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 72/172 (41%), Gaps = 3/172 (1%)

Query: 124 QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
            D   +    ++   +    F+  I KI+S + L KDRR L++VL SF +  +      L
Sbjct: 18  GDTAVTRYRDQKTVEKTINDFKTRIEKIDSPEALLKDRRALEFVLTSFQLESEIGKTGIL 77

Query: 184 KDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNN 243
           + +LT      K       D R+  +A +         + +++   +  I   V+N F  
Sbjct: 78  RKLLTEDPTEEKSLANRLVDPRYTKLATSL--SGKIPEAFQNESFVNGLINNYVTNTFEK 135

Query: 244 TI-DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
           ++ +    + +  Y+K  I +V+S S  L D  L  +++  L   +     D
Sbjct: 136 SVGEGNTGLREALYFKRNIANVTSVSQILADRALSYVVRKGLNLPDSFAMQD 187



 Score = 76.8 bits (187), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 38/220 (17%), Positives = 77/220 (35%), Gaps = 29/220 (13%)

Query: 354 QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLR 413
            + +  Y+      K+I++  +   +++ P +  +    L+F L ++ L  +      LR
Sbjct: 19  DTAVTRYRDQKTVEKTINDFKTRIEKIDSPEALLKDRRALEFVLTSFQLESEIGKTGILR 78

Query: 414 NVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRK 473
            +LT +P++  S AN+  D R  KL  +      G I      Q+   +   + +Y    
Sbjct: 79  KLLTEDPTEEKSLANRLVDPRYTKLATSL----SGKI--PEAFQNESFVNGLINNYVTN- 131

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
                                        E  Y+  NI  + S  ++LA++ +   + + 
Sbjct: 132 ---------------TFEKSVGEGNTGLREALYFKRNIANVTSVSQILADRALSYVVRKG 176

Query: 534 KGIDSQKVREDF--LCEIFKSDLKDPKSFANTYKDNRYKE 571
             +      +DF       +  L         +KD  Y E
Sbjct: 177 LNLPDSFAMQDFDQQKRYLEKKLD-----LTKFKDPGYVE 211


>gi|158422871|ref|YP_001524163.1| hypothetical protein AZC_1247 [Azorhizobium caulinodans ORS 571]
 gi|158329760|dbj|BAF87245.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 295

 Score =  183 bits (465), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 57/240 (23%), Positives = 101/240 (42%), Gaps = 15/240 (6%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            + +    Q+    E+  +  YY  NI ++ S ++ + N R+LN+ + + G+  +   + 
Sbjct: 47  KNSDTALKQEAAQPEVARDTAYYEANIGSVTSVDDFVNNYRLLNYAMTAYGLSDETNAKA 106

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSF-NFDIHGELSHKKIGKVQDNFHIDDTCD 603
            + ++  SDL D  S      D RY  +  +F N + +   +       Q         +
Sbjct: 107 LVKQVLSSDLSDSSSLVYKLNDQRYLNLAKAFANLNPNDSAASYTAATTQQ------VVN 160

Query: 604 LYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVL 663
            Y  Q +E    ++D    LALYF+R   NI + Y ILGDS+L+KVV     L      +
Sbjct: 161 SYLEQQLENDVGQQDEGTQLALYFQRNAANITSGYSILGDSQLWKVVQTVYDLPESLGSI 220

Query: 664 PERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSF 723
              ++  +++  + I D +D  KV   L    A+   +         S   + DP    F
Sbjct: 221 DINQQKDLVESKVNIADLQDPTKVSALLDRFSAVWDATN--------SSAASSDPVLELF 272



 Score =  132 bits (331), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 50/231 (21%), Positives = 97/231 (41%), Gaps = 10/231 (4%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
            +                  +  P V+ +  YY   I  ++++D+F+ + RL +YA+ A+
Sbjct: 37  STFATFNYYSKNSDTALKQEAAQPEVARDTAYYEANIGSVTSVDDFVNNYRLLNYAMTAY 96

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQ--HK 120
           GLSD ++A+  +K++L SDLSD  SLV +LN  +Y   A+++    P     S      +
Sbjct: 97  GLSDETNAKALVKQVLSSDLSDSSSLVYKLNDQRYLNLAKAFANLNPNDSAASYTAATTQ 156

Query: 121 TIIQDYKQSHQHKE----EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            ++  Y +     +    +   + + YF++N   I S   +  D +L   V   + +   
Sbjct: 157 QVVNSYLEQQLENDVGQQDEGTQLALYFQRNAANITSGYSILGDSQLWKVVQTVYDLPES 216

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDN-RFRAMAENFRFQPDGSLSKRDK 226
             S+   +      L   K    + +D  +  A+ + F    D + S    
Sbjct: 217 LGSIDINQQ---KDLVESKVNIADLQDPTKVSALLDRFSAVWDATNSSAAS 264



 Score = 96.1 bits (237), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 69/172 (40%), Gaps = 2/172 (1%)

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
           D     +  +     ++ Y+  NI  + SVD    + RLL+Y + ++ ++ +  +   +K
Sbjct: 50  DTALKQEAAQPEVARDTAYYEANIGSVTSVDDFVNNYRLLNYAMTAYGLSDETNAKALVK 109

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENF-RFQPDGSLSKRDKILTDMQIEKIVSNYFNN 243
            VL+  L++      +  D R+  +A+ F    P+ S +      T   +   +     N
Sbjct: 110 QVLSSDLSDSSSLVYKLNDQRYLNLAKAFANLNPNDSAASYTAATTQQVVNSYLEQQLEN 169

Query: 244 TI-DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
            +           Y++    +++S    L D +L+K++Q          + D
Sbjct: 170 DVGQQDEGTQLALYFQRNAANITSGYSILGDSQLWKVVQTVYDLPESLGSID 221



 Score = 69.1 bits (167), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 40/255 (15%), Positives = 83/255 (32%), Gaps = 48/255 (18%)

Query: 336 KMLDLYKKNCQIL-----HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPI 390
              + Y KN            ++      Y+  +G + S+D+ ++               
Sbjct: 40  ATFNYYSKNSDTALKQEAAQPEVARDTAYYEANIGSVTSVDDFVNN-------------Y 86

Query: 391 ITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAF-NFNADGS 449
             L +A+ AY L+ +   +  ++ VL+S+ SD  S   K  D R + L  AF N N + S
Sbjct: 87  RLLNYAMTAYGLSDETNAKALVKQVLSSDLSDSSSLVYKLNDQRYLNLAKAFANLNPNDS 146

Query: 450 IGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTL 509
                   ++  +   ++          D   +                       Y+  
Sbjct: 147 AASYTAATTQQVVNSYLEQQLENDVGQQDEGTQL--------------------ALYFQR 186

Query: 510 NINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC-------EIFKSDLKDPKSFAN 562
           N   I S   +L + ++   +     +       D          ++  +DL+DP   + 
Sbjct: 187 NAANITSGYSILGDSQLWKVVQTVYDLPESLGSIDINQQKDLVESKVNIADLQDPTKVSA 246

Query: 563 TYKDNRYKEIISSFN 577
               +R+  +  + N
Sbjct: 247 LL--DRFSAVWDATN 259


>gi|163850120|ref|YP_001638163.1| hypothetical protein Mext_0680 [Methylobacterium extorquens PA1]
 gi|163661725|gb|ABY29092.1| protein of unknown function DUF1217 [Methylobacterium extorquens
           PA1]
          Length = 417

 Score =  182 bits (461), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 73/394 (18%), Positives = 134/394 (34%), Gaps = 60/394 (15%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              Y+  +G++K++D+LL  +                 +A+ AY L      +  +R VL
Sbjct: 32  TAYYEAHIGRVKTVDDLLGDQR-------------LYAYAMKAYGLEDMTYAKAFMRKVL 78

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSI 476
               +   S+AN+  DDR      AF+F            Q       +   +  + R+ 
Sbjct: 79  EEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPARFGEQARAA 127

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI---------- 526
             +  K        S +   +  + S +D  T    TI    + LA +            
Sbjct: 128 SLSAPKLLADTYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGQVANPAKVTPAEI 187

Query: 527 ------LNFLLESKGIDSQKVRED---FLCEIFKSDLKDPKSFANTYKD-------NRYK 570
                        KG     +  D   F      +DL    ++  T +D           
Sbjct: 188 AAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGRDTDTLVNVGGPN 247

Query: 571 EIISSFNFDIHGELSHKKIG---KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYF 627
             ++  N  +    +   +G    +  +         Y  Q +E +  + D  + LALYF
Sbjct: 248 RTLTIRNAPLSANRTAVDVGFGTDLGPDSMAQAVTQAYLRQSLESEAGDADTGVRLALYF 307

Query: 628 KRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP---ERKKIRILKKHIKINDFKDS 684
            R    I + Y+ILGD+ L +V +  + L             K+ +++   I I  F+D 
Sbjct: 308 ARKASTIASAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIAGKIDIASFRDP 367

Query: 685 KKVEDFLYAA----KAMDHQSIDYKKALFSSPNQ 714
            K++ F+        A ++ +     ALF+    
Sbjct: 368 AKLDAFVRRFAAIWDAQNNTASAPILALFTGTGS 401



 Score =  139 bits (349), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 64/417 (15%), Positives = 128/417 (30%), Gaps = 51/417 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  +  +            S  + +P+V+ E  YY   I  + T+D+ + D+RL++YA+K
Sbjct: 1   MTDTLTSYRLIAKDLPASLSRKAAEPMVARETAYYEAHIGRVKTVDDLLGDQRLYAYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDI--- 117
           A+GL DM++A+ F++K+LE   +   S  N+L   +Y  FA+++ F        +D    
Sbjct: 61  AYGLEDMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPARF 120

Query: 118 --QHKTIIQDYKQSHQHKEEVALEESKYF----RKNIHKINSVDQLFKDRRLLDYVLQSF 171
             Q +       +      + +      F    R +     SV      + L   V    
Sbjct: 121 GEQARAASLSAPKLLADTYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGQVANPA 180

Query: 172 SITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK-------- 223
            +TP  I+      +    L    +  + +  + F           DG+           
Sbjct: 181 KVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGRDTDTL 240

Query: 224 ----------------------------RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN 255
                                          +  D   + +   Y   +++     +D  
Sbjct: 241 VNVGGPNRTLTIRNAPLSANRTAVDVGFGTDLGPDSMAQAVTQAYLRQSLESEAGDADTG 300

Query: 256 -----YYKLAINSVSSFSDFLKDPKLFKMLQLSLF-PLNPEITADKFLTLMQENDPIVSQ 309
                Y+    ++++S  D L D  L ++    +  P        + L    +       
Sbjct: 301 VRLALYFARKASTIASAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIAGKID 360

Query: 310 VKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
           +  F                 D+Q                    ++L       +G 
Sbjct: 361 IASFRDPAKLDAFVRRFAAIWDAQNNTASAPILALFTGTGSLDAETLQSVQTARIGA 417



 Score =   99 bits (247), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 19/97 (19%), Positives = 45/97 (46%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
             +    ++K     +  E  YY  +I  + + ++LL ++R+  + +++ G++     + 
Sbjct: 13  KDLPASLSRKAAEPMVARETAYYEAHIGRVKTVDDLLGDQRLYAYAMKAYGLEDMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
           F+ ++ +       SFAN   D+RY     +F+F   
Sbjct: 73  FMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQG 109


>gi|254488868|ref|ZP_05102073.1| flagellar protein, putative [Roseobacter sp. GAI101]
 gi|214045737|gb|EEB86375.1| flagellar protein, putative [Roseobacter sp. GAI101]
          Length = 262

 Score =  181 bits (459), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 42/225 (18%), Positives = 93/225 (41%), Gaps = 21/225 (9%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            + ++       ++E+  + +Y+  NI  I + E L+ ++R+L   L + G+        
Sbjct: 19  TTYDRQFETFTKSVELKRDTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFGLQDDINNRY 78

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +    +  S AN + D RY E+  +F F  +    +   G         +    
Sbjct: 79  FIRKVLEEGTTNDDSLANRFADPRYAELSKAFGFGPNESRKNGASG------FAAEISAK 132

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNHYEILGDSKLFKVVSKKLKL 656
           ++    E    ++D  + +ALY +R + +I           + I+GD  L  +  K L L
Sbjct: 133 FQANSFEVSTGDQDQAMRIALYAQRQLVDIAESDGSVDTKWFTIMGDPPLRNLFQKALNL 192

Query: 657 SPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAA 694
              F  +   +++ + K+          I  F D++K+++ +   
Sbjct: 193 PESFGQIDIDQQLGVFKERAKKAFGTEDIATFGDTEKLQELITKF 237



 Score =  137 bits (344), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 46/201 (22%), Positives = 85/201 (42%), Gaps = 27/201 (13%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
           F T +K   +  +  Y+++ I  I T +  +KD+RL +  L AFGL D  +   FI+K+L
Sbjct: 25  FETFTKSVELKRDTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFGLQDDINNRYFIRKVL 84

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVAL 138
           E   ++  SL N+    +Y   ++++ F P                            A 
Sbjct: 85  EEGTTNDDSLANRFADPRYAELSKAFGFGPNES-----------------RKNGASGFAA 127

Query: 139 EESKYFRKNIHKINSVDQ-------LFKDRRLLDYVLQSFSITPKYISL---PFLKDVLT 188
           E S  F+ N  ++++ DQ       L+  R+L+D      S+  K+ ++   P L+++  
Sbjct: 128 EISAKFQANSFEVSTGDQDQAMRIALYAQRQLVDIAESDGSVDTKWFTIMGDPPLRNLFQ 187

Query: 189 LGLANPKKYFIESRDNRFRAM 209
             L  P+ +     D +    
Sbjct: 188 KALNLPESFGQIDIDQQLGVF 208



 Score = 91.5 bits (225), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 66/172 (38%), Gaps = 9/172 (5%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            K      +++YF+KNI  I + + L KDRRLL   L +F +     +  F++ VL  G 
Sbjct: 29  TKSVELKRDTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFGLQDDINNRYFIRKVLEEGT 88

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDCVPI 250
            N         D R+  +++ F F P+ S              K  +N F  +T D    
Sbjct: 89  TNDDSLANRFADPRYAELSKAFGFGPNESRKNGASGFAAEISAKFQANSFEVSTGDQDQA 148

Query: 251 VSDQNYYKLAINSV--------SSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
           +    Y +  +  +        + +   + DP L  + Q +L         D
Sbjct: 149 MRIALYAQRQLVDIAESDGSVDTKWFTIMGDPPLRNLFQKALNLPESFGQID 200



 Score = 66.0 bits (159), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 58/154 (37%), Gaps = 20/154 (12%)

Query: 334 IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           +Q   D   +      + K  +  + +Q  +G I++ + L+  +               L
Sbjct: 17  LQTTYDRQFETFTKSVELKRDT--EYFQKNIGAIETAEGLVKDRR-------------LL 61

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNA-----DG 448
              L A+ L     +R  +R VL    ++ DS AN+  D R  +L+ AF F       +G
Sbjct: 62  TVTLGAFGLQDDINNRYFIRKVLEEGTTNDDSLANRFADPRYAELSKAFGFGPNESRKNG 121

Query: 449 SIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENK 482
           + G    + ++           ++ +++  A   
Sbjct: 122 ASGFAAEISAKFQANSFEVSTGDQDQAMRIALYA 155


>gi|170744539|ref|YP_001773194.1| hypothetical protein M446_6502 [Methylobacterium sp. 4-46]
 gi|168198813|gb|ACA20760.1| protein of unknown function DUF1217 [Methylobacterium sp. 4-46]
          Length = 429

 Score =  181 bits (459), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 84/423 (19%), Positives = 140/423 (33%), Gaps = 60/423 (14%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              +   +GK+KS+D+ +                    +A+ A+ L      +  +R VL
Sbjct: 32  TDYFTANIGKVKSVDDFMKDDR-------------LYAYAMRAHGLEEMIYAKAFMRRVL 78

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSI 476
           T   + P S+AN+  D R ++    F F  D            +T +    +        
Sbjct: 79  TEGVASPSSFANRLADQRYVEFARQFQFATD---VTAQGADPVMTGKTYADYRLGPAIPA 135

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR----------- 525
             +           S +      I+S VD  T    TI   +  L +             
Sbjct: 136 RLSGAFPLGQAMDFSDKVEARFTISSRVDATTTKSATIVLNKSTLRDAVSDLARVTPAEL 195

Query: 526 --ILNFLLESKG-------IDSQKVREDFL---CEIFKSDLKDPK-SFANTYKDNRYKEI 572
              +N  + + G       + +    +  L      F S   D K      Y D  Y+  
Sbjct: 196 VAAINSQIAASGEANLAGKVSASLGAKGELFLETTAFASLGPDGKPGGTGAYADVLYEGG 255

Query: 573 ISSFNFDIHG-------ELSHKKIGKVQDNFHIDDTCDL-YKHQMIEKKEEEKDPNIALA 624
                  I         +L+    G             L Y +Q IE+ E EKD  + LA
Sbjct: 256 GQVRTITIQNLAPAEGRQLADVGFGSALPMSARAQRVTLAYLNQAIERDEGEKDTGVRLA 315

Query: 625 LYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER---KKIRILKKHIKINDF 681
           LYF R  P + + Y+IL D  L KV +  L L             ++  ++K+ I I  F
Sbjct: 316 LYFTRMAPTLSSPYDILSDPALTKVANVVLGLPATSGAATSDALVRRAALIKQKIDIASF 375

Query: 682 KDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSN 741
           +D  KV+ F+    A+   +           +    P    F    N+ +  L   ++S 
Sbjct: 376 QDPAKVQAFVKRFAAIWDATN---------ADAESSPVLGLFPTSPNSQAENLGRLQRSR 426

Query: 742 GRF 744
            +F
Sbjct: 427 AKF 429



 Score =  145 bits (365), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 65/357 (18%), Positives = 121/357 (33%), Gaps = 63/357 (17%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +  +    ++DI +K  +  + +  V  +  Y+   I  + ++D+F+KD RL++YA+
Sbjct: 1   MTSTFTSYQLLTRDI-TKTLTRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDRLYAYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           +A GL +M +A+ F++++L   ++ P S  N+L   +Y  FAR + F+       +D   
Sbjct: 60  RAHGLEEMIYAKAFMRRVLTEGVASPSSFANRLADQRYVEFARQFQFATDVTAQGADPVM 119

Query: 120 KTII-QDYK----------------QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRR 162
                 DY+                Q+    ++V    +   R +     S   +     
Sbjct: 120 TGKTYADYRLGPAIPARLSGAFPLGQAMDFSDKVEARFTISSRVDATTTKSATIVLNKST 179

Query: 163 LLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG--- 219
           L D V     +TP  +       +   G AN       S   +     E   F   G   
Sbjct: 180 LRDAVSDLARVTPAELVAAINSQIAASGEANLAGKVSASLGAKGELFLETTAFASLGPDG 239

Query: 220 ------------------------------------SLSKRDKILTDMQIEKIVSNYFNN 243
                                                +     +    + +++   Y N 
Sbjct: 240 KPGGTGAYADVLYEGGGQVRTITIQNLAPAEGRQLADVGFGSALPMSARAQRVTLAYLNQ 299

Query: 244 TIDCVPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADK 295
            I+      D       Y+     ++SS  D L DP L K+  + L        A  
Sbjct: 300 AIERDEGEKDTGVRLALYFTRMAPTLSSPYDILSDPALTKVANVVLGLPATSGAATS 356



 Score =  106 bits (265), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 45/108 (41%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            S   +       + +  T+K     +  + DY+T NI  + S ++ + + R+  + + +
Sbjct: 2   TSTFTSYQLLTRDITKTLTRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDRLYAYAMRA 61

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
            G++     + F+  +    +  P SFAN   D RY E    F F   
Sbjct: 62  HGLEEMIYAKAFMRRVLTEGVASPSSFANRLADQRYVEFARQFQFATD 109



 Score = 41.8 bits (96), Expect = 0.50,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 40/126 (31%), Gaps = 14/126 (11%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           + + ++       +   +  D +Y+   I  V S  DF+KD +L+    +    L   I 
Sbjct: 11  LTRDITKTLTRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDRLYAY-AMRAHGLEEMIY 69

Query: 293 ADKFLTLMQEND-----------PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
           A  F+  +                    V++  Q  F  D ++           K    Y
Sbjct: 70  AKAFMRRVLTEGVASPSSFANRLADQRYVEFARQFQFATDVTAQG--ADPVMTGKTYADY 127

Query: 342 KKNCQI 347
           +    I
Sbjct: 128 RLGPAI 133


>gi|149203152|ref|ZP_01880123.1| flagellar protein, putative [Roseovarius sp. TM1035]
 gi|149143698|gb|EDM31734.1| flagellar protein, putative [Roseovarius sp. TM1035]
          Length = 267

 Score =  178 bits (452), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 41/232 (17%), Positives = 92/232 (39%), Gaps = 21/232 (9%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           + E+ +     + +I  + +Y+  NI  I + E L++++R+L   L + G+        F
Sbjct: 21  TSERQTDLFNKSPQIVRDTEYFEQNIAKITTAEGLVSDRRLLRVALGAFGLQEDINSRAF 80

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           +  I +       + AN   D+RYK++  +F F      + + I + Q +    +  + +
Sbjct: 81  IRAILEEGTIRDDAIANRLADDRYKQLSEAFAF------ADRPIPRTQLSTFGTEITEKF 134

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLS 657
           + +  E    +++  + LAL  +R + +I           + ILG+  L +V    L L 
Sbjct: 135 RRREFEVAVGDQNQALRLALNVQRELGDIAGDAETEDTRWFRILGNPPLRRVFEVALGLP 194

Query: 658 PYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQSI 702
             F      +++  +K           ++D       E  +      +  + 
Sbjct: 195 DSFGQADLDRQLDEIKSRSAQQLKIGSLSDLSAESVREQLIQRFLLREQVAS 246



 Score =  126 bits (316), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 39/193 (20%), Positives = 76/193 (39%), Gaps = 17/193 (8%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
            +K P +  +  Y+ + I  I+T +  + D+RL   AL AFGL +  ++  FI+ ILE  
Sbjct: 29  FNKSPQIVRDTEYFEQNIAKITTAEGLVSDRRLLRVALGAFGLQEDINSRAFIRAILEEG 88

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
                ++ N+L   +Y+  + ++ F+  P          T I +  +  +          
Sbjct: 89  TIRDDAIANRLADDRYKQLSEAFAFADRPIPRTQLSTFGTEITEKFRRRE---------- 138

Query: 142 KYFRKNIHKINSVDQLFKD--RRLLDYVLQSFSITPKYI---SLPFLKDVLTLGLANPKK 196
             F   +   N   +L  +  R L D    + +   ++      P L+ V  + L  P  
Sbjct: 139 --FEVAVGDQNQALRLALNVQRELGDIAGDAETEDTRWFRILGNPPLRRVFEVALGLPDS 196

Query: 197 YFIESRDNRFRAM 209
           +     D +   +
Sbjct: 197 FGQADLDRQLDEI 209



 Score = 89.2 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/201 (18%), Positives = 78/201 (38%), Gaps = 15/201 (7%)

Query: 123 IQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
             + +    +K    + +++YF +NI KI + + L  DRRLL   L +F +     S  F
Sbjct: 21  TSERQTDLFNKSPQIVRDTEYFEQNIAKITTAEGLVSDRRLLRVALGAFGLQEDINSRAF 80

Query: 183 LKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQ----PDGSLSKRDKILTDMQIEKIVS 238
           ++ +L  G            D+R++ ++E F F     P   LS     +T+    +   
Sbjct: 81  IRAILEEGTIRDDAIANRLADDRYKQLSEAFAFADRPIPRTQLSTFGTEITEKFRRREFE 140

Query: 239 NYFNNTIDCVPIVSDQNYYKLAINSV--------SSFSDFLKDPKLFKMLQLSLFPLNPE 290
               +    + +  +    +  +  +        + +   L +P L ++ +++L   +  
Sbjct: 141 VAVGDQNQALRLALN---VQRELGDIAGDAETEDTRWFRILGNPPLRRVFEVALGLPDSF 197

Query: 291 ITADKFLTLMQENDPIVSQVK 311
             AD    L +       Q+K
Sbjct: 198 GQADLDRQLDEIKSRSAQQLK 218



 Score = 62.2 bits (149), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 19/111 (17%)

Query: 335 QKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQ 394
           ++  DL+ K+ QI+ D       + ++  + KI + + L+S +               L+
Sbjct: 23  ERQTDLFNKSPQIVRDT------EYFEQNIAKITTAEGLVSDRR-------------LLR 63

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFN 445
            AL A+ L      R  +R +L       D+ AN+  DDR  +L+ AF F 
Sbjct: 64  VALGAFGLQEDINSRAFIRAILEEGTIRDDAIANRLADDRYKQLSEAFAFA 114



 Score = 41.4 bits (95), Expect = 0.52,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 30/80 (37%), Gaps = 1/80 (1%)

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
             + +      +       IV D  Y++  I  +++    + D +L ++  L  F L  +
Sbjct: 16  ALLSRTSERQTDLFNKSPQIVRDTEYFEQNIAKITTAEGLVSDRRLLRV-ALGAFGLQED 74

Query: 291 ITADKFLTLMQENDPIVSQV 310
           I +  F+  + E   I    
Sbjct: 75  INSRAFIRAILEEGTIRDDA 94


>gi|170744540|ref|YP_001773195.1| hypothetical protein M446_6503 [Methylobacterium sp. 4-46]
 gi|168198814|gb|ACA20761.1| protein of unknown function DUF1217 [Methylobacterium sp. 4-46]
          Length = 414

 Score =  178 bits (451), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 75/406 (18%), Positives = 126/406 (31%), Gaps = 50/406 (12%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             D  +      Y+  +GK+KS+D+L++ +                 +A+ AY L     
Sbjct: 23  AADPVVARDTAYYEANIGKVKSVDDLMADQR-------------LYAYAMKAYGLEDMTY 69

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R VL    +D  S+AN+  D R +    A                +        +
Sbjct: 70  AKAFMRKVLEGGVADASSFANRLADPRYVAFARA-------FDFAAGAASASGADGSISE 122

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI- 526
                 +        +       S        + S +D  T    TI      LA     
Sbjct: 123 SGVVPPQPAQLTAPAALPDSTDFSGANEARFTLTSRLDATTTRSVTITLNAATLAGSAAD 182

Query: 527 ------------LNFLLESKGIDSQKVREDFLCEI-----FKSDLKDPKSFANTYKDNRY 569
                       +N  + + G D  + R            F++    P  F    +    
Sbjct: 183 LTRVTGAEIVAAINAQIAASGEDGLEDRVQVGLGARNELYFETTASAPDGFGTAVEAGGT 242

Query: 570 KEIISSFNFDIHGELSHKKI----GKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALAL 625
              +S  N                  +  +  +    D Y  Q +E    E+D  + LAL
Sbjct: 243 GRTLSVENAAPSAADRKAVGIGFGTALPPDAQVRTVTDAYLEQTLESDAGEEDTGLRLAL 302

Query: 626 YFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP---ERKKIRILKKHIKINDFK 682
           YF R  P + + Y+ILGD+ L KV +    L              +   L   I I  F+
Sbjct: 303 YFARMAPTLTSAYDILGDAALSKVANTVAGLPATSGAATSEALDARAAFLAAKIDIAGFQ 362

Query: 683 DSKKVEDFLYAA----KAMDHQSIDYKKALFSSP-NQNKDPWNNSF 723
           D  KV+ F+        A +        ALF++      DP  + +
Sbjct: 363 DPAKVQAFVRRFAAIWDAQNSSGDSPILALFTTAGGGGADPLGSLY 408



 Score =  131 bits (330), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 60/329 (18%), Positives = 112/329 (34%), Gaps = 47/329 (14%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  +            K     + DP+V+ +  YY   I  + ++D+ + D+RL++YA+K
Sbjct: 1   MTSTFTNYQLVARDLPKALQRKAADPVVARDTAYYEANIGKVKSVDDLMADQRLYAYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS------------- 107
           A+GL DM++A+ F++K+LE  ++D  S  N+L   +Y  FAR++DF+             
Sbjct: 61  AYGLEDMTYAKAFMRKVLEGGVADASSFANRLADPRYVAFARAFDFAAGAASASGADGSI 120

Query: 108 PPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLL--- 164
               V+       T       S           +   R +     SV        L    
Sbjct: 121 SESGVVPPQPAQLTAPAALPDSTDFSGANEARFTLTSRLDATTTRSVTITLNAATLAGSA 180

Query: 165 --------DYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQ 216
                     ++ + +          L+D + +GL    + + E+  +            
Sbjct: 181 ADLTRVTGAEIVAAINAQIAASGEDGLEDRVQVGLGARNELYFETTASAPDGFGTAVEAG 240

Query: 217 PDGSLSK------------------RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN--- 255
             G                         +  D Q+  +   Y   T++      D     
Sbjct: 241 GTGRTLSVENAAPSAADRKAVGIGFGTALPPDAQVRTVTDAYLEQTLESDAGEEDTGLRL 300

Query: 256 --YYKLAINSVSSFSDFLKDPKLFKMLQL 282
             Y+     +++S  D L D  L K+   
Sbjct: 301 ALYFARMAPTLTSAYDILGDAALSKVANT 329



 Score = 95.7 bits (236), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 20/96 (20%), Positives = 45/96 (46%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            S           + +   +K  +  +  +  YY  NI  + S ++L+A++R+  + +++
Sbjct: 2   TSTFTNYQLVARDLPKALQRKAADPVVARDTAYYEANIGKVKSVDDLMADQRLYAYAMKA 61

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRY 569
            G++     + F+ ++ +  + D  SFAN   D RY
Sbjct: 62  YGLEDMTYAKAFMRKVLEGGVADASSFANRLADPRY 97


>gi|163744335|ref|ZP_02151695.1| hypothetical protein OIHEL45_02090 [Oceanibulbus indolifex HEL-45]
 gi|161381153|gb|EDQ05562.1| hypothetical protein OIHEL45_02090 [Oceanibulbus indolifex HEL-45]
          Length = 277

 Score =  178 bits (450), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 38/221 (17%), Positives = 90/221 (40%), Gaps = 5/221 (2%)

Query: 477 HDAENKSFNSMEQISTQKRINLEIN-SEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
                K F++          N  +N  +++ +   I  I S +E +A+  +  F++ +  
Sbjct: 9   TQVAVKLFDATRDKQLDLVANDALNARQIEAFKERIGDIKSAKEFVADTEVYTFVMRAFD 68

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           ++ Q   +  + ++ +S+  +P +  N   + + KE+  +  F   G  S          
Sbjct: 69  LEDQIFGKAMIRKVLESNSDEPSALVNRLSNPKIKEMYDTLGFAPGGGRS----FNFNRT 124

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
              D+  D +K +++     E++    +AL FK     I +  ++L D+ L   + + L 
Sbjct: 125 GWQDEVIDRFKERIVLNSAGEENEGARIALEFKSKAGEINSWLDVLKDADLGSFMRRALG 184

Query: 656 LSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKA 696
           +      +   ++I + ++   I   KD  +V+  +    A
Sbjct: 185 VPNEAIGVDLDRQIALFEQKFDIEKLKDPAEVDKLVSRFSA 225



 Score =  135 bits (340), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 39/192 (20%), Positives = 85/192 (44%), Gaps = 7/192 (3%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + + VA       + K    V+ D + + +   ++ERI  I +  EF+ D  ++++ ++A
Sbjct: 7   MSTQVAVKLFDATRDKQLDLVANDALNARQIEAFKERIGDIKSAKEFVADTEVYTFVMRA 66

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP-------KVIQ 114
           F L D    +  I+K+LES+  +P +LVN+L++ K +    +  F+P         +   
Sbjct: 67  FDLEDQIFGKAMIRKVLESNSDEPSALVNRLSNPKIKEMYDTLGFAPGGGRSFNFNRTGW 126

Query: 115 SDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
            D       +    +   +E      +  F+    +INS   + KD  L  ++ ++  + 
Sbjct: 127 QDEVIDRFKERIVLNSAGEENEGARIALEFKSKAGEINSWLDVLKDADLGSFMRRALGVP 186

Query: 175 PKYISLPFLKDV 186
            + I +   + +
Sbjct: 187 NEAIGVDLDRQI 198



 Score = 89.2 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 33/199 (16%), Positives = 71/199 (35%), Gaps = 9/199 (4%)

Query: 109 PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVL 168
                Q  ++     +D +      + +   + + F++ I  I S  +   D  +  +V+
Sbjct: 5   GGMSTQVAVKLFDATRDKQLDLVANDALNARQIEAFKERIGDIKSAKEFVADTEVYTFVM 64

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG------SLS 222
           ++F +  +      ++ VL      P        + + + M +   F P G      + +
Sbjct: 65  RAFDLEDQIFGKAMIRKVLESNSDEPSALVNRLSNPKIKEMYDTLGFAPGGGRSFNFNRT 124

Query: 223 KRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQL 282
                + D   E+IV N      +   I  +   +K     ++S+ D LKD  L   ++ 
Sbjct: 125 GWQDEVIDRFKERIVLNSAGEENEGARIALE---FKSKAGEINSWLDVLKDADLGSFMRR 181

Query: 283 SLFPLNPEITADKFLTLMQ 301
           +L   N  I  D    +  
Sbjct: 182 ALGVPNEAIGVDLDRQIAL 200



 Score = 63.3 bits (152), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/203 (14%), Positives = 68/203 (33%), Gaps = 31/203 (15%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           + +D      I+ ++  +G IKS    ++                   F + A++L  Q 
Sbjct: 27  VANDALNARQIEAFKERIGDIKSAKEFVADTE-------------VYTFVMRAFDLEDQI 73

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R VL SN  +P +  N+  + ++ ++     F   G                  
Sbjct: 74  FGKAMIRKVLESNSDEPSALVNRLSNPKIKEMYDTLGFAPGGG----------------- 116

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
               N  R+    E         +        E       +      I+S+ ++L +  +
Sbjct: 117 -RSFNFNRTGWQDEVIDRFKERIVLNSAGEENEGARIALEFKSKAGEINSWLDVLKDADL 175

Query: 527 LNFLLESKGIDSQKVREDFLCEI 549
            +F+  + G+ ++ +  D   +I
Sbjct: 176 GSFMRRALGVPNEAIGVDLDRQI 198


>gi|255263694|ref|ZP_05343036.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255106029|gb|EET48703.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 262

 Score =  175 bits (443), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 52/243 (21%), Positives = 98/243 (40%), Gaps = 24/243 (9%)

Query: 492 TQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
           T      +I     Y+  NI+ I + E L+A++++L   L + G+D       F+  I +
Sbjct: 26  TAFNEAPQIERATSYFRENISKITTAEALVADRQLLEVALGAFGLDDDINNTYFIKTILE 85

Query: 552 SDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIE 611
               D  + AN   D+RYKE   SF F            +   +   DD  + ++    E
Sbjct: 86  EGTLDDDALANRLADSRYKEFAESFGFG------DFSTPRTVLSTFPDDIINRFEAGQFE 139

Query: 612 KKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVL 663
           +   E++P++ LAL F  T+ +I           ++I+G+    K+    L L   FA +
Sbjct: 140 QAVGEQNPDLRLALNFSSTMESILATDSSNDVLWFKIMGNPPARKLFETALGLPASFAQI 199

Query: 664 PERKKIRILKKHI-------KINDFKDSKKVEDFLYAA---KAMDHQSIDYKKALFSSPN 713
              +++ I K+          ++DF      +D +        MD  +     ++  +  
Sbjct: 200 DIDRQLGIFKERSMSRFGTNSVSDFSSPDTQDDIIRNFLVLSEMDQFAQTSSGSIALALL 259

Query: 714 QNK 716
           Q +
Sbjct: 260 QGQ 262



 Score =  124 bits (310), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 53/242 (21%), Positives = 98/242 (40%), Gaps = 11/242 (4%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           + D+Q   F+   + P +     Y+RE I  I+T +  + D++L   AL AFGL D  + 
Sbjct: 20  TLDVQQTAFN---EAPQIERATSYFRENISKITTAEALVADRQLLEVALGAFGLDDDINN 76

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSH 130
             FIK ILE    D  +L N+L   +Y+ FA S+ F                I +  ++ 
Sbjct: 77  TYFIKTILEEGTLDDDALANRLADSRYKEFAESFGFGDFSTPRTVLSTFPDDIINRFEAG 136

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
           Q ++ V  E++   R  ++  ++++ +       D       +  K +  P  + +    
Sbjct: 137 QFEQAVG-EQNPDLRLALNFSSTMESILATDSSNDV------LWFKIMGNPPARKLFETA 189

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPI 250
           L  P  +  +   +R   + +       G+ S  D    D Q + I +    + +D    
Sbjct: 190 LGLPASFA-QIDIDRQLGIFKERSMSRFGTNSVSDFSSPDTQDDIIRNFLVLSEMDQFAQ 248

Query: 251 VS 252
            S
Sbjct: 249 TS 250



 Score = 68.0 bits (164), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 27/172 (15%), Positives = 60/172 (34%), Gaps = 18/172 (10%)

Query: 334 IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           +++ LD+ +         +++     ++  + KI + + L++ +               L
Sbjct: 17  LERTLDVQQTAFN--EAPQIERATSYFRENISKITTAEALVADRQ-------------LL 61

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           + AL A+ L+    +   ++ +L     D D+ AN+  D R  +   +F F   G     
Sbjct: 62  EVALGAFGLDDDINNTYFIKTILEEGTLDDDALANRLADSRYKEFAESFGF---GDFSTP 118

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVD 505
             + S        +  A +       +N         S+     L  +S  D
Sbjct: 119 RTVLSTFPDDIINRFEAGQFEQAVGEQNPDLRLALNFSSTMESILATDSSND 170


>gi|254471377|ref|ZP_05084779.1| flagellar basal-body rod protein flgf [Pseudovibrio sp. JE062]
 gi|211959523|gb|EEA94721.1| flagellar basal-body rod protein flgf [Pseudovibrio sp. JE062]
          Length = 365

 Score =  171 bits (433), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 75/391 (19%), Positives = 147/391 (37%), Gaps = 61/391 (15%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
              D ++   IK Y+    K++++D+LL+                   F +    L    
Sbjct: 21  TAKDPEIAREIKYYEENFSKVETVDDLLND-------------YRLYNFMMKTMGLEDMA 67

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  +R VL     D  + AN  KD R  +L  AF FN DG+I                
Sbjct: 68  YAKGMVRKVLVEGTDDSGALANTLKDKRFKELAEAFPFNKDGTI---------------- 111

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNI-NTIHSFEELLANKR 525
                + +   ++E      +   +T      +++   +Y+TL +   +    ++LA+  
Sbjct: 112 -----KGKFDWESEGLDPRMVLWSNTPGEEVDDVDRLAEYFTLKMPRDVIFTTQILADPA 166

Query: 526 ILNFLLESKGIDSQKVREDFLCEIFKSDLK-DPKSFA--NTYKDN--RYKEIISSFNFDI 580
           +   +  +  +  + +       I   D   D ++    +  KD   +Y++     N +I
Sbjct: 167 LYEVITVAFDVPEEIINGPKSERIDWFDENIDIEALKKPSELKDTIAKYRD-----NLEI 221

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
                 K               + Y     E+ E E++  + LAL F+RT  NI + YEI
Sbjct: 222 READRTKG------------IVEQYIQVSFEEGEGEQNEGVRLALNFQRTGGNITSAYEI 269

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQ 700
           LG   L++VV   L +S          +  ++ +   I  F+D ++V+ F+     +   
Sbjct: 270 LGSPALYQVVRTVLGMSESMVGSDIDNQAAVINEKFDIKKFQDPEEVDKFVKKFVIL--- 326

Query: 701 SIDYKKALFSSPNQNKDPWNNSFDDPQNNVS 731
             D +  + ++P+      N     P+N ++
Sbjct: 327 -YDAQNGIGTAPSVQLFASNPGVGIPENVLT 356



 Score =  168 bits (425), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 96/210 (45%), Gaps = 8/210 (3%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
            +     +   + EI  E+ YY  N + + + ++LL + R+ NF++++ G++     +  
Sbjct: 13  DLPGAKERTAKDPEIAREIKYYEENFSKVETVDDLLNDYRLYNFMMKTMGLEDMAYAKGM 72

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++      D  + ANT KD R+KE+  +F F+  G +  K      ++  +D    L+
Sbjct: 73  VRKVLVEGTDDSGALANTLKDKRFKELAEAFPFNKDGTIKGKFD---WESEGLDPRMVLW 129

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIP-NIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
            +   E    E D    LA YF   +P ++    +IL D  L++V++    +       P
Sbjct: 130 SNTPGE----EVDDVDRLAEYFTLKMPRDVIFTTQILADPALYEVITVAFDVPEEIINGP 185

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAA 694
           + ++I    ++I I   K   +++D +   
Sbjct: 186 KSERIDWFDENIDIEALKKPSELKDTIAKY 215



 Score =  160 bits (405), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 57/362 (15%), Positives = 140/362 (38%), Gaps = 24/362 (6%)

Query: 8   PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDM 67
              ++D+        +KDP ++ E +YY E    + T+D+ + D RL+++ +K  GL DM
Sbjct: 8   SMLNRDLPGAK-ERTAKDPEIAREIKYYEENFSKVETVDDLLNDYRLYNFMMKTMGLEDM 66

Query: 68  SHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQHKTIIQDY 126
           ++A+  ++K+L     D  +L N L   +++  A ++ F+    +    D + + +    
Sbjct: 67  AYAKGMVRKVLVEGTDDSGALANTLKDKRFKELAEAFPFNKDGTIKGKFDWESEGLDPRM 126

Query: 127 ---KQSHQHKEEVALEESKYFRKNIH-KINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
                +   + +     ++YF   +   +    Q+  D  L + +  +F +  + I+ P 
Sbjct: 127 VLWSNTPGEEVDDVDRLAEYFTLKMPRDVIFTTQILADPALYEVITVAFDVPEEIINGPK 186

Query: 183 LKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN 242
            + +               + +  +     +R   +   + R K + +  I+        
Sbjct: 187 SERI--DWFDENIDIEALKKPSELKDTIAKYRDNLEIREADRTKGIVEQYIQVSFEEGEG 244

Query: 243 NTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
              + V +  +   ++    +++S  + L  P L+++++  L      + +D        
Sbjct: 245 EQNEGVRLALN---FQRTGGNITSAYEILGSPALYQVVRTVLGMSESMVGSD-------- 293

Query: 303 NDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL 362
            D   + +   F I   +D     K      ++K + LY     I     +Q    +  +
Sbjct: 294 IDNQAAVINEKFDIKKFQDPEEVDKF-----VKKFVILYDAQNGIGTAPSVQLFASNPGV 348

Query: 363 PL 364
            +
Sbjct: 349 GI 350


>gi|159045898|ref|YP_001534692.1| hypothetical protein Dshi_3358 [Dinoroseobacter shibae DFL 12]
 gi|157913658|gb|ABV95091.1| protein of unknown function DUF1217 [Dinoroseobacter shibae DFL 12]
          Length = 263

 Score =  170 bits (430), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 53/247 (21%), Positives = 99/247 (40%), Gaps = 27/247 (10%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           ++E        + +   E DY+  NI  I + E+L+A++R+L F L + G+D+    + F
Sbjct: 21  TLEAQKEAFGQSTQYRREEDYFRANIGNIETAEQLVADRRLLAFSLSAFGLDADLPNKFF 80

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + +I      D  + +N   D  Y+E   +F           ++ K Q     D+    Y
Sbjct: 81  IQKILSDGTSDNAALSNRLSDKTYREFSDAFGLGQG------QVRKTQQTSFADEIIQKY 134

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNH--------YEILGDSKLFKVVSKKLKLS 657
           + Q  E+     + ++ LAL  KR I ++ +         + +LG   L        +L 
Sbjct: 135 ETQKFEESVGNVNDDLRLALNLKREISDLASSDMSERAKLFTVLGSPPLRTTFETAFRLP 194

Query: 658 PYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAA------KAMDHQSIDY 704
             FA L   +++ +L++ +        I+ FKD    E  +          + +  S   
Sbjct: 195 SAFAGLDIDRQVTVLEEKLESAFGDASISQFKDPDLSERLIQKFLLQSELSSFEATSSPA 254

Query: 705 KKALFSS 711
             ALF  
Sbjct: 255 ATALFLL 261



 Score =  111 bits (276), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/191 (20%), Positives = 74/191 (38%), Gaps = 13/191 (6%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
               +      EE Y+R  I +I T ++ + D+RL +++L AFGL      + FI+KIL 
Sbjct: 27  EAFGQSTQYRREEDYFRANIGNIETAEQLVADRRLLAFSLSAFGLDADLPNKFFIQKILS 86

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFSPPP-KVIQSDIQHKTIIQDYKQSHQHKEEVAL 138
              SD  +L N+L+   Y+ F+ ++       +  Q       IIQ Y+     +    +
Sbjct: 87  DGTSDNAALSNRLSDKTYREFSDAFGLGQGQVRKTQQTSFADEIIQKYETQKFEESVGNV 146

Query: 139 EE----SKYFRKNIHKINSVD--------QLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
            +    +   ++ I  + S D         +     L      +F +   +  L   + V
Sbjct: 147 NDDLRLALNLKREISDLASSDMSERAKLFTVLGSPPLRTTFETAFRLPSAFAGLDIDRQV 206

Query: 187 LTLGLANPKKY 197
             L       +
Sbjct: 207 TVLEEKLESAF 217



 Score = 73.0 bits (177), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 40/234 (17%), Positives = 79/234 (33%), Gaps = 10/234 (4%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           ++    +      E  YFR NI  I + +QL  DRRLL + L +F +     +  F++ +
Sbjct: 25  QKEAFGQSTQYRREEDYFRANIGNIETAEQLVADRRLLAFSLSAFGLDADLPNKFFIQKI 84

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI- 245
           L+ G ++         D  +R  ++ F          +     D  I+K  +  F  ++ 
Sbjct: 85  LSDGTSDNAALSNRLSDKTYREFSDAFGLGQGQVRKTQQTSFADEIIQKYETQKFEESVG 144

Query: 246 DCVPIVSDQNYYKLAINSVSSFS--------DFLKDPKLFKMLQLSLFPLNPEITADKFL 297
           +    +      K  I+ ++S            L  P L    + +    +     D   
Sbjct: 145 NVNDDLRLALNLKREISDLASSDMSERAKLFTVLGSPPLRTTFETAFRLPSAFAGLDIDR 204

Query: 298 TLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDD 351
            +    + + S         F  D   S ++ Q   +Q  L  ++         
Sbjct: 205 QVTVLEEKLESAFGDASISQFK-DPDLSERLIQKFLLQSELSSFEATSSPAATA 257



 Score = 51.8 bits (122), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/103 (17%), Positives = 39/103 (37%), Gaps = 4/103 (3%)

Query: 371 DNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKS 430
           D   +    +E           L F+L A+ L+    ++  ++ +L+   SD  + +N+ 
Sbjct: 40  DYFRANIGNIETAEQLVADRRLLAFSLSAFGLDADLPNKFFIQKILSDGTSDNAALSNRL 99

Query: 431 KDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRK 473
            D    + + AF        G +   Q      + ++ Y  +K
Sbjct: 100 SDKTYREFSDAFGLGQ----GQVRKTQQTSFADEIIQKYETQK 138



 Score = 37.5 bits (85), Expect = 9.3,   Method: Composition-based stats.
 Identities = 29/194 (14%), Positives = 63/194 (32%), Gaps = 18/194 (9%)

Query: 246 DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDP 305
                  +++Y++  I ++ +    + D +L     LS F L+ ++    F+  +  +  
Sbjct: 31  QSTQYRREEDYFRANIGNIETAEQLVADRRLLA-FSLSAFGLDADLPNKFFIQKILSDGT 89

Query: 306 I---------VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKN---CQILHDDKM 353
                       +    F   F        K QQ S   +++  Y+       + + +  
Sbjct: 90  SDNAALSNRLSDKTYREFSDAFGLGQGQVRKTQQTSFADEIIQKYETQKFEESVGNVNDD 149

Query: 354 QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD---AYNLNMQDLDRD 410
             L  + +  +  + S D  +S + +L     +     T + A     A+     D    
Sbjct: 150 LRLALNLKREISDLASSD--MSERAKLFTVLGSPPLRTTFETAFRLPSAFAGLDIDRQVT 207

Query: 411 QLRNVLTSNPSDPD 424
            L   L S   D  
Sbjct: 208 VLEEKLESAFGDAS 221


>gi|254509607|ref|ZP_05121674.1| flagellar protein, putative [Rhodobacteraceae bacterium KLH11]
 gi|221533318|gb|EEE36306.1| flagellar protein, putative [Rhodobacteraceae bacterium KLH11]
          Length = 265

 Score =  170 bits (429), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 88/216 (40%), Gaps = 21/216 (9%)

Query: 501 NSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSF 560
             E DY+  NI  + S E+L++++R+L   L + G+++      F+ +I     +   + 
Sbjct: 36  QRETDYFLENIGKVQSAEDLVSDRRLLQVALGAFGLEADLDNRFFIQKILSDGTQAEDAL 95

Query: 561 ANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPN 620
           AN   D RY++  ++F     G++    +    +    D+    +     E    E D +
Sbjct: 96  ANRLADGRYRDFANAFGLGP-GDVRKTGLTNEMEKIASDNLVARF-----EISVGEADES 149

Query: 621 IALALYFKRTIPNIR--------NHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRIL 672
           + +AL+ +  +  I           ++++G   L  ++   L L   FA L   K++ + 
Sbjct: 150 MRIALFTQHALQEIAAQDGSENRKWFDLMGLPPLRSMMETALGLPSAFAQLDIDKQLEVF 209

Query: 673 KKHI-------KINDFKDSKKVEDFLYAAKAMDHQS 701
           +  +        ++ F DS+ +        A    +
Sbjct: 210 RDRLQRVTGSSDLSQFTDSEAIGKLTDTYLARSQIA 245



 Score =  123 bits (308), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/245 (19%), Positives = 90/245 (36%), Gaps = 17/245 (6%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           + D Q + +S      +   E  Y+ E I  + + ++ + D+RL   AL AFGL      
Sbjct: 21  TYDAQLQSYSA---SNVNQRETDYFLENIGKVQSAEDLVSDRRLLQVALGAFGLEADLDN 77

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSH 130
             FI+KIL        +L N+L   +Y+ FA ++   P       D++   +  + ++  
Sbjct: 78  RFFIQKILSDGTQAEDALANRLADGRYRDFANAFGLGPG------DVRKTGLTNEMEKIA 131

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS---LPFLKDVL 187
                   E S        +I     LF    L +   Q  S   K+     LP L+ ++
Sbjct: 132 SDNLVARFEISVGEADESMRIA----LFTQHALQEIAAQDGSENRKWFDLMGLPPLRSMM 187

Query: 188 TLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDC 247
              L  P  +     D +     +  + +  GS        ++   +   +    + I  
Sbjct: 188 ETALGLPSAFAQLDIDKQLEVFRDRLQ-RVTGSSDLSQFTDSEAIGKLTDTYLARSQIAQ 246

Query: 248 VPIVS 252
           +  ++
Sbjct: 247 LQRIT 251



 Score = 60.3 bits (144), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 76/218 (34%), Gaps = 28/218 (12%)

Query: 334 IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           +Q+  D   ++    + ++ ++    +   +GK++S ++L+S +               L
Sbjct: 18  LQRTYDAQLQSYSASNVNQRET--DYFLENIGKVQSAEDLVSDRR-------------LL 62

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           Q AL A+ L     +R  ++ +L+      D+ AN+  D R     +AF     G +   
Sbjct: 63  QVALGAFGLEADLDNRFFIQKILSDGTQAEDALANRLADGRYRDFANAFGLGP-GDVRKT 121

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
            +      I  +              E+       Q + Q+    + +    ++      
Sbjct: 122 GLTNEMEKIASDNLVARFEISVGEADESMRIALFTQHALQEIAAQDGSENRKWF------ 175

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
                +L+    + + +  + G+      +  + +  +
Sbjct: 176 -----DLMGLPPLRSMMETALGL-PSAFAQLDIDKQLE 207


>gi|83944192|ref|ZP_00956648.1| hypothetical protein EE36_02633 [Sulfitobacter sp. EE-36]
 gi|83845059|gb|EAP82940.1| hypothetical protein EE36_02633 [Sulfitobacter sp. EE-36]
          Length = 274

 Score =  168 bits (426), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 82/204 (40%), Gaps = 3/204 (1%)

Query: 495 RINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDL 554
           R +       + +   I  I S EEL+A+  + +F++ +  ++ Q   +  + ++ +SD 
Sbjct: 28  RDSAANKRAEEAFRDRIGDISSPEELIADFEVYSFVMRAFDLEDQIFGKGLIRKMLESDP 87

Query: 555 KDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKE 614
            +P S  N   D+R++E+  +  F    E   +       +F  D T   Y  Q I + +
Sbjct: 88  VEPSSLLNRLTDSRFREMHLALGFTT--EAGPQTPDLTDPDFLNDVTTRFYNRQYINEND 145

Query: 615 EEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKK 674
             ++  +   L F+     I N +E+L   KL       L L    + L   K+  +L  
Sbjct: 146 A-QNETVGTVLEFRDKFSGINNWFEVLASEKLTNFFQVALSLPEQMSALDLDKQKALLAD 204

Query: 675 HIKINDFKDSKKVEDFLYAAKAMD 698
              +    D  + E  +    A+ 
Sbjct: 205 KFDLEKLADPAEREKLIARYVAIS 228



 Score =  126 bits (316), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 94/218 (43%), Gaps = 16/218 (7%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
            ++D Q  L    + +      E  +R+RI  IS+ +E I D  ++S+ ++AF L D   
Sbjct: 18  ATRDKQLDLMRDSAAN---KRAEEAFRDRIGDISSPEELIADFEVYSFVMRAFDLEDQIF 74

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP-----PKVIQSDIQHKTIIQ 124
            +  I+K+LESD  +P SL+N+L   +++    +  F+       P +   D  +    +
Sbjct: 75  GKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTR 134

Query: 125 DYKQSHQHKEEVALEESKY---FRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLP 181
            Y + + ++ +   E       FR     IN+  ++    +L ++   + S+  +  +L 
Sbjct: 135 FYNRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLASEKLTNFFQVALSLPEQMSALD 194

Query: 182 FLK-DVLTLGLANPKKYFI----ESRDNRFRAMAENFR 214
             K   L     + +K       E    R+ A+++   
Sbjct: 195 LDKQKALLADKFDLEKLADPAEREKLIARYVAISDAVN 232



 Score = 90.7 bits (223), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 60/188 (31%), Gaps = 4/188 (2%)

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
              +D +              + FR  I  I+S ++L  D  +  +V+++F +  +    
Sbjct: 17  DATRDKQLDLMRDSAANKRAEEAFRDRIGDISSPEELIADFEVYSFVMRAFDLEDQIFGK 76

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD----KILTDMQIEKI 236
             ++ +L      P        D+RFR M     F  +      D      L D+     
Sbjct: 77  GLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTRFY 136

Query: 237 VSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
              Y N        V     ++   + ++++ + L   KL    Q++L         D  
Sbjct: 137 NRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLASEKLTNFFQVALSLPEQMSALDLD 196

Query: 297 LTLMQEND 304
                  D
Sbjct: 197 KQKALLAD 204



 Score = 70.7 bits (171), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 38/235 (16%), Positives = 88/235 (37%), Gaps = 35/235 (14%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
                 +   + ++  +G I S + L++                   F + A++L  Q  
Sbjct: 28  RDSAANKRAEEAFRDRIGDISSPEELIAD-------------FEVYSFVMRAFDLEDQIF 74

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R +L S+P +P S  N+  D R  +++ A  F  +       +           +
Sbjct: 75  GKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTR 134

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
            Y  +  + +DA+N++  ++ +                 +    + I+++ E+LA++++ 
Sbjct: 135 FYNRQYINENDAQNETVGTVLE-----------------FRDKFSGINNWFEVLASEKLT 177

Query: 528 NFLLESKGIDSQKVREDF-LCEIFKSDLKDPKSFANTYKD----NRYKEIISSFN 577
           NF   +  +  Q    D    +   +D  D +  A+  +      RY  I  + N
Sbjct: 178 NFFQVALSLPEQMSALDLDKQKALLADKFDLEKLADPAEREKLIARYVAISDAVN 232


>gi|89056691|ref|YP_512142.1| flagellar protein, putative [Jannaschia sp. CCS1]
 gi|88866240|gb|ABD57117.1| flagellar protein putative [Jannaschia sp. CCS1]
          Length = 265

 Score =  168 bits (424), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 43/236 (18%), Positives = 79/236 (33%), Gaps = 22/236 (9%)

Query: 482 KSFNSMEQISTQKRINLEIN-SEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
           K   S   +   +     +   + +Y+  NI  + S E+L+ + R+L   L + G+    
Sbjct: 16  KVLQSTLDVQQTRFAEDPVQSRDREYFRENIGAVSSAEDLVGDYRLLRVALGAFGLQDDL 75

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
               F+ ++    + D  + +N   D  Y+    +F F              Q     D 
Sbjct: 76  PNRAFVEKVLSDGVLDDDALSNKLADKTYRAFAEAFGFGSP------LPPLTQGPGFADK 129

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSK 652
               +  Q  E    E+D ++ LAL   R +P I +           +LG   L +V   
Sbjct: 130 ILARFDEQAFEVAVGEQDTDMRLALEATREVPGIASADTSDTTAWLTVLGKPSLRQVFET 189

Query: 653 KLKLSPYFAVLPERKKIRILK-------KHIKINDFKDSKKVEDFLYAAKAMDHQS 701
              L      L   K++   +          +    +D   VED + A       +
Sbjct: 190 AFALPSSIGTLDLDKQLDAFRGGAERVLGSSEFAALQDPTVVEDLVQAFTLQSQAA 245



 Score =  131 bits (330), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 87/226 (38%), Gaps = 21/226 (9%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
            + D+Q       ++DP+ S +  Y+RE I  +S+ ++ + D RL   AL AFGL D   
Sbjct: 20  STLDVQQT---RFAEDPVQSRDREYFRENIGAVSSAEDLVGDYRLLRVALGAFGLQDDLP 76

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP-PKVIQSDIQHKTII----Q 124
              F++K+L   + D  +L N+L    Y+ FA ++ F  P P + Q       I+    +
Sbjct: 77  NRAFVEKVLSDGVLDDDALSNKLADKTYRAFAEAFGFGSPLPPLTQGPGFADKILARFDE 136

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVD--------QLFKDRRLLDYVLQSFSITPK 176
              +    +++  +  +    + +  I S D         +     L      +F++   
Sbjct: 137 QAFEVAVGEQDTDMRLALEATREVPGIASADTSDTTAWLTVLGKPSLRQVFETAFALPSS 196

Query: 177 YISLPFLKDV-----LTLGLANPKKYFIESRDNRFRAMAENFRFQP 217
             +L   K +         +    ++           + + F  Q 
Sbjct: 197 IGTLDLDKQLDAFRGGAERVLGSSEFAALQDPTVVEDLVQAFTLQS 242



 Score = 89.2 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/179 (19%), Positives = 69/179 (38%), Gaps = 9/179 (5%)

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
           D +Q+   ++ V   + +YFR+NI  ++S + L  D RLL   L +F +     +  F++
Sbjct: 23  DVQQTRFAEDPVQSRDREYFRENIGAVSSAEDLVGDYRLLRVALGAFGLQDDLPNRAFVE 82

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNT 244
            VL+ G+ +      +  D  +RA AE F F        +     D  + +     F   
Sbjct: 83  KVLSDGVLDDDALSNKLADKTYRAFAEAFGFGSPLPPLTQGPGFADKILARFDEQAFEVA 142

Query: 245 I-DCVPIVSDQNYYKLAINSVSSFS--------DFLKDPKLFKMLQLSLFPLNPEITAD 294
           + +    +         +  ++S            L  P L ++ + +    +   T D
Sbjct: 143 VGEQDTDMRLALEATREVPGIASADTSDTTAWLTVLGKPSLRQVFETAFALPSSIGTLD 201



 Score = 63.7 bits (153), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 46/276 (16%), Positives = 87/276 (31%), Gaps = 51/276 (18%)

Query: 334 IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           +Q  LD+ +       D       + ++  +G + S ++L+                  L
Sbjct: 18  LQSTLDVQQTRFA--EDPVQSRDREYFRENIGAVSSAEDLVGD-------------YRLL 62

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           + AL A+ L     +R  +  VL+    D D+ +NK  D        AF F +       
Sbjct: 63  RVALGAFGLQDDLPNRAFVEKVLSDGVLDDDALSNKLADKTYRAFAEAFGFGS----PLP 118

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
           P+ Q        +  +  +   +   E           T  R+ LE   EV         
Sbjct: 119 PLTQGPGFADKILARFDEQAFEVAVGEQ---------DTDMRLALEATREVP-------G 162

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEII 573
           I S +   ++      +L           +  L ++F++    P S      D +     
Sbjct: 163 IASAD--TSDTTAWLTVLG----------KPSLRQVFETAFALPSSIGTLDLDKQL---- 206

Query: 574 SSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
            +F       L   +   +QD   ++D    +  Q 
Sbjct: 207 DAFRGGAERVLGSSEFAALQDPTVVEDLVQAFTLQS 242


>gi|221634512|ref|YP_002523200.1| hypothetical protein RSKD131_4487 [Rhodobacter sphaeroides KD131]
 gi|221163385|gb|ACM04347.1| Hypothetical Protein RSKD131_4487 [Rhodobacter sphaeroides KD131]
          Length = 262

 Score =  168 bits (424), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 43/224 (19%), Positives = 81/224 (36%), Gaps = 21/224 (9%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           +ME+       + ++  EV Y+   I T+ + E+L+++ R+L   L + G+      +  
Sbjct: 21  TMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKAL 80

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++      D  + AN   D R+  +  +F+F                    D     Y
Sbjct: 81  IRKVLGEGAADKGALANRLSDKRWLALAKAFDF------GGASGAGTGTAGFADRIAGQY 134

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLS 657
           + Q  E    E D N+ LAL   R +  + +         + +LG + L  V      L 
Sbjct: 135 RTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLP 194

Query: 658 PYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAA 694
             FA L   +++ I +            + F    K E  +   
Sbjct: 195 REFAALDLDRQVEIYQDRAARMFGSGSASQFAAEDKRETLIKTF 238



 Score =  125 bits (313), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 70/176 (39%), Gaps = 13/176 (7%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           +   V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +
Sbjct: 31  QSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGAA 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ-----SDIQHKTIIQDYKQSHQHKEEVAL 138
           D  +L N+L+  ++   A+++DF             +D           ++   + +  L
Sbjct: 91  DKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDANL 150

Query: 139 EESKYFRKNIHKINSVD--------QLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
             +    + +  + S D         +     L      +F +  ++ +L   + V
Sbjct: 151 GLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 83.8 bits (205), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 61/208 (29%), Gaps = 9/208 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            + +    E  YF + I  + + + L  D RLL   L +F +         ++ VL  G 
Sbjct: 30  DQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGA 89

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI-DCVPI 250
           A+         D R+ A+A+ F F              D    +  +  F   I +    
Sbjct: 90  ADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDAN 149

Query: 251 VSDQNYYKLAINSVSS--------FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
           +         + +++S        +   L    L  +   +          D    +   
Sbjct: 150 LGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVEIY 209

Query: 303 NDPIVSQVKYFFQINFHRDNSSSTKIQQ 330
            D             F  ++   T I+ 
Sbjct: 210 QDRAARMFGSGSASQFAAEDKRETLIKT 237



 Score = 63.7 bits (153), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 70/216 (32%), Gaps = 27/216 (12%)

Query: 336 KMLDLYKKNCQILHDDKMQSL--IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           + L    +  +  HD   Q    +  +   +G +++ ++L+S                 L
Sbjct: 16  RFLGRTMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSD-------------YRLL 62

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           + AL A+ L      +  +R VL    +D  + AN+  D R + L  AF+F      G  
Sbjct: 63  KVALGAFGLGEAINGKALIRKVLGEGAADKGALANRLSDKRWLALAKAFDFGGASGAGTG 122

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
               +   I    +  +          N               + +++ E  +++     
Sbjct: 123 TAGFAD-RIAGQYRTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFS----- 176

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
                 +L +  +      + G+  +    D   ++
Sbjct: 177 ------VLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 47.9 bits (112), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/196 (10%), Positives = 55/196 (28%), Gaps = 21/196 (10%)

Query: 235 KIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
           + +    ++      +  +  Y+   I +V +  D + D +L K+   +           
Sbjct: 20  RTMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKA 79

Query: 295 KFLTLMQENDPIVSQVKY--------FFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQ 346
               ++ E       +               F    +S           ++   Y+    
Sbjct: 80  LIRKVLGEGAADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQ-- 137

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD-----AYN 401
                  ++ I +    LG   ++D  ++     +    A+   +    +L      A+ 
Sbjct: 138 -----SFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFG 192

Query: 402 LNMQDLDRDQLRNVLT 417
           L  ++     L   + 
Sbjct: 193 L-PREFAALDLDRQVE 207


>gi|126464886|ref|YP_001041862.1| hypothetical protein Rsph17029_4159 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126106701|gb|ABN79226.1| protein of unknown function DUF1217 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 262

 Score =  168 bits (424), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 43/224 (19%), Positives = 81/224 (36%), Gaps = 21/224 (9%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           +ME+       + ++  EV Y+   I T+ + E+L+++ R+L   L + G+      +  
Sbjct: 21  TMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKAL 80

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++      D  + AN   D R+  +  +F+F                    D     Y
Sbjct: 81  IRKVLGEGAADKGALANRLSDKRWLALAKAFDF------GGTSGAGTGTAGFADRIAGQY 134

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLS 657
           + Q  E    E D N+ LAL   R +  + +         + +LG + L  V      L 
Sbjct: 135 RTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLP 194

Query: 658 PYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAA 694
             FA L   +++ I +            + F    K E  +   
Sbjct: 195 REFAALDLDRQVEIYQDRTARMFGSGSASQFAAEDKRETLIKTF 238



 Score =  125 bits (313), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 70/176 (39%), Gaps = 13/176 (7%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           +   V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +
Sbjct: 31  QSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGAA 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ-----SDIQHKTIIQDYKQSHQHKEEVAL 138
           D  +L N+L+  ++   A+++DF             +D           ++   + +  L
Sbjct: 91  DKGALANRLSDKRWLALAKAFDFGGTSGAGTGTAGFADRIAGQYRTQSFEAAIGEVDANL 150

Query: 139 EESKYFRKNIHKINSVD--------QLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
             +    + +  + S D         +     L      +F +  ++ +L   + V
Sbjct: 151 GLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 84.5 bits (207), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 61/208 (29%), Gaps = 9/208 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            + +    E  YF + I  + + + L  D RLL   L +F +         ++ VL  G 
Sbjct: 30  DQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGA 89

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI-DCVPI 250
           A+         D R+ A+A+ F F              D    +  +  F   I +    
Sbjct: 90  ADKGALANRLSDKRWLALAKAFDFGGTSGAGTGTAGFADRIAGQYRTQSFEAAIGEVDAN 149

Query: 251 VSDQNYYKLAINSVSS--------FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
           +         + +++S        +   L    L  +   +          D    +   
Sbjct: 150 LGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVEIY 209

Query: 303 NDPIVSQVKYFFQINFHRDNSSSTKIQQ 330
            D             F  ++   T I+ 
Sbjct: 210 QDRTARMFGSGSASQFAAEDKRETLIKT 237



 Score = 64.1 bits (154), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 70/216 (32%), Gaps = 27/216 (12%)

Query: 336 KMLDLYKKNCQILHDDKMQSL--IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           + L    +  +  HD   Q    +  +   +G +++ ++L+S                 L
Sbjct: 16  RFLGRTMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSD-------------YRLL 62

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           + AL A+ L      +  +R VL    +D  + AN+  D R + L  AF+F      G  
Sbjct: 63  KVALGAFGLGEAINGKALIRKVLGEGAADKGALANRLSDKRWLALAKAFDFGGTSGAGTG 122

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
               +   I    +  +          N               + +++ E  +++     
Sbjct: 123 TAGFAD-RIAGQYRTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFS----- 176

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
                 +L +  +      + G+  +    D   ++
Sbjct: 177 ------VLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 47.9 bits (112), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/196 (10%), Positives = 55/196 (28%), Gaps = 21/196 (10%)

Query: 235 KIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
           + +    ++      +  +  Y+   I +V +  D + D +L K+   +           
Sbjct: 20  RTMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKA 79

Query: 295 KFLTLMQENDPIVSQVKY--------FFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQ 346
               ++ E       +               F    +S           ++   Y+    
Sbjct: 80  LIRKVLGEGAADKGALANRLSDKRWLALAKAFDFGGTSGAGTGTAGFADRIAGQYRTQ-- 137

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD-----AYN 401
                  ++ I +    LG   ++D  ++     +    A+   +    +L      A+ 
Sbjct: 138 -----SFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFG 192

Query: 402 LNMQDLDRDQLRNVLT 417
           L  ++     L   + 
Sbjct: 193 L-PREFAALDLDRQVE 207


>gi|83955108|ref|ZP_00963764.1| hypothetical protein NAS141_03346 [Sulfitobacter sp. NAS-14.1]
 gi|83840437|gb|EAP79610.1| hypothetical protein NAS141_03346 [Sulfitobacter sp. NAS-14.1]
          Length = 274

 Score =  168 bits (424), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 84/204 (41%), Gaps = 3/204 (1%)

Query: 495 RINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDL 554
           R +       + +   I  I S EEL+A+  + +F++ +  ++ Q   +  + ++ +SD 
Sbjct: 28  RDSAANKRAEEAFRNRIGDISSPEELIADFEVYSFVMRAFDLEDQIFGKGLIRKMLESDP 87

Query: 555 KDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKE 614
            +P S  N   D+R++E+  +  F    E   +       +F  D T   Y  Q I + +
Sbjct: 88  VEPSSLLNRLTDSRFREMHLALGFTT--EAGPQTPDLTDPDFLNDVTTRFYNRQYINEND 145

Query: 615 EEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKK 674
             ++  +   L F+     I N +E+L + KL       L L    + L   K+  +L  
Sbjct: 146 A-QNETVGTVLEFRDKFSGINNWFEVLANEKLTNFFQVALSLPEQMSALDLDKQKALLAD 204

Query: 675 HIKINDFKDSKKVEDFLYAAKAMD 698
              +    D  + E+ +    A+ 
Sbjct: 205 KFDLEKLADPAERENLIARYVAIS 228



 Score =  127 bits (319), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 46/218 (21%), Positives = 95/218 (43%), Gaps = 16/218 (7%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
            ++D Q  L    + +      E  +R RI  IS+ +E I D  ++S+ ++AF L D   
Sbjct: 18  ATRDKQLDLMRDSAAN---KRAEEAFRNRIGDISSPEELIADFEVYSFVMRAFDLEDQIF 74

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP-----PKVIQSDIQHKTIIQ 124
            +  I+K+LESD  +P SL+N+L   +++    +  F+       P +   D  +    +
Sbjct: 75  GKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTR 134

Query: 125 DYKQSHQHKEEVALEESKY---FRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLP 181
            Y + + ++ +   E       FR     IN+  ++  + +L ++   + S+  +  +L 
Sbjct: 135 FYNRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLANEKLTNFFQVALSLPEQMSALD 194

Query: 182 FLK-DVLTLGLANPKKYFI----ESRDNRFRAMAENFR 214
             K   L     + +K       E+   R+ A+++   
Sbjct: 195 LDKQKALLADKFDLEKLADPAERENLIARYVAISDAVN 232



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 61/188 (32%), Gaps = 4/188 (2%)

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
              +D +              + FR  I  I+S ++L  D  +  +V+++F +  +    
Sbjct: 17  DATRDKQLDLMRDSAANKRAEEAFRNRIGDISSPEELIADFEVYSFVMRAFDLEDQIFGK 76

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD----KILTDMQIEKI 236
             ++ +L      P        D+RFR M     F  +      D      L D+     
Sbjct: 77  GLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTRFY 136

Query: 237 VSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
              Y N        V     ++   + ++++ + L + KL    Q++L         D  
Sbjct: 137 NRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLANEKLTNFFQVALSLPEQMSALDLD 196

Query: 297 LTLMQEND 304
                  D
Sbjct: 197 KQKALLAD 204



 Score = 74.9 bits (182), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 41/237 (17%), Positives = 87/237 (36%), Gaps = 39/237 (16%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
                 +   + ++  +G I S + L++                   F + A++L  Q  
Sbjct: 28  RDSAANKRAEEAFRNRIGDISSPEELIAD-------------FEVYSFVMRAFDLEDQIF 74

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R +L S+P +P S  N+  D R  +++ A  F  +       +           +
Sbjct: 75  GKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTR 134

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
            Y  +  + +DA+N++  ++ +                 +    + I+++ E+LAN+++ 
Sbjct: 135 FYNRQYINENDAQNETVGTVLE-----------------FRDKFSGINNWFEVLANEKLT 177

Query: 528 NFLLESKGIDSQKVREDF-LCEIFKSD------LKDPKSFANTYKDNRYKEIISSFN 577
           NF   +  +  Q    D    +   +D      L DP    N     RY  I  + N
Sbjct: 178 NFFQVALSLPEQMSALDLDKQKALLADKFDLEKLADPAERENLIA--RYVAISDAVN 232


>gi|260574408|ref|ZP_05842412.1| protein of unknown function DUF1217 [Rhodobacter sp. SW2]
 gi|259023304|gb|EEW26596.1| protein of unknown function DUF1217 [Rhodobacter sp. SW2]
          Length = 267

 Score =  166 bits (421), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 87/224 (38%), Gaps = 21/224 (9%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           +M               E +Y+  NI  I + E L++++++L   L + G+D+    + F
Sbjct: 21  TMTTQKAAFAAVSTSKREEEYFRANIGKIKTAEALVSDRKLLKVALGAFGLDADINSKAF 80

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++ +       + AN   D +Y+   + F F            + Q +   D+    Y
Sbjct: 81  IQKVLEGGTLKTGALANKLADKQYQAFSAGFGFG------DFATPRTQLSTFADEILTAY 134

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNHYEILGDSKLFKVVSKKLKLS 657
           K++  E    E++ ++ LA+  +R +  +           + ++G   L  V  K   L 
Sbjct: 135 KNRQFETAVGEQNDDMRLAMNVERELVTLAGKSTTEDAKWFTVMGSKPLRAVFEKAFGLP 194

Query: 658 PYFAVLPERKKIRILKKHIK-------INDFKDSKKVEDFLYAA 694
              A L   +++ + K           ++ F D+ K++  +   
Sbjct: 195 SSLAALDLDQQLSVFKSAANKAFGATSVSQFADTTKLDKLVKQF 238



 Score =  113 bits (282), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/217 (18%), Positives = 72/217 (33%), Gaps = 15/217 (6%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           +  +      K   +   +  +       EE Y+R  I  I T +  + D++L   AL A
Sbjct: 9   LGGYAGWSLLKRTMTTQKAAFAAVSTSKREEEYFRANIGKIKTAEALVSDRKLLKVALGA 68

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKV-IQSDIQHK 120
           FGL    +++ FI+K+LE       +L N+L   +YQ F+  + F        Q      
Sbjct: 69  FGLDADINSKAFIQKVLEGGTLKTGALANKLADKQYQAFSAGFGFGDFATPRTQLSTFAD 128

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS- 179
            I+  YK            +      N+           +R L+    +S +   K+ + 
Sbjct: 129 EILTAYKNRQFETAVGEQNDDMRLAMNV-----------ERELVTLAGKSTTEDAKWFTV 177

Query: 180 --LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
                L+ V       P        D +         
Sbjct: 178 MGSKPLRAVFEKAFGLPSSLAALDLDQQLSVFKSAAN 214



 Score = 77.2 bits (188), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 37/245 (15%), Positives = 81/245 (33%), Gaps = 19/245 (7%)

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
             +++       +  E +YFR NI KI + + L  DR+LL   L +F +     S  F++
Sbjct: 23  TTQKAAFAAVSTSKREEEYFRANIGKIKTAEALVSDRKLLKVALGAFGLDADINSKAFIQ 82

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD----MQIEKIVSNY 240
            VL  G         +  D +++A +  F F    +   +     D        +     
Sbjct: 83  KVLEGGTLKTGALANKLADKQYQAFSAGFGFGDFATPRTQLSTFADEILTAYKNRQFETA 142

Query: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSD-----FLKDPKLFKMLQLSLFPLNPEITADK 295
                D + +  +     + +   S+  D      +    L  + + +    +     D 
Sbjct: 143 VGEQNDDMRLAMNVERELVTLAGKSTTEDAKWFTVMGSKPLRAVFEKAFGLPSSLAALDL 202

Query: 296 FLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS 355
                   D  +S  K      F    +S ++    +++ K++  +    ++       S
Sbjct: 203 --------DQQLSVFKSAANKAFGA--TSVSQFADTTKLDKLVKQFLIRSEVAAGMTSTS 252

Query: 356 LIKDY 360
              + 
Sbjct: 253 GASNA 257



 Score = 58.7 bits (140), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 42/302 (13%), Positives = 93/302 (30%), Gaps = 51/302 (16%)

Query: 332 SQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPII 391
           S +++ +   K     +   K +   + ++  +GKIK+ + L+S +              
Sbjct: 16  SLLKRTMTTQKAAFAAVSTSKRE--EEYFRANIGKIKTAEALVSDRK------------- 60

Query: 392 TLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIG 451
            L+ AL A+ L+     +  ++ VL        + ANK  D +    +  F F   G   
Sbjct: 61  LLKVALGAFGLDADINSKAFIQKVLEGGTLKTGALANKLADKQYQAFSAGFGF---GDFA 117

Query: 452 PIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNI 511
                 ++L+   +    A + R    A  +  + M      +R  + +  +        
Sbjct: 118 TPR---TQLSTFADEILTAYKNRQFETAVGEQNDDMRLAMNVERELVTLAGKSTTEDAKW 174

Query: 512 NTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKE 571
            T+      + +K +     ++ G+                    P S A    D +   
Sbjct: 175 FTV------MGSKPLRAVFEKAFGL--------------------PSSLAALDLDQQL-- 206

Query: 572 IISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTI 631
             S F    +       + +  D   +D     +  +             + AL   + +
Sbjct: 207 --SVFKSAANKAFGATSVSQFADTTKLDKLVKQFLIRSEVAAGMTSTSGASNALQLLQAM 264

Query: 632 PN 633
             
Sbjct: 265 QG 266



 Score = 41.8 bits (96), Expect = 0.40,   Method: Composition-based stats.
 Identities = 35/263 (13%), Positives = 77/263 (29%), Gaps = 34/263 (12%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           +++ ++              ++ Y++  I  + +    + D KL K+  L  F L+ +I 
Sbjct: 18  LKRTMTTQKAAFAAVSTSKREEEYFRANIGKIKTAEALVSDRKLLKV-ALGAFGLDADIN 76

Query: 293 ADKFLTLMQENDPIVSQVKY---------FFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           +  F+  + E   + +              F   F   + ++ + Q  +   ++L  YK 
Sbjct: 77  SKAFIQKVLEGGTLKTGALANKLADKQYQAFSAGFGFGDFATPRTQLSTFADEILTAYKN 136

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
                     ++ + +    +    +++  L           A+   +     L A    
Sbjct: 137 RQ-------FETAVGEQNDDMRLAMNVERELVTLAGKSTTEDAKWFTVMGSKPLRA---- 185

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
                      V       P S A    D +L     A N         +        + 
Sbjct: 186 -----------VFEKAFGLPSSLAALDLDQQLSVFKSAAN--KAFGATSVSQFADTTKLD 232

Query: 464 DNVKHYANRKRSIHDAENKSFNS 486
             VK +  R        + S  S
Sbjct: 233 KLVKQFLIRSEVAAGMTSTSGAS 255


>gi|125654647|ref|YP_001033841.1| flagellar basal-body rod protein FLGF [Rhodobacter sphaeroides
           2.4.1]
 gi|77386307|gb|ABA81736.1| possible flagellar basal-body ROD protein FLGF [Rhodobacter
           sphaeroides 2.4.1]
          Length = 262

 Score =  166 bits (420), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 80/224 (35%), Gaps = 21/224 (9%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           +ME+       + ++  EV Y+   I T+ + E+L+++ R+L   L + G+      +  
Sbjct: 21  TMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKAL 80

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++      D  + AN   D R+  +  +F+F                    D     Y
Sbjct: 81  IRKVLNEGAADKGALANRLSDKRWLALAKAFDF------GGASGAGTGTAGFADRIAGQY 134

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLS 657
           + Q  E    E D N+ LAL     +  + +         + +LG + L  V      L 
Sbjct: 135 RTQSFEAAIGEVDANLGLALTLDHEMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLP 194

Query: 658 PYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAA 694
             FA L   +++ I +            + F    K E  +   
Sbjct: 195 REFAALDLDRQVEIYQDRTARMFGSGSASQFAAEDKRETLIKTF 238



 Score =  124 bits (311), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 33/176 (18%), Positives = 69/176 (39%), Gaps = 13/176 (7%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           +   V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +
Sbjct: 31  QSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGAA 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ-----SDIQHKTIIQDYKQSHQHKEEVAL 138
           D  +L N+L+  ++   A+++DF             +D           ++   + +  L
Sbjct: 91  DKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDANL 150

Query: 139 EESKYFRKNIHKINSVD--------QLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
             +      +  + S D         +     L      +F +  ++ +L   + V
Sbjct: 151 GLALTLDHEMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 83.8 bits (205), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/208 (15%), Positives = 61/208 (29%), Gaps = 9/208 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            + +    E  YF + I  + + + L  D RLL   L +F +         ++ VL  G 
Sbjct: 30  DQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGA 89

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI-DCVPI 250
           A+         D R+ A+A+ F F              D    +  +  F   I +    
Sbjct: 90  ADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDAN 149

Query: 251 VSDQNYYKLAINSVSS--------FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
           +         + +++S        +   L    L  +   +          D    +   
Sbjct: 150 LGLALTLDHEMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVEIY 209

Query: 303 NDPIVSQVKYFFQINFHRDNSSSTKIQQ 330
            D             F  ++   T I+ 
Sbjct: 210 QDRTARMFGSGSASQFAAEDKRETLIKT 237



 Score = 65.3 bits (157), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 70/216 (32%), Gaps = 27/216 (12%)

Query: 336 KMLDLYKKNCQILHDDKMQSL--IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           + L    +  +  HD   Q    +  +   +G +++ ++L+S                 L
Sbjct: 16  RFLGRTMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSD-------------YRLL 62

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           + AL A+ L      +  +R VL    +D  + AN+  D R + L  AF+F      G  
Sbjct: 63  KVALGAFGLGEAINGKALIRKVLNEGAADKGALANRLSDKRWLALAKAFDFGGASGAGTG 122

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
               +   I    +  +          N               + +++ E  +++     
Sbjct: 123 TAGFAD-RIAGQYRTQSFEAAIGEVDANLGLALTLDHEMATLASDDMSEEAKWFS----- 176

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
                 +L +  +      + G+  +    D   ++
Sbjct: 177 ------VLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 47.6 bits (111), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/196 (10%), Positives = 56/196 (28%), Gaps = 21/196 (10%)

Query: 235 KIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
           + +    ++      +  +  Y+   I +V +  D + D +L K+   +           
Sbjct: 20  RTMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKA 79

Query: 295 KFLTLMQENDPIVSQVKY--------FFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQ 346
               ++ E       +               F    +S           ++   Y+    
Sbjct: 80  LIRKVLNEGAADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQ-- 137

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD-----AYN 401
                  ++ I +    LG   ++D+ ++     +    A+   +    +L      A+ 
Sbjct: 138 -----SFEAAIGEVDANLGLALTLDHEMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFG 192

Query: 402 LNMQDLDRDQLRNVLT 417
           L  ++     L   + 
Sbjct: 193 L-PREFAALDLDRQVE 207


>gi|56698279|ref|YP_168652.1| flagellar protein, putative [Ruegeria pomeroyi DSS-3]
 gi|56680016|gb|AAV96682.1| flagellar protein, putative [Ruegeria pomeroyi DSS-3]
          Length = 265

 Score =  165 bits (418), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 91/240 (37%), Gaps = 22/240 (9%)

Query: 484 FNSMEQISTQKRINLEI-NSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVR 542
                    Q   N  + N E  Y+   I  + + E+L++++R+L   L + G++     
Sbjct: 18  LQRTYDAQAQSFSNSTVRNRESSYFMEKIGQVKTAEDLVSDRRLLQVALGAFGLEDDLNN 77

Query: 543 EDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTC 602
             F+ +I +       + AN   D RY+E   +F     GE+    +        ++D  
Sbjct: 78  TYFVRKILEDGTTSSDALANKLSDKRYREFSKAFGLGP-GEIRTTGLVT-----FMEDIV 131

Query: 603 DLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKL 654
              +    E+    +D  + +ALY +  +  + +         + ++G   L K++   L
Sbjct: 132 AKNEAAGFEQAVGAQDETMRIALYAQHELKALADDRSSDNAKWFSLMGIPPLRKMMETAL 191

Query: 655 KLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQSIDYKKA 707
            L      +   K++ I +  +       +++ F D + VE    A  A    +  +  +
Sbjct: 192 GLPSGLGSVDIDKQLEIFQDKLQRLTGSPQVSQFTDPEMVEKVTIAYLARSQINSQFAGS 251



 Score =  132 bits (332), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 50/260 (19%), Positives = 105/260 (40%), Gaps = 18/260 (6%)

Query: 1   MIPSHVAPFP----SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFS 56
           +I   +A +     + D Q++ FS      + + E  Y+ E+I  + T ++ + D+RL  
Sbjct: 7   LISGGIAGWRFLQRTYDAQAQSFS---NSTVRNRESSYFMEKIGQVKTAEDLVSDRRLLQ 63

Query: 57  YALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD 116
            AL AFGL D  +   F++KILE   +   +L N+L+  +Y+ F++++   P        
Sbjct: 64  VALGAFGLEDDLNNTYFVRKILEDGTTSSDALANKLSDKRYREFSKAFGLGPGEIRTTGL 123

Query: 117 IQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
           +     I    ++   ++ V  ++ +  R  ++  + +  L  DR   +    S      
Sbjct: 124 VTFMEDIVAKNEAAGFEQAVGAQD-ETMRIALYAQHELKALADDRSSDNAKWFSL----- 177

Query: 177 YISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQ-IEK 235
            + +P L+ ++   L  P        D +     +  +     + S +    TD + +EK
Sbjct: 178 -MGIPPLRKMMETALGLPSGLGSVDIDKQLEIFQDKLQ---RLTGSPQVSQFTDPEMVEK 233

Query: 236 IVSNYFNNTIDCVPIVSDQN 255
           +   Y   +           
Sbjct: 234 VTIAYLARSQINSQFAGSSA 253



 Score = 84.9 bits (208), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 43/250 (17%), Positives = 79/250 (31%), Gaps = 19/250 (7%)

Query: 125 DYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
           D +        V   ES YF + I ++ + + L  DRRLL   L +F +     +  F++
Sbjct: 23  DAQAQSFSNSTVRNRESSYFMEKIGQVKTAEDLVSDRRLLQVALGAFGLEDDLNNTYFVR 82

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNT 244
            +L  G  +      +  D R+R  ++ F   P    +       +  + K  +  F   
Sbjct: 83  KILEDGTTSSDALANKLSDKRYREFSKAFGLGPGEIRTTGLVTFMEDIVAKNEAAGFEQA 142

Query: 245 IDCVPIVSDQNYYKLA----INSVSSFSD-----FLKDPKLFKMLQLSLFPLNPEITADK 295
           +           Y       +    S  +      +  P L KM++ +L   +   + D 
Sbjct: 143 VGAQDETMRIALYAQHELKALADDRSSDNAKWFSLMGIPPLRKMMETALGLPSGLGSVDI 202

Query: 296 FLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS 355
              L    D +           F               ++K+   Y    QI       S
Sbjct: 203 DKQLEIFQDKLQRLTGSPQVSQFTD----------PEMVEKVTIAYLARSQINSQFAGSS 252

Query: 356 LIKDYQLPLG 365
             ++    LG
Sbjct: 253 AAQNALTLLG 262



 Score = 66.4 bits (160), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 50/146 (34%), Gaps = 15/146 (10%)

Query: 334 IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           +Q+  D   ++         +S    +   +G++K+ ++L+S +               L
Sbjct: 18  LQRTYDAQAQSFSNSTVRNRES--SYFMEKIGQVKTAEDLVSDRR-------------LL 62

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           Q AL A+ L     +   +R +L    +  D+ ANK  D R  + + AF           
Sbjct: 63  QVALGAFGLEDDLNNTYFVRKILEDGTTSSDALANKLSDKRYREFSKAFGLGPGEIRTTG 122

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDA 479
            +      +  N      +     D 
Sbjct: 123 LVTFMEDIVAKNEAAGFEQAVGAQDE 148



 Score = 39.1 bits (89), Expect = 3.2,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 30/78 (38%), Gaps = 1/78 (1%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           +++       +  +      + +Y+   I  V +  D + D +L ++  L  F L  ++ 
Sbjct: 18  LQRTYDAQAQSFSNSTVRNRESSYFMEKIGQVKTAEDLVSDRRLLQV-ALGAFGLEDDLN 76

Query: 293 ADKFLTLMQENDPIVSQV 310
              F+  + E+    S  
Sbjct: 77  NTYFVRKILEDGTTSSDA 94


>gi|163733161|ref|ZP_02140605.1| flagellar protein, putative [Roseobacter litoralis Och 149]
 gi|161393696|gb|EDQ18021.1| flagellar protein, putative [Roseobacter litoralis Och 149]
          Length = 262

 Score =  165 bits (417), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 47/232 (20%), Positives = 98/232 (42%), Gaps = 23/232 (9%)

Query: 497 NLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKD 556
           + ++    +Y+   I+++ + EEL+A++R+    L + G+        F+ ++ +    +
Sbjct: 31  SSQLARAAEYFEEKISSVTTAEELVADRRLREVALGAFGLQDDIDNRFFIKKVLEEGTTN 90

Query: 557 PKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEE 616
             S AN + D+RYK+  ++F      +L      K+QD     D    Y+    E     
Sbjct: 91  EDSLANRFSDSRYKDFSAAFGLGPGEQL------KLQDTGFAQDIIAKYRANSFEIATGS 144

Query: 617 KDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKK 668
           +D ++ +AL+ +R IP +           + I+G   L  V  K L L   F  +   ++
Sbjct: 145 QDDSMRVALFAQREIPALATDDTSNDAKWFGIMGQPPLRAVFEKALNLPSSFGQIDIDQQ 204

Query: 669 IRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPN 713
           + + K+         +++ F   + V+D +          +D   A  SS +
Sbjct: 205 LVVFKERSRAVFGTDEVSQFAGDEAVQDLVTKYIVRSQ--LDSFNANTSSAS 254



 Score =  122 bits (306), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/257 (19%), Positives = 95/257 (36%), Gaps = 18/257 (7%)

Query: 3   PSHVAPF-PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
            + +  +   +      F+  ++   ++    Y+ E+I  ++T +E + D+RL   AL A
Sbjct: 8   STGLTGWRFLQRTYDSQFAAFNQSSQLARAAEYFEEKISSVTTAEELVADRRLREVALGA 67

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKV-IQSDIQHK 120
           FGL D      FIKK+LE   ++  SL N+ +  +Y+ F+ ++   P  ++ +Q     +
Sbjct: 68  FGLQDDIDNRFFIKKVLEEGTTNEDSLANRFSDSRYKDFSAAFGLGPGEQLKLQDTGFAQ 127

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYI-- 178
            II  Y+ +       + ++S               LF  R +        S   K+   
Sbjct: 128 DIIAKYRANSFEIATGSQDDSMRVA-----------LFAQREIPALATDDTSNDAKWFGI 176

Query: 179 -SLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR--FQPDGSLSKRDKILTDMQIEK 235
              P L+ V    L  P  +     D +     E  R  F  D              + K
Sbjct: 177 MGQPPLRAVFEKALNLPSSFGQIDIDQQLVVFKERSRAVFGTDEVSQFAGDEAVQDLVTK 236

Query: 236 IVSNYFNNTIDCVPIVS 252
            +     ++ +     +
Sbjct: 237 YIVRSQLDSFNANTSSA 253



 Score = 78.8 bits (192), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 72/204 (35%), Gaps = 9/204 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
           ++       ++YF + I  + + ++L  DRRL +  L +F +     +  F+K VL  G 
Sbjct: 29  NQSSQLARAAEYFEEKISSVTTAEELVADRRLREVALGAFGLQDDIDNRFFIKKVLEEGT 88

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDCVPI 250
            N         D+R++  +  F   P   L  +D       I K  +N F   T      
Sbjct: 89  TNEDSLANRFSDSRYKDFSAAFGLGPGEQLKLQDTGFAQDIIAKYRANSFEIATGSQDDS 148

Query: 251 VSDQNYYKLAINSVSS--------FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
           +    + +  I ++++        +   +  P L  + + +L   +     D    L+  
Sbjct: 149 MRVALFAQREIPALATDDTSNDAKWFGIMGQPPLRAVFEKALNLPSSFGQIDIDQQLVVF 208

Query: 303 NDPIVSQVKYFFQINFHRDNSSST 326
            +   +         F  D +   
Sbjct: 209 KERSRAVFGTDEVSQFAGDEAVQD 232



 Score = 62.6 bits (150), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/140 (15%), Positives = 48/140 (34%), Gaps = 19/140 (13%)

Query: 334 IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
           +Q+  D            ++    + ++  +  + + + L++ +                
Sbjct: 17  LQRTYDSQFAAFN--QSSQLARAAEYFEEKISSVTTAEELVADRR-------------LR 61

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           + AL A+ L     +R  ++ VL    ++ DS AN+  D R    + AF        G  
Sbjct: 62  EVALGAFGLQDDIDNRFFIKKVLEEGTTNEDSLANRFSDSRYKDFSAAFGLGP----GEQ 117

Query: 454 PMMQSRLTIRDNVKHYANRK 473
             +Q     +D +  Y    
Sbjct: 118 LKLQDTGFAQDIIAKYRANS 137



 Score = 44.1 bits (102), Expect = 0.