BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781009|ref|YP_003065422.1| hypothetical protein
CLIBASIA_04555 [Candidatus Liberibacter asiaticus str. psy62]
         (750 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781009|ref|YP_003065422.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040686|gb|ACT57482.1| hypothetical protein CLIBASIA_04555 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 750

 Score =  715 bits (1846), Expect = 0.0,   Method: Composition-based stats.
 Identities = 750/750 (100%), Positives = 750/750 (100%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK
Sbjct: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK
Sbjct: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
           TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL
Sbjct: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
           PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY
Sbjct: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240

Query: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM 300
           FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM
Sbjct: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM 300

Query: 301 QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY 360
           QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY
Sbjct: 301 QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY 360

Query: 361 QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP 420
           QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP
Sbjct: 361 QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP 420

Query: 421 SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE 480
           SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE
Sbjct: 421 SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE 480

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
           NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK
Sbjct: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
           VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD
Sbjct: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660
           TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF
Sbjct: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660

Query: 661 AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN 720
           AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN
Sbjct: 661 AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN 720

Query: 721 NSFDDPQNNVSLQLSPQKKSNGRFSILNLF 750
           NSFDDPQNNVSLQLSPQKKSNGRFSILNLF
Sbjct: 721 NSFDDPQNNVSLQLSPQKKSNGRFSILNLF 750


>gi|15889789|ref|NP_355470.1| hypothetical protein Atu2524 [Agrobacterium tumefaciens str. C58]
 gi|15157715|gb|AAK88255.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 774

 Score =  618 bits (1592), Expect = e-174,   Method: Composition-based stats.
 Identities = 221/795 (27%), Positives = 371/795 (46%), Gaps = 97/795 (12%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+P++      +++++S L   V+ DPI+S + +YY + I  + ++D F+KD +L+SYA+
Sbjct: 1   MLPAYTTYALYNRNMESSL-KRVANDPIISRDAKYYADNIGKVKSLDAFLKDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP--PPKVIQSDI 117
           KA GL +M++A  F+KK+LES+L DP S VN+L   +Y+ FA ++DF      K +Q+  
Sbjct: 60  KAHGLEEMTYATAFMKKVLESNLKDPNSFVNKLKDTRYRDFAAAFDFGTIKTEKTVQTKS 119

Query: 118 QHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           Q   ++  Y  + + + E   EE++Y+   I K+  VD +FK+ RL +YV +SF I P+ 
Sbjct: 120 QQDRLVTAYHDTDKQRNEEQKEETRYYNIVIDKVGQVDDIFKNTRLRNYVFKSFGIDPQT 179

Query: 178 ISLPFLKDVLTLGLANPKKYFIE------------------------------------- 200
                LK VLT  ++    Y                                        
Sbjct: 180 FDYQHLKGVLTSDISKADSYVNSTYKPLLEEWQAKIADLRDQRTKIPSTDKTSLEKNDYL 239

Query: 201 --------SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPI 250
                   +   +   +A  F F+ DG ++   K  T +Q      NY   N  +     
Sbjct: 240 INQYNKRINGAAKLFELAATFNFRADGLVNDGTKAQTAVQKRLTNENYVLANPRVTQTGA 299

Query: 251 VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIV--- 307
           + +++++  A+  V+       + +L  ML ++    +   T  K    ++EN       
Sbjct: 300 ILNRDFFVQAMKDVTDAGQLTANSRLRTMLIVAFNLEDNSGTDQKIQWALRENPADPQSG 359

Query: 308 -------SQVKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK 358
                    +      NF  D   ++   +Q D Q+  +++LY        +   +  IK
Sbjct: 360 LYREKDKGFIDLAKAFNFGTDGKVAAGKAVQSDGQLSTIMNLYFSRYDDKQEAADEKTIK 419

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
           DY+  +G  K++D+ LS         +A   +    FAL A+N+  ++    +L+ V TS
Sbjct: 420 DYRRYIGLTKNLDDFLS---------AAPAAVAIRNFALKAFNIGTEESSTFKLKKVFTS 470

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
           + S+P SY    KDDR ++L  AFNF+A G IG     Q+   I    ++Y         
Sbjct: 471 DLSNPKSYVYTLKDDRFLRLAKAFNFDAQGKIGSPRFAQAENEIARISRNYLKEVTR--- 527

Query: 479 AENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDS 538
                          K+I  +   EV YY   + T+ + ++LLA++R+L+F+L ++ ID 
Sbjct: 528 -----------WDKDKKIREKGEKEVGYYREKMGTLETADQLLADRRLLDFMLVAERIDP 576

Query: 539 QKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHI 598
           + +  D+L +IFKSDLKDPKSFANT KD R++ +  SFNFD  G +S      +Q+N  +
Sbjct: 577 KSITTDYLKKIFKSDLKDPKSFANTEKDPRFRALAGSFNFDAKGNISATTRQPIQNNRSL 636

Query: 599 DDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
            +T D Y  Q +E++  E++  + LALYFKR    I + Y+IL D  L +V    L +  
Sbjct: 637 METRDKYVRQKLEERAGEENSGVRLALYFKRMAGGISSAYDILADKALSEVTRTALGIPA 696

Query: 659 YFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDP 718
             A      + ++++K +KI D +D KKVE  +                 F + N   DP
Sbjct: 697 ETANAKVDAQAKMIEKRLKIKDLQDPKKVEKLVNRFLM-----------TFEANNSGSDP 745

Query: 719 WNNSFDDPQNNVSLQ 733
               F     ++S  
Sbjct: 746 RIALFRQGSASISGN 760


>gi|222147731|ref|YP_002548688.1| hypothetical protein Avi_0969 [Agrobacterium vitis S4]
 gi|221734719|gb|ACM35682.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 727

 Score =  595 bits (1533), Expect = e-167,   Method: Composition-based stats.
 Identities = 221/737 (29%), Positives = 361/737 (48%), Gaps = 48/737 (6%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +++     ++D+++ L   VS++P V+ E++YY+E I  + T+D+F+ D RL+ Y +
Sbjct: 1   MVSTYIGYDLVNRDMKASL-KRVSQEPEVAREQKYYQENIGKVKTVDDFMNDDRLYQYTM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA GL DM++A+ F+KK+LESDLSD  S  N+L   +Y+ FARS++FS     IQ+D Q 
Sbjct: 60  KANGLEDMTYAKAFMKKVLESDLSDEDSYANKLADDRYRDFARSFNFSAETADIQTDKQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           + +I  YKQS   + + A EE +Y+   I K+ +VD L K+ RL  +VL+S+ +  KY S
Sbjct: 120 EDVIGLYKQSLVTEGDDAKEEVQYYDSAIDKVTNVDDLLKNSRLTKFVLESYGLDTKYYS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNR--FRAMAENFRFQPDGSLSKRDKILTDMQIEKIV 237
              LK VLT  + +   Y      N+  +  +A+ F F  DGSL K     T  Q   + 
Sbjct: 180 TDHLKKVLTSDVNDSTSYVNTLTTNKSDYVNIAKAFSFNTDGSL-KNATAQTSDQKTAME 238

Query: 238 SNYFNN---TIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITA- 293
             Y      T        +  YYK  I +V+  SD   D +LF  ++ +L      + + 
Sbjct: 239 DLYLEEVPSTETAYQAEREAAYYKEKIATVTKASDITGDSRLFSYVKTALGMDKNTLKST 298

Query: 294 -----DKFLTLMQENDPIVSQVKYFFQ-----INFHRDNSS-STKIQQDSQIQKMLDLYK 342
                   L           +VK  +       NF    ++ +   Q ++Q+ +    Y 
Sbjct: 299 FENIVTSDLNDANSYANTQGKVKGEYAKIAAMFNFDTSGNATAGNAQSETQLSQTATAYM 358

Query: 343 KNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNL 402
            N        + SL   Y   +  I  +D+LL                      + AY +
Sbjct: 359 TNYDDEDQANLSSLTTYYSTQMKSITKVDDLLGN-------------EKIYDMVMKAYGI 405

Query: 403 NMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTI 462
              +  +  L+ VLTS+ +DP SYANK++D+RLI L  AFNF  DG+     + QS  TI
Sbjct: 406 ETDEFSKADLKKVLTSDMNDPKSYANKTRDERLISLASAFNFKEDGTADVPLLAQSERTI 465

Query: 463 RDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLA 522
            +  K Y  +K    + + ++                   +  YY  NI  + S  +LL 
Sbjct: 466 TEVAKDYIVQKTRFLEGKEQTD-----------AKTAAEEDSKYYQENIVKVSSVTDLLK 514

Query: 523 NKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHG 582
           ++++++F L ++G+D + V +D L ++F SDL DPKSFANT  D  Y + ++S+NFD  G
Sbjct: 515 DRKLVDFALTAQGLDPKDVSDDMLKQLFSSDLTDPKSFANTQADEGYAKFVASYNFDSSG 574

Query: 583 ELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILG 642
           ++S +    VQ+     +T +LY HQ +E ++ E D  + LALY+ R    I + Y+ILG
Sbjct: 575 KISQENADGVQNRSETFNTENLYLHQTLENEQGESDQGVRLALYWDRMSSTITSAYDILG 634

Query: 643 DSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSI 702
           D+ L +V      L    + +   ++ ++++K + + D  D +K + FL    AM     
Sbjct: 635 DTALLEVFRTAYSLPSDMSNMDIEQQKKVIEKKMDLKDLSDPEKQKKFLQRFTAM----Y 690

Query: 703 DYKKALFSSPNQNKDPW 719
           D +    SS N      
Sbjct: 691 DLENNTGSSANAALTIL 707


>gi|325293876|ref|YP_004279740.1| hypothetical protein AGROH133_08567 [Agrobacterium sp. H13-3]
 gi|325061729|gb|ADY65420.1| hypothetical protein AGROH133_08567 [Agrobacterium sp. H13-3]
          Length = 775

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 221/795 (27%), Positives = 367/795 (46%), Gaps = 97/795 (12%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           ++P++      ++D++  L   V+ DP+VS + +YY + I  +  +D F+KD RL+SYA+
Sbjct: 2   VLPAYTTYALYNRDMELSL-KRVANDPVVSRDAKYYADNIGTVKNLDAFLKDFRLYSYAM 60

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP--PPKVIQSDI 117
           KA GL +M +A  F+KK+LES+L+DP S  N+L   +Y+ FA S+DF      K +Q+  
Sbjct: 61  KAHGLEEMIYATAFMKKVLESNLNDPNSFANKLKDTRYRDFAASFDFGTIKAEKSVQTKS 120

Query: 118 QHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           Q   +I  Y  + + +     EE++++   I K+  VD +FK+ R+ DY+ +SF I P+ 
Sbjct: 121 QQDRLIATYHATIEQEGAELKEETRFYNIAIEKVGHVDDIFKNTRVRDYIFKSFGIDPET 180

Query: 178 ISLPFLKDVLTLGLANPKKYFIE------------------------------------- 200
            S   +K+VLT  ++N   Y  +                                     
Sbjct: 181 FSYKHVKNVLTSDISNADSYINKTYKSLIPEWKAKAADLRIERAGVASTDKPALAKIDYL 240

Query: 201 --------SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPI-- 250
                   +  N+   MA  F F+ DG +       T  Q   I   Y  +         
Sbjct: 241 ISQYNKRINDANKLFEMAAAFNFRDDGRVDDGMPAQTAAQRRLINETYVLSNPRLTQAGA 300

Query: 251 VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIV--- 307
           V ++ Y+   + +++  S   +  +L  ML +S    + + T  K    + ++       
Sbjct: 301 VLNREYFVDKMKTITEASQMTQFARLRTMLIVSFNLTDNDETDKKIGWAVLQDPNDPQSP 360

Query: 308 -------SQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK 358
                    V      NF  D    +    Q   Q+  M++LY        +   +  IK
Sbjct: 361 IHKEKDKGLVDLARAFNFGADGKIKTGKVAQTAEQLNTMMNLYFSRYDDKDEAADEKAIK 420

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
           +YQ  +G  K++++ LS          A+  +I   FAL A+++  ++     L+ V TS
Sbjct: 421 NYQRYIGLTKNLEDFLSN---------AQGAVIIRNFALKAFDITAEEASSFTLKRVFTS 471

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
           + SDP SY    KD+R ++L  AFNF+A+G IG   + QS   I    ++Y         
Sbjct: 472 DLSDPKSYVYTLKDERFVRLAKAFNFDAEGKIGSPRLAQSENEITRISRNYLKEVTR--- 528

Query: 479 AENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDS 538
                          K++  +   EV YY   + TI + ++LL+++R+L+F+L ++ ID 
Sbjct: 529 -----------WDKDKKVREKGEKEVAYYRQKMETIETVDQLLSDRRLLDFMLIAQRIDP 577

Query: 539 QKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHI 598
           + V  D+L +IFKSDLKDPKSFANT KD R++ +  SFNFD  G +  K    VQ+   +
Sbjct: 578 KTVTTDYLKKIFKSDLKDPKSFANTEKDARFRALAGSFNFDAKGNIVAKAGQSVQNTRSL 637

Query: 599 DDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
            +T D Y  Q +E++  E++  + LALYFKR   +I N Y+IL D+ L +     L +  
Sbjct: 638 METRDKYVRQTLEQRVGEENSGVRLALYFKRMAASISNPYDILADNALAEFTRTALGIPA 697

Query: 659 YFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDP 718
             A      + ++++K +KI D +D KKVE  +                 F + N   DP
Sbjct: 698 ETANSKVDAQAKMIEKKLKIKDLQDPKKVEKLVNRFLL-----------TFEANNATSDP 746

Query: 719 WNNSFDDPQNNVSLQ 733
               F     ++S  
Sbjct: 747 RLALFGSGSTSISGN 761


>gi|307309365|ref|ZP_07589028.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
 gi|307320101|ref|ZP_07599522.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
 gi|306894316|gb|EFN25081.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
 gi|306900234|gb|EFN30852.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
          Length = 769

 Score =  590 bits (1521), Expect = e-166,   Method: Composition-based stats.
 Identities = 200/799 (25%), Positives = 348/799 (43%), Gaps = 102/799 (12%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +++     ++D++  L   VS+  IV+ + +YYRE I  ++++DEF+ D RL+SYA+
Sbjct: 1   MVSTYLDYNLIARDMKLSLR-RVSEQTIVARDTQYYRENIGSVASVDEFLADYRLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL+DM  +  F++K+LESDLSD  S  N+L   +Y+ F  ++ FS    V Q++ Q 
Sbjct: 60  KAYGLADMIESVAFMRKVLESDLSDDNSFANKLTDERYRDFTMAFSFSGGTAVSQTEAQL 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y  S     E   EE++Y+   I K+ SVDQL  + RL  YV   F I     S
Sbjct: 120 DEMIGLYNTSIASIGETQKEETRYYNVMIDKVTSVDQLLNNDRLRTYVFTVFGIDESTYS 179

Query: 180 LPFLKDVLTLGLANPKKYFIE--------------------------------------- 200
              L+ VL+    +P  Y                                          
Sbjct: 180 RETLRKVLSSNADDPDSYENTVLEPRLSELEAARADAQAKLQQSGTTQAEKLELQAKIAT 239

Query: 201 -----SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP--IVSD 253
                S  + + AMA  F+F+ DG+++      T    + +   Y ++     P   + +
Sbjct: 240 YNKSISTVSNYLAMAAAFQFEADGTVAAG-SAQTAAHKKTMNELYVSSNSRVTPQAALLN 298

Query: 254 QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQV--- 310
           + Y++  I S+++ S+ + D +L+  ++ +       I       ++  +    +     
Sbjct: 299 KAYFEEKIASITTVSELVADTRLYNYIRTAFDLNEVTIVPATIKNILTSDPDDPNSYINT 358

Query: 311 ---------KYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKD 359
                          NF  D +  +    Q   Q       Y        D   +  I  
Sbjct: 359 IGKGNENYKALARAFNFQADGTLAAGDAAQTAEQTTLTSSRYMTRYNDKDDAADEKAIGA 418

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+L + K+ S+ + +             E      FAL A  L+        ++ VLTS+
Sbjct: 419 YKLAVEKMTSVSDFI-------------ETASIYDFALQAVGLDPDSESARTIKRVLTSD 465

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            +DP+S+    KD+R +KL   FNF   G IG   + QS   I++  K Y   K      
Sbjct: 466 LTDPESFVYTLKDERYLKLAQLFNFTTSGDIGVPALAQSETLIQETAKTYIVNKSRFGSE 525

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
           E+K+               +  +E +YYT  +  + S +E LA+ R+++F LE+ GID +
Sbjct: 526 EDKT---------------KAEAEAEYYTAEVAKLSSLDEFLADSRLVDFALEANGIDPE 570

Query: 540 KVREDFLCEIFKSDLKDPKSFANTYKDN-RYKEIISSFNFDIHGELSHKKIGKVQDNFHI 598
            V  DFL +IF SDL DPKSF N  +++  Y  +++SFNFD  G +  +    +     +
Sbjct: 571 NVTLDFLRDIFTSDLDDPKSFINQQQNSGAYIALVTSFNFDSGGNVLREDKSVIITRQGL 630

Query: 599 DDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
            +T D Y HQ +E++  E +  + LALYF+R   ++ + Y++L D  L +V      L  
Sbjct: 631 YETLDRYLHQSLEEQAGEDNAGVRLALYFERQAGSLVDAYDLLADDALAEVFRTIFSLPD 690

Query: 659 YFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDP 718
            F+ +   ++ +I++K++ +    D  +++  L     +     D +       N   DP
Sbjct: 691 EFSSMDIDQQAKIVEKNLDLEKLSDPAELKKLLARFTVL----YDLEN------NMEVDP 740

Query: 719 WNNSFDDPQNNVSLQLSPQ 737
                    +N+ +     
Sbjct: 741 AVVVLSGSGSNIGISADTL 759


>gi|15964619|ref|NP_384972.1| hypothetical protein SMc00986 [Sinorhizobium meliloti 1021]
 gi|15073797|emb|CAC45438.1| Hypothetical protein SMc00986 [Sinorhizobium meliloti 1021]
          Length = 769

 Score =  586 bits (1511), Expect = e-165,   Method: Composition-based stats.
 Identities = 199/799 (24%), Positives = 346/799 (43%), Gaps = 102/799 (12%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +++     ++D++  L   VS+  IV+ + +YYRE I  ++++DEF+ D RL SYA+
Sbjct: 1   MVSTYLDYNLIARDMKLSLR-RVSEQTIVARDTQYYRENIGSVASVDEFLADYRLHSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL+DM  +  F++K+LESDLSD  S  N+L   +Y+ F  ++ FS    V Q++ Q 
Sbjct: 60  KAYGLADMIESVAFMRKVLESDLSDDNSFANKLTDERYRDFTMAFSFSGGTAVSQTEAQL 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y  S     E   EE++Y+   I K+ SVDQL  + RL  YV   F I     S
Sbjct: 120 DEMIGLYNTSIASIGETQKEETRYYNVMIDKVTSVDQLLNNDRLRTYVFTVFGIDESTYS 179

Query: 180 LPFLKDVLTLGLANPKKYFIE--------------------------------------- 200
              L+ VL+    +P  Y                                          
Sbjct: 180 RETLRKVLSSNADDPDSYENTVLEPRLSELEAARADAQAKLQQSGTTQAEKLELQAKIAT 239

Query: 201 -----SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP--IVSD 253
                S  + + AMA  F+F+ DG+++      T    + +   Y ++     P   + +
Sbjct: 240 YNKSISTVSNYLAMAAAFQFEADGTVAAG-SAQTAAHKKTMNELYVSSNSRVTPQAALLN 298

Query: 254 QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQV--- 310
           +  ++  I S+++ S+ + D +L+  ++ +       I       ++  +    +     
Sbjct: 299 KADFEEKIASITTVSELVADTRLYNYIRTAFDLNEVTIVPATIKNILTSDPDDPNSYINT 358

Query: 311 ---------KYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKD 359
                          NF  D +  +    Q   Q       Y        D   +  I  
Sbjct: 359 IGKGNENYKALARAFNFQADGTLAAGDAAQTAEQTTLTSSRYMTRYNDKDDAADEKAIGA 418

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+L + K+ S+ + +             E      FAL A  L+        ++ VLTS+
Sbjct: 419 YKLAVEKMTSVSDFI-------------ETASIYDFALQAVGLDPDSESARTIKRVLTSD 465

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            +DP+S+    KD+R +KL   FNF   G IG   + QS   I++  K Y   K      
Sbjct: 466 LTDPESFVYTLKDERYLKLAQLFNFTTSGDIGVPALAQSETLIQETAKTYIVNKSRFGSE 525

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
           E+K+               +  +E +YYT  +  + S +E LA+ R+++F LE+ GID +
Sbjct: 526 EDKT---------------KAEAEAEYYTAEVAKLSSLDEFLADSRLVDFALEANGIDPE 570

Query: 540 KVREDFLCEIFKSDLKDPKSFANTYKDN-RYKEIISSFNFDIHGELSHKKIGKVQDNFHI 598
            V  DFL +IF SDL DPKSF N  +++  Y  +++SFNFD  G +  +    +     +
Sbjct: 571 NVTLDFLRDIFTSDLDDPKSFINQQQNSGAYIALVTSFNFDSGGNVLREDKSVIITRQGL 630

Query: 599 DDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
            +T D Y HQ +E++  E +  + LALYF+R   ++ + Y++L D  L +V      L  
Sbjct: 631 YETLDRYLHQSLEEQAGEDNAGVRLALYFERQAGSLVDAYDLLADDALAEVFRTIFSLPD 690

Query: 659 YFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDP 718
            F+ +   ++ +I++K++ +    D  +++  L     +     D +       N   DP
Sbjct: 691 EFSSMDIDQQAKIVEKNLDLEKLSDPAELKKLLARFTVL----YDLEN------NMEVDP 740

Query: 719 WNNSFDDPQNNVSLQLSPQ 737
                    +N+ +     
Sbjct: 741 AVVVLSGSGSNIGISADTL 759


>gi|327192290|gb|EGE59255.1| hypothetical protein RHECNPAF_2330071 [Rhizobium etli CNPAF512]
          Length = 773

 Score =  585 bits (1508), Expect = e-165,   Method: Composition-based stats.
 Identities = 204/722 (28%), Positives = 354/722 (49%), Gaps = 29/722 (4%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           ++ ++V+        S   S V+    V+ +  YY++ I  ++T+DEF+ D +L+SYA+K
Sbjct: 47  LVSTYVSYLAVARNLSTSLSNVASQATVARDSAYYKDNIGKVTTVDEFMGDYKLYSYAMK 106

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ FS   K  QSD+Q  
Sbjct: 107 AYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGETKTAQSDVQRD 166

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
            ++  Y+ S + + +   +E+ YF +NI  I SVD      RL  YVL +F ++ +Y S 
Sbjct: 167 NLLDAYEASFETEADTIEDETDYFEENIASITSVDDFLSSSRLKSYVLTAFGLSTEYTSS 226

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLKDVLT  L +   +  +  D+ + ++A+ F F  DGS+     ++++ QI  + S Y
Sbjct: 227 SFLKDVLTSDLDDADSFVNQLDDDVYVSLAKAFNFNEDGSVD--GDLMSEDQISLVTSAY 284

Query: 241 FNNTIDCVPIVSDQN---YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
              +       + +    Y+   I +++S    + D KL   L+ +    + E  +D F+
Sbjct: 285 AVASATIASTQTGEAYDSYFAAEIGNITSVDQLMSDDKLVSYLRTAYGLTDDE--SDTFI 342

Query: 298 TLMQENDPIV---SQVKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HDD 351
           +   ++  I             NF  D   +     Q   Q       + +N Q+L  + 
Sbjct: 343 SAALKSADIAEAIGLSDLHDAFNFDEDGALADGDSAQTSDQTAATTAAFDENYQVLIANT 402

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
             +  + +Y   +  + SID+ L      +  +  ++     + AL A+ ++   + + Q
Sbjct: 403 DTEVAVDNYTTRIASVTSIDDFLVSNADDDD-DDNDDLPEMWEMALRAFGIDPDSVSKSQ 461

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
           +R +L S+P+D  SY N   DDR +    AFNF++DG +       S   + D   +Y  
Sbjct: 462 VRKILESDPTDSKSYVNSLNDDRFVAFRKAFNFDSDGDVTVPLQAMSESVVDDYAAYYKQ 521

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
            K    D +  +                 + E+ Y+   + TI +  E LA+ R+++F+L
Sbjct: 522 NKIRYLDGDELT-----------EATDAADDEITYFREQMATITTASEFLADDRLVSFVL 570

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           E+KG+D   V  D L ++F SDL D  S+ N   DNR+ E++ +FNFD  G +S +  G+
Sbjct: 571 EAKGLDPDDVTSDQLKKMFSSDLDDEDSYVNKLDDNRFAELVGAFNFDQDGNISAEPTGE 630

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
           VQ    + +T D Y    +E ++ + +  + LALYF+R    I + Y+ILGDS LF+  +
Sbjct: 631 VQQRGDVLETVDAYVRLTLEDEQGDSNTGVRLALYFQRKASEISSAYDILGDSALFEFFT 690

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSS 711
               +S Y + +   K+  +++  I I D  D  KV+D +    AM     D      ++
Sbjct: 691 TSFNISSYVSNMDVDKQAEMVENFIDIKDLSDPDKVDDLIKRFTAM----YDMANGTGTT 746

Query: 712 PN 713
             
Sbjct: 747 ST 748


>gi|209547533|ref|YP_002279451.1| hypothetical protein Rleg2_5534 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209538777|gb|ACI58711.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 738

 Score =  585 bits (1507), Expect = e-164,   Method: Composition-based stats.
 Identities = 207/723 (28%), Positives = 355/723 (49%), Gaps = 31/723 (4%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           ++ ++V+    ++++ + L S+V+    VS +  YY+E I  ++T+DEF+ D +L+SYA+
Sbjct: 12  LVSTYVSYLAVARNLNASL-SSVASQGTVSRDSAYYKENIGKVTTVDEFMGDYKLYSYAM 70

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ F    K  QSD+Q 
Sbjct: 71  KAYGLDDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFGGETKTAQSDVQR 130

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           +T++  Y+ S   + E   +E+ YF +NI  I SVD      RL +Y L +F ++  Y S
Sbjct: 131 ETLLDAYESSFDTEAEDIADETDYFEENISSITSVDDFLSSSRLKNYALTAFGLSTDYTS 190

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLK VLT  L +   +  +  D+ + ++A+ F F  DGS      ++++ QI  + S 
Sbjct: 191 SSFLKQVLTSDLDDSDSFVNQLGDDVYVSLAKAFNFNEDGSTD--GDVMSEDQISLVTSG 248

Query: 240 YFNNTIDCVPIVSDQN---YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
           Y   +       + +    Y+   I +++S    + D KL   L+++    + E  +D F
Sbjct: 249 YAVASSTVASSDTGEAYDTYFAAEIGNITSVDQLMNDDKLVGYLRIAYGLTDDE--SDTF 306

Query: 297 LTLMQENDPIV---SQVKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HD 350
           ++   ++  I             NF  D   +     Q   Q       + +N Q+L  +
Sbjct: 307 ISAALKSADIADAIGLSDLHDAFNFDEDGALADGDTAQTSEQTATTTAAFDENYQVLIAN 366

Query: 351 DKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
              +  + +Y   +  + SID+ L      +  +  ++     + AL A++++   + R 
Sbjct: 367 TDSEDAVDNYTTRIASVTSIDDFLVSNADDDV-DGNDDLPEMWEMALRAFDIDPDSVSRS 425

Query: 411 QLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYA 470
           Q+R +L S+P+D  SY N   DDR +    AFNF++DG +       S   + D   +Y 
Sbjct: 426 QVRKILESDPTDSKSYVNSLDDDRFVAFRKAFNFDSDGDVTVPLQAMSESVVDDYAAYYK 485

Query: 471 NRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFL 530
             K    D ++ +                 + E+ Y+   + TI +  E LA+ R+++  
Sbjct: 486 QNKIRYLDGDDLT-----------EATDAADDEISYFREQMATITTASEFLADDRLVSLA 534

Query: 531 LESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIG 590
           LE+KG+D   V  D L ++F SDL D  S+ N   D+R+ E++ SFNFD  G +S    G
Sbjct: 535 LEAKGLDPDDVTSDQLKKMFSSDLDDEDSYVNKLDDSRFAELVGSFNFDQDGNISADPTG 594

Query: 591 KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y ILGDS LF+  
Sbjct: 595 TVQQRGDVLETIDSYVRLTLEDDQGDSNTGVRLALYFQRKAPEISSAYGILGDSALFQFF 654

Query: 651 SKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFS 710
           +    LS Y + +   K+  ++   I I D  D  KV+D +    AM     D      +
Sbjct: 655 TTTFNLSSYVSNMDVDKQAEMVNNFIDIKDLADPDKVDDLIKRFTAM----YDVANGTGT 710

Query: 711 SPN 713
           + +
Sbjct: 711 TSS 713


>gi|150395704|ref|YP_001326171.1| hypothetical protein Smed_0479 [Sinorhizobium medicae WSM419]
 gi|150027219|gb|ABR59336.1| protein of unknown function DUF1217 [Sinorhizobium medicae WSM419]
          Length = 822

 Score =  581 bits (1498), Expect = e-163,   Method: Composition-based stats.
 Identities = 186/774 (24%), Positives = 329/774 (42%), Gaps = 96/774 (12%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +++     ++D++  L   VS+  IV+ + +YYRE I  ++++D F+ D RL+SYA+
Sbjct: 54  MVSTYLDYNLIARDMKLSLR-RVSEQTIVARDTQYYRENIASVASVDAFLADYRLYSYAM 112

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM  +  F++K+LESDL+D  S  N+L   +Y+ FA ++ FS    V Q++ Q 
Sbjct: 113 KAYGLGDMIDSVAFMRKVLESDLADDNSFANKLTDERYREFAMAFSFSGGTAVSQTEAQL 172

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y  S     E   EE++Y+   + K+ SVDQL  + RL  Y+   F I     S
Sbjct: 173 DEMIGLYNTSIASIGETQKEETRYYNLMVDKVTSVDQLLNNDRLRAYIFTVFGIDESTYS 232

Query: 180 LPFLKDVLTLGLANPKKYFIE--------------------------------------- 200
              L++VL+    +P  Y                                          
Sbjct: 233 RETLRNVLSSNADDPDSYENTVLEPRLTELQTARADAQAKLQQSGTTQAEKLELQAKIAT 292

Query: 201 -----SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP--IVSD 253
                S  + + AMA  F+F  DG+++      T    + +   Y ++     P   + +
Sbjct: 293 YNKSISTVSNYLAMAAAFQFSADGTVAAG-SAQTAAHKKTMNELYVSSNPRITPQAALLN 351

Query: 254 QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQV--- 310
           + Y++  I S+++ S+ + D +++  ++ +       I       ++  +          
Sbjct: 352 KAYFEEKIASITNVSELVADTRIYNYIRTAFDLNEVTIVPATIKNILTSDPDDPDSYINT 411

Query: 311 ---------KYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKD 359
                          NF  D +  +    Q   Q       Y        D   +  I  
Sbjct: 412 IGKGNENYKALARAFNFQADGTLAAGDAAQTAEQTTLTSSRYMTRYNDKDDAADEKAIGA 471

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+L + K+ S+ + +             E      FAL A  L+        ++ VL S+
Sbjct: 472 YKLAVEKMVSVGDFI-------------ETASIYDFALKAVGLDPDAESTRTIKRVLMSD 518

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            +DP S+    KD+R +KL   FNF   G IG   + Q    I++  K Y   K      
Sbjct: 519 LTDPGSFVYTLKDERYLKLAQLFNFTTSGDIGVPALAQPETLIQETAKTYIVNKSRFGSE 578

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
           E+K+    E                      +  + S +  LA+ R++ F LE+ GID +
Sbjct: 579 EDKAEAEAEAEYYTAE---------------VAKLASLDAFLADSRLVAFALEANGIDPE 623

Query: 540 KVREDFLCEIFKSDLKDPKSFANTYKDNR-YKEIISSFNFDIHGELSHKKIGKVQDNFHI 598
            V  DFL EIF SDL DPKSF N  +++  Y  +++S+NFD  G +  +    +     +
Sbjct: 624 NVTIDFLREIFTSDLDDPKSFINQQQNSGSYIALVTSYNFDRSGNILREDKSVIITRQGL 683

Query: 599 DDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
            +T D Y HQ +E++  E +  + LALYF+R   ++ + Y++L D  L +V      L  
Sbjct: 684 YETFDRYLHQTLEEQAGEDNAGVRLALYFERQAGSLVDAYDLLADDALAEVFRTIFSLPD 743

Query: 659 YFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            F+ +   ++ +I++K++ +    +  +++  L     +     D +      P
Sbjct: 744 EFSSMDIDQQAKIVEKNLDLEKLSEPAELKKLLARFTVL----YDLENNTEVDP 793



 Score =  112 bits (280), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/189 (19%), Positives = 72/189 (38%), Gaps = 13/189 (6%)

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
           R  S +   N     M+    +      +  +  YY  NI ++ S +  LA+ R+ ++ +
Sbjct: 53  RMVSTYLDYNLIARDMKLSLRRVSEQTIVARDTQYYRENIASVASVDAFLADYRLYSYAM 112

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           ++ G+        F+ ++ +SDL D  SFAN   D RY+E   +F+F             
Sbjct: 113 KAYGLGDMIDSVAFMRKVLESDLADDNSFANKLTDERYREFAMAFSF-------SGGTAV 165

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEE-KDPNIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            Q    +D+   LY          E +        Y+   +  + +  ++L + +L   +
Sbjct: 166 SQTEAQLDEMIGLY--NTSIASIGETQKEETR---YYNLMVDKVTSVDQLLNNDRLRAYI 220

Query: 651 SKKLKLSPY 659
                +   
Sbjct: 221 FTVFGIDES 229


>gi|86360899|ref|YP_472786.1| hypothetical protein RHE_PF00168 [Rhizobium etli CFN 42]
 gi|86285001|gb|ABC94059.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 727

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 210/723 (29%), Positives = 360/723 (49%), Gaps = 31/723 (4%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ ++V+    ++++ + L S+V+    V+ +  YY+E I  ++T+DEF+ D +L+SYA+
Sbjct: 1   MVSTYVSYLAVARNLNASL-SSVASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ F+   K  QSD Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFAGETKTAQSDEQR 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
            +++  Y+ S   + E   +E+ YF +NI  I SVD L    RL +YVL +F ++ +Y S
Sbjct: 120 DSLLDAYEDSFDTEAENIEDETDYFEENISSITSVDDLLSSSRLKNYVLTAFGLSTEYTS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLKDVLT  L + + +  +  D+ + ++A+ F    DGS      ++++ Q+  + S 
Sbjct: 180 TSFLKDVLTSDLDDSESFVNQLDDDVYVSLAKAFNVSEDGSTD--GDVMSEDQLSLVTSA 237

Query: 240 YFNNTIDCVPIVSDQN---YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
           Y   +       + +    Y+   I +++S    + D KL   L+ +    + E   D F
Sbjct: 238 YAVASSTLASTETGEAYDTYFAAQIGNITSVDQLMSDDKLVSYLRTAYGLSDTET--DNF 295

Query: 297 LTLMQENDPIV---SQVKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HD 350
           ++   ++  I             NF  D   +     Q   Q       + +N Q+L  +
Sbjct: 296 ISAALKSADIADAIGLSDLHDAFNFDEDGALADGETAQTSEQTAATTAAFDENYQVLIAN 355

Query: 351 DKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
            + +  + +Y   +  I SID+ L      +  +  ++     + AL A+ ++  ++ + 
Sbjct: 356 TETEDAVDNYTTRIASITSIDDFLVSNADDDD-DDNDDLPELWEMALRAFGIDSGEVSKS 414

Query: 411 QLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYA 470
           ++R +L S+P DP SY N  KDDR     +AFNF++DG +       S   + D   +Y 
Sbjct: 415 EVRKILESDPGDPKSYVNSLKDDRFEAFRNAFNFDSDGDVTVPLQAMSESVVDDYAAYYK 474

Query: 471 NRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFL 530
             K    + +  +                 + E++Y+   + TI S  E LA+ R++ F 
Sbjct: 475 QNKIRYLEGDELT-----------EATDAADEEIEYFRDQMATITSASEFLADDRLVAFA 523

Query: 531 LESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIG 590
           LE+KG+D + V  D L +IF SDL D  S+ N  +D+R+ E++ SFNFD  G +S    G
Sbjct: 524 LEAKGLDPEDVTSDDLEKIFSSDLDDEDSYVNKLEDSRFAELVGSFNFDRDGNISADPTG 583

Query: 591 KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y+ILGDS LF+  
Sbjct: 584 TVQQRGDVLETVDAYVRLTLEDDQGDSNTGVRLALYFEREAPEISSAYDILGDSALFEFF 643

Query: 651 SKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFS 710
           +    LS Y + +   K+  +++  I I D  D  KV+D +    AM     D       
Sbjct: 644 TTSFNLSSYVSNMDVDKQAEMIENFIDIKDLADPDKVDDLIKRFTAM----YDMANGTGG 699

Query: 711 SPN 713
           +  
Sbjct: 700 TST 702


>gi|227821060|ref|YP_002825030.1| putative flagella associated protein [Sinorhizobium fredii NGR234]
 gi|227340059|gb|ACP24277.1| putative flagella associated protein [Sinorhizobium fredii NGR234]
          Length = 769

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 187/774 (24%), Positives = 333/774 (43%), Gaps = 96/774 (12%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +++     ++D++  L   VS+  +V+ + +YY+E I ++S++D F+ D RL+SYA+
Sbjct: 1   MVSTYLDYNLIARDMKVSL-KRVSEQTVVARDTQYYKENIGNVSSVDAFLDDYRLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
            AFGL DM  +  F++K+LESDLSD  S  N L   +Y+ FA +Y FS    V Q++ Q 
Sbjct: 60  TAFGLGDMIDSVAFMRKVLESDLSDTSSFANSLTDDRYREFALAYSFSGATAVSQTEAQL 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             II  Y  S  +  E   EE++Y+   I KI SVDQL  + RL  YV  +F +     S
Sbjct: 120 DEIIGLYDTSILNIAETQEEETRYYNVMIDKITSVDQLLNNDRLRAYVFTAFGVDESTYS 179

Query: 180 LPFLKDVLTLGLANPKKYFIE--------------------------------------- 200
              ++ VL+    +   Y                                          
Sbjct: 180 RQTIRSVLSSSSGDASSYENTVIAPKLSELETAKAAAEAQLTAGGLTDEEEAELESKITT 239

Query: 201 -----SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF--NNTIDCVPIVSD 253
                +  N +  +A  F F  DG+++      TD   E     Y   N+ +     + +
Sbjct: 240 YANSIATLNNYIDLAAAFDFNSDGTVTAG-AAQTDENKETTNELYISSNSRVTSQAALLN 298

Query: 254 QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQV--- 310
           + Y++  I S+++ ++ L D +L+  ++ +       I +     ++  +          
Sbjct: 299 KAYFEETIASITTVTELLADTRLYNYIRTAFDLDEVTIVSATIKNILTSDPDDPDSYVNT 358

Query: 311 ---------KYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKD 359
                          NF  D +       Q  +Q     + Y        D+  +  +  
Sbjct: 359 IGGGDANYLALANAFNFQEDGTLAVGDSAQTAAQTTLTSNRYMTRYNDKDDEADEKAVSA 418

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           Y+  +  + S+D+ +                    FAL A  L+        ++ VLTS+
Sbjct: 419 YKTAVASMTSVDDFIGS-------------ASIYDFALKAVGLDPDTASTRTIKRVLTSD 465

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDA 479
            +DP SY    KD+R + L   FNF  +G IGP  + QS   I++  K++   K      
Sbjct: 466 LTDPKSYVYSLKDERYVTLAKLFNFTTEGEIGPPALAQSETQIQETAKNHIVIKSRFGSE 525

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
           ++K+               +   E +YYT  +  + S +E LA+ R++   LE+ GID +
Sbjct: 526 DDKT---------------KAQEESEYYTAGVAKLSSLDEFLADDRLVTIALEANGIDPE 570

Query: 540 KVREDFLCEIFKSDLKDPKSFANTYKDN-RYKEIISSFNFDIHGELSHKKIGKVQDNFHI 598
            V  D L +IF SDL DP+S  N  +++  Y  +++SFNFD  G +  +    +     +
Sbjct: 571 GVTADVLRQIFNSDLDDPESVINEQENSAAYVSLVTSFNFDSEGNVLREDRDSIVTRQGL 630

Query: 599 DDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
            +T D Y  Q +E++  E +  + LALYF+R   ++ + Y++L D  L +V      L  
Sbjct: 631 YETLDQYLRQTLEEQAGESNEGVRLALYFERKAGSLVDAYDLLADDALAEVFRTIFSLPD 690

Query: 659 YFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            F+ +   ++ +I++K++ +    D  +++  L     +     D +      P
Sbjct: 691 EFSTMDIDQQAKIVEKNLDLEKLSDPAELKKLLARFAVL----YDLENNTEVDP 740


>gi|27379820|ref|NP_771349.1| hypothetical protein blr4709 [Bradyrhizobium japonicum USDA 110]
 gi|27352973|dbj|BAC49974.1| blr4709 [Bradyrhizobium japonicum USDA 110]
          Length = 687

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 192/742 (25%), Positives = 325/742 (43%), Gaps = 79/742 (10%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ ++ +         +  + V +   V+ E  YY+  I  + T+D+ +KD RL+ YALK
Sbjct: 1   MVSTYFSYNYISHHLKQSLTRVEQQTDVAREAAYYKANIGKVKTVDDLMKDYRLYHYALK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP-PKVIQSDIQH 119
           A+GL DM++A+ F++K+LESDLSD KS VN+L   +Y+ FA ++ F+     V QS+ Q 
Sbjct: 61  AYGLEDMAYAKAFMRKVLESDLSDAKSFVNKLVDKRYREFAAAFSFNGTATPVAQSENQT 120

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
              I  Y  + + + +   +++KY+   I  I+S DQL  + RL +YV  +F I      
Sbjct: 121 DETIGLYTATKKSQVDALADDTKYYSAQIGSISSADQLLNNDRLRNYVYSAFGIDQSKWP 180

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
              +  VL    ++P  Y   +  ++   +          + +K D   T+ +I    + 
Sbjct: 181 PDTISQVLRSDPSDPNSYVNTAFASQLTGLNAQL------AQAKSDVSATNTKIADYTAQ 234

Query: 240 YFNNTID----CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADK 295
                 D     V I+ ++ + +    S+SS +D +                        
Sbjct: 235 LSQPGADVAQLNVQILVEKYHLESYTKSISSLNDQIATIG-------------------- 274

Query: 296 FLTLMQENDPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKM 353
                         V       F  D S  S    Q  + +      +  +   ++    
Sbjct: 275 ------------GFVDLAGAFEFSADGSLPSGVPAQTAANVTLTTKRFDDSKSDVYAAAS 322

Query: 354 ----QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDR 409
                     ++  +GKI S+   +S                   FAL A  L+  ++ +
Sbjct: 323 PLNEAFATVQFRNAIGKIDSVQAFVSTPA-------------VYDFALGAVGLDPAEVSQ 369

Query: 410 DQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHY 469
             ++  L S+ SDP S+    KD+R ++L  AFNF+A+G++    + Q    +    K Y
Sbjct: 370 ATVKAALESDLSDPKSFVYTLKDNRYVELARAFNFDANGNLTTPLVAQDSAKVLQTAKDY 429

Query: 470 ANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNF 529
                     E +           K +  +   +   Y   I  I S  ELLAN+++++F
Sbjct: 430 VIAVLKQASPEQQ-----------KAVREQAQKDATSYQEAIAGIDSVSELLANRKMVDF 478

Query: 530 LLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKI 589
           +L +KG+D +KV  ++L +IF SDL +PKSFANT  D+R+ EI +SFNFD    ++   +
Sbjct: 479 ILVAKGLDPKKVSTEYLKKIFASDLNNPKSFANTESDHRFAEIAASFNFDSKDNVARLAM 538

Query: 590 GKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKV 649
              Q    + +T   Y  Q +E+++ + +P + LALYF+R    I + Y+IL D  L +V
Sbjct: 539 VGPQKQVQLRETQANYLQQSLEQQQGDTNPGVRLALYFQRKAGEITSAYDILADKALSEV 598

Query: 650 VSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALF 709
                 L    A +P  ++ + + K +KI D  D  KVE  L    AM     D K    
Sbjct: 599 FRTTFNLPDSMAAMPIDQQAKFVDKFMKIKDLSDPAKVEKLLGRFSAM----YDVKNGQ- 653

Query: 710 SSPNQNKDPWNNSFDDPQNNVS 731
            S  Q + P  N F    + +S
Sbjct: 654 -SIGQGQSPLLNLFQGSGSGLS 674


>gi|116248743|ref|YP_764584.1| putative flagella associated protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115253393|emb|CAK11781.1| putative flagella associated protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 727

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 202/723 (27%), Positives = 350/723 (48%), Gaps = 31/723 (4%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ ++V+    ++++ + L S V+    V+ +  YY+E I  ++T+DEF+ D +L+SYA+
Sbjct: 1   MVSTYVSYLTVARNLNASL-SNVASQATVARDSAYYKENIDKVTTVDEFMSDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ F+   K  QSD+Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDTRYAEFAAAFKFAGETKTAQSDVQR 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             ++  Y++S   +     + + YF  NI  I SVD L    +L +YVL +F ++ +Y S
Sbjct: 120 DNLLDAYEESFDTEAGDIADATDYFEDNISSITSVDDLLSSSKLKNYVLTAFGLSTEYTS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLK VLT  L     +  +  D  +  +++ F F  DG       ++++ QI  + S 
Sbjct: 180 SSFLKSVLTSDLDETDSFVNQLDDEVYVNLSKAFNFNEDGLTD--GDVMSEDQISLVTSA 237

Query: 240 YFNNTIDCVPIVSDQN---YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
           Y   +       + +    Y+   I +++S  + + D KL   L+ +    + E   D F
Sbjct: 238 YAVASATIASSETGEAYDTYFAAQIGNITSVDELMSDDKLVSYLRTAYGLTDSET--DNF 295

Query: 297 LTLMQENDPIV---SQVKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HD 350
           ++   ++  I       +     NF  D   +     Q   Q       + +N ++L  +
Sbjct: 296 ISAALKSADIADAIGLSELHDAFNFDEDGALADGDTAQTSEQTAATTAAFDENYEVLIAN 355

Query: 351 DKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
              +  + +Y   +  + SID+ L      +  +  ++     + AL AY+++   + R 
Sbjct: 356 TDTEDAVDNYTTRIASVTSIDDFLVS-NDDDDDDDNDDLPELWEMALRAYDIDPDSVSRS 414

Query: 411 QLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYA 470
           ++R +L S+PSD  SY N   DDR +    AFNF+ +G +       S   + D   +Y 
Sbjct: 415 EVRKILESDPSDSKSYVNSLDDDRFVAFRKAFNFDDNGDVTVPLQAMSESVVDDYATYYK 474

Query: 471 NRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFL 530
             K    + +  +                 +  + Y+   + TI +  E LA+ R+++F+
Sbjct: 475 QNKIRYLEGDEMT-----------EATDAADEGITYFREQMATITTASEFLADDRLVSFV 523

Query: 531 LESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIG 590
           LE+KG+D   V  D L E+F SDL D  S+ N   DNR+ E++ +FNFD  G +S +  G
Sbjct: 524 LEAKGLDPDDVTSDALEEMFASDLDDEDSYVNKLDDNRFAELVGAFNFDQDGNISAEPTG 583

Query: 591 KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y+ILGDS LF+  
Sbjct: 584 TVQQRGDVLETIDAYVRLTLEDDQGDSNTGVRLALYFQRKAPEISSAYDILGDSALFEFF 643

Query: 651 SKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFS 710
           +    LS Y + +   K+  ++   I I D  D  KV+D +    AM     D      +
Sbjct: 644 TTSFNLSSYVSNMDVDKQAEMIDNFIDIEDLSDPDKVDDLIKRFTAM----YDMANGTGT 699

Query: 711 SPN 713
           +  
Sbjct: 700 TST 702


>gi|241113587|ref|YP_002973422.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240861795|gb|ACS59461.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 727

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 203/723 (28%), Positives = 350/723 (48%), Gaps = 31/723 (4%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ ++V+    ++++ + L S+V+    VS +  YY+E I  ++T+DEF+ D +L+SYA+
Sbjct: 1   MVSTYVSYLSVARNLNASL-SSVASQATVSRDSAYYKENIDKVTTVDEFMSDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+ K+LESDLSD  S  N L+  +Y  FA ++ F+   K  QSD+Q 
Sbjct: 60  KAYGLEDMTYAKAFMTKVLESDLSDSSSFANSLSDTRYAEFAAAFKFAGETKTAQSDVQR 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             ++  Y++S   + +   + + YF +NI  I SVD L    +L +YVL +F ++ +Y S
Sbjct: 120 DNLLDAYEESFDTEADDIADATDYFEENISSITSVDDLLSSSKLKNYVLTAFGLSTEYTS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLK VLT  L +   +  +  D  +  +A+ F F  DGS      ++++ QI  + S 
Sbjct: 180 TSFLKSVLTSDLEDADSFVNQLDDAVYVNLAKAFNFNEDGSTD--GDVMSEDQISLVTSA 237

Query: 240 YFNNTIDCVPIVSDQN---YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
           Y   +       + +    Y+   I +++S  + + D KL   L+ +    + E   D F
Sbjct: 238 YAVASATIASSETGEAYDTYFAAQIGNITSVDELMSDDKLVSYLRTAYGLTDSET--DNF 295

Query: 297 LTLMQENDPIV---SQVKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HD 350
           ++   ++  +             NF  D   +     Q   Q       + +N Q+L  +
Sbjct: 296 ISAALKSADVADAIGLSDLHDAFNFDEDGDLADGDTAQTSDQTATTTAAFDENYQVLVAN 355

Query: 351 DKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
              +    +Y   +  + SID+ L      +  +  ++     + AL AY+++   + R 
Sbjct: 356 ASTEDATDNYTTRIASVTSIDDFLVS-NDDDDDDDNDDLPELWEMALRAYDIDPDSVSRS 414

Query: 411 QLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYA 470
           ++R +L S+P+D  SY N   DDR +    AFNF+ +G +       S   + D   +Y 
Sbjct: 415 EVRKILESDPADSKSYVNSLDDDRFVAFRKAFNFDDNGDVTVPLQAMSESVVDDYAAYYK 474

Query: 471 NRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFL 530
             K    +    +                 N E+ Y+   + TI +  E LA+ R+++F 
Sbjct: 475 QNKIRYLEGAELT-----------EATDAANDEITYFREQMATITTASEFLADDRLVSFA 523

Query: 531 LESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIG 590
           LE+KG+D   V  D L ++F SDL D  S+ N   DNR+ E++ +FNFD  G +S    G
Sbjct: 524 LEAKGLDPDDVTSDELEKMFSSDLDDEDSYVNKLDDNRFAELVGAFNFDQDGNISADPTG 583

Query: 591 KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
            VQ    + +T D Y    +E  + + +  + LALYF+R  P I + Y ILGDS LF+  
Sbjct: 584 TVQQRGDVLETIDAYVRLTLEDDQGDSNTGVRLALYFQRKAPEISSAYNILGDSALFEFF 643

Query: 651 SKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFS 710
           +    LS Y + +   K+  ++   I + D  D  KV+D +    AM     D      +
Sbjct: 644 TTTFNLSSYVSNMDVDKQAEMVDNFIDMKDLSDPDKVDDLIKRFTAM----YDMANGTGT 699

Query: 711 SPN 713
           + +
Sbjct: 700 TSS 702


>gi|300023907|ref|YP_003756518.1| hypothetical protein Hden_2400 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525728|gb|ADJ24197.1| protein of unknown function DUF1217 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 710

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 195/743 (26%), Positives = 316/743 (42%), Gaps = 60/743 (8%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +         S+  + VS    VS    YY   I  + ++D+F+ + RLFSYA+K
Sbjct: 1   MISTFLTYTSYASDMSRSLARVSGQAEVSSATAYYNANIGKVKSVDDFMNNHRLFSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDP----KSLVNQLNSLKYQYFARSYDFSPPPK----- 111
           A+GL DM++A+ F+KK+L SD+S      KS V +L   ++  FA+++ FS   K     
Sbjct: 61  AYGLEDMTYAKAFMKKVLTSDISTSTNLQKSFVGKLTDPRFLKFAQAFQFSADGKVATQP 120

Query: 112 -VIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
              Q       +I  Y Q   +K   A ++S Y++ NI  + SVD L  + RLL+Y L +
Sbjct: 121 VTAQQANDQSDLINLYTQQQVNKGATAADDSAYYQANIGNVASVDDLVGNTRLLNYALTA 180

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           + I     S   +K VLT  L++P  +  +     ++ +AE F F  DGS++      + 
Sbjct: 181 YGIDASIASASAIKQVLTSDLSDPGSFANQM-PGNYKLLAEAFSFNTDGSIN-GASAQSS 238

Query: 231 MQIEKIVSNYFNNTIDCV---PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPL 287
             +   V  Y++ +              YY+ AI  VSS  D L + +LF  L+ +    
Sbjct: 239 DDVSFTVYRYYDASGTGGSAPAAAFKSQYYQDAIAGVSSVDDLLGNARLFIYLETAFGLD 298

Query: 288 NPE----------ITADKFLTLMQENDPIVSQVKYFFQINFHRDNS-SSTKIQQDSQIQK 336
             E           +               +        NF+ D S + ++ Q  SQ   
Sbjct: 299 PSEQSTAILRNVLTSDLSDPNSYANQQTNDAYRALAAAFNFNTDGSINGSEAQTASQTDS 358

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
            +  +  N     +    S I  Y+  + KI S+ + +                    F 
Sbjct: 359 TVSSFMTNNTTAVEKYQSSQINFYKTDIAKIASVSDFIKDTG-------------LYGFV 405

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           L A+ ++     +  +  VL S+ S+P SYAN S +    KL  AFNF+ADG        
Sbjct: 406 LSAFGIDPSKTSKLTIEKVLESDASNPSSYANMSHNSAYSKLAAAFNFDADGKAKTASSA 465

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
           Q   ++   +K Y +                      K    + + E  YY   I TI S
Sbjct: 466 QVNASLVSTIKLYNSEM-----------------GDAKAEKKQTSDEDTYYGNTIGTIKS 508

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSF 576
            +E L NKR++ F L +  +  + +  D L +I  SD  DPKSF N  +++ Y+ +  +F
Sbjct: 509 VDEFLKNKRLVTFALTAFDLQDKALSNDTLRKILTSDPTDPKSFINKPENSAYRSMAVAF 568

Query: 577 NFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN 636
           NF   G+       +VQ    +  T D Y  Q +E+   +++    LALYF+R  P+I +
Sbjct: 569 NFGTDGKDLTTPTQQVQTRSQMVATTDAYARQTLEENAGDQNEGARLALYFQRLAPSITS 628

Query: 637 HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKA 696
            Y IL D  L +V    L L    +      +  ++ K +KI D +D +K++ FL    A
Sbjct: 629 AYSILADKALLQVAQTALGLPTSMSNADIDVQANMITKKLKIADLQDPEKLKKFLARFSA 688

Query: 697 MDHQSIDYKKALFSSPNQNKDPW 719
           M     D   +  +  N      
Sbjct: 689 M----YDINNSDITQTNPAITIL 707


>gi|90420304|ref|ZP_01228212.1| putative IMP dehydrogenase/GMP reductase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90335638|gb|EAS49388.1| putative IMP dehydrogenase/GMP reductase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 725

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 189/755 (25%), Positives = 323/755 (42%), Gaps = 71/755 (9%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ + ++    ++D+ ++    ++ DP+V  E  YYR  I  +STIDEF+ D RL+SYA+
Sbjct: 11  MLSNTLSYQLYTRDM-TRTLDRIAADPVVKREAEYYRTNIHSVSTIDEFMADYRLYSYAM 69

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF----SPPPKVIQS 115
           KA GL +   ++  IKK+LESDLSD KSL N+L+  +Y+ FA+++ F     PP  V Q+
Sbjct: 70  KAHGLEEQIGSKALIKKVLESDLSDSKSLANKLSDERYRTFAKAFSFINTAEPPVLVAQT 129

Query: 116 DIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             Q   +++ Y        +V    +K +   I  I++VD+      L +  L S  I P
Sbjct: 130 VGQTDLVVEAYSDYRTRAGQVHATAAKAYMDGIGAISNVDEFLNSTHLFNVSLASVGIDP 189

Query: 176 KYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEK 235
              S  F++DVLT   A+       + DNR+  +A    F+PDGS+     + ++ +   
Sbjct: 190 SIASRSFIRDVLTGNAAD---GPAANGDNRYADLAAMLAFEPDGSIPAGG-LQSEKEANN 245

Query: 236 IVSNYFNN---TIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
            V  YF                +YY+  I  + +  + + DP+LF +   S+   + E+ 
Sbjct: 246 TVFEYFAKKGLATSEQAAAYQVSYYESEIAKIRTADELVNDPRLFGIALSSVGLSDSEMP 305

Query: 293 A-------------DKFLTLMQENDPIVSQVK-----YFFQINFHRDNS--SSTKIQQDS 332
           +             +  L  M E+ P     K        + NF    +       Q D+
Sbjct: 306 SYAWTLITSDPDDPNSDLNQMPEDTPASLARKEKYKLLNERFNFDTQGNLPVGEPAQSDA 365

Query: 333 QIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIIT 392
             +  +D Y  N +       +     +++ +  + ++   +S                 
Sbjct: 366 AREATVDGYFANYRTATAGNDKIATSLFRVAVSGMSTVRQFVSSSA-------------V 412

Query: 393 LQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGP 452
             +AL A+ L+     R  +  VL S+PSDP SYAN   +DR +KL  AFNF+  G I  
Sbjct: 413 YDYALKAFGLDPATESRSSIMRVLRSDPSDPSSYANSLNNDRYVKLAAAFNFDDSGKIAA 472

Query: 453 IPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNIN 512
             + Q+     D    YA                    +     +  I      Y   + 
Sbjct: 473 QRIAQTEANQIDTATRYAGS---------------FGDTPTTAESKAITEATTAYKKALL 517

Query: 513 TIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEI 572
           +I S  + ++NK ++NF L++ G+++ ++ +  L  I  SD  DP+SF N   D R  E 
Sbjct: 518 SIVSVNDFVSNKTVVNFALKAYGLEADRLSQKDLVSILTSDPSDPESFVNKSGDRRLIEF 577

Query: 573 ISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIP 632
            +++ F   G +    + ++Q       T D Y  Q +E++    + ++ LALYF+R  P
Sbjct: 578 AAAYAFTPDGGIER-GVHEIQSASDFLSTQDFYLRQTMEEEAGADNESVRLALYFRRLAP 636

Query: 633 NIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLY 692
            + + YEIL D  L  VV   + L    +      + R ++K + +   KD K +E F+ 
Sbjct: 637 ELTSIYEILADPALLTVVQTAVGLPAESSQSNLDLQKRTIEKKLDLETLKDPKGLERFIS 696

Query: 693 AAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQ 727
              A+             S +    P         
Sbjct: 697 RYLALQE---------AQSTSTATSPALAILGSSG 722


>gi|315122487|ref|YP_004062976.1| hypothetical protein CKC_03695 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495889|gb|ADR52488.1| hypothetical protein CKC_03695 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 757

 Score =  527 bits (1358), Expect = e-147,   Method: Composition-based stats.
 Identities = 406/740 (54%), Positives = 529/740 (71%), Gaps = 16/740 (2%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
            K  +T+SKDPIVS EE+YYRE+IK IST++EFI DKRL +Y LKAF LSDMSHA+ F++
Sbjct: 28  KKSIATISKDPIVSREEKYYREKIKKISTVEEFINDKRLLNYVLKAFDLSDMSHAKTFLQ 87

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEE 135
           KIL SDLS P+SLVN++NS KYQ FA  +DFSP PK IQ+ IQ K +I+DY  S++ KE+
Sbjct: 88  KILTSDLSVPESLVNKMNSKKYQTFASQFDFSPAPKSIQTTIQQKKVIEDYITSYKRKEK 147

Query: 136 VALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPK 195
            ALEESKYFR+NI+ I SVDQL K+RRL++Y LQSF I P+YISL FLK+ LT  L + K
Sbjct: 148 DALEESKYFRQNINNITSVDQLIKNRRLVNYALQSFGINPQYISLSFLKESLTSELDHTK 207

Query: 196 KYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV---S 252
           +     ++N   A+A+NFRFQ +GS   +DKILT+MQIE +V NYF++TI  VP     S
Sbjct: 208 Q--KTPKENLLHALADNFRFQSNGSPIHKDKILTNMQIENMVHNYFSHTIMSVPEEVIFS 265

Query: 253 DQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKY 312
           DQ YY+ +INS+ SF   LKDPKL+K+LQ+SL   +P++T + FL L++ NDP + QVK 
Sbjct: 266 DQKYYRSSINSIPSFEQLLKDPKLYKILQISLSL-DPKVTENNFLKLIKNNDPSIVQVKK 324

Query: 313 FFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPL-GKIKSID 371
           FFQI++  D +S   IQ   QI K+L LY+ NC+ L   K++SLI++Y+  + G IKS+D
Sbjct: 325 FFQIDYAGDINSRPAIQTKKQIDKLLFLYQTNCKKLRSQKIESLIENYKKDISGDIKSVD 384

Query: 372 NLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSK 431
             L+ K +    ++  +PI  L+FAL AY +   DL++ +LR++L S+ SD  SY N+ K
Sbjct: 385 QFLNMKPKSYISSNKSQPITPLEFALQAYGIKKNDLNKYRLRDILISDSSDSKSYVNQLK 444

Query: 432 DDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQIS 491
           D+R I L+HAFNFN  G IG   + QS+LT+RDNV +Y   K+S+++      N +   +
Sbjct: 445 DNRFINLHHAFNFNKKGEIGFNRLTQSKLTLRDNVMNYIGYKKSLYNE-----NKIFSSA 499

Query: 492 TQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
              RI  + + EV+YYT NI TIHSF +LLANKRILNFLLESK ID +KV+  FL +IFK
Sbjct: 500 QNIRIKKDTDKEVEYYTSNIQTIHSFNDLLANKRILNFLLESKEIDPKKVKNSFLEKIFK 559

Query: 552 SDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIE 611
           SDL + KS ANTYKD+RYKEI+ SFNFDIHG  S++  GKVQDNFHID   DLYK+Q+++
Sbjct: 560 SDLNNTKSLANTYKDSRYKEIMLSFNFDIHGTKSNENTGKVQDNFHIDHVVDLYKNQILQ 619

Query: 612 KKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRI 671
           KKEEEKDP++AL LYFKRTIP I+N Y+ILGD  LF+V+SKKL+LSP+F  LPE  KI I
Sbjct: 620 KKEEEKDPDVALLLYFKRTIPTIKNIYDILGDKNLFQVISKKLRLSPHFPSLPESTKIHI 679

Query: 672 LKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNN-SFDDPQNNV 730
           LKK I I DFKD KK+E+FLY   A++           +       P    S DD + N+
Sbjct: 680 LKKLINIKDFKDPKKLENFLY---AVNVNHYQSTTHKIALTLAFFPPLEKDSMDDHEKNI 736

Query: 731 SLQLSPQKKSNGRFSILNLF 750
           SLQLSP KK NG+FSILNLF
Sbjct: 737 SLQLSPNKKENGKFSILNLF 756



 Score =  182 bits (461), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 114/588 (19%), Positives = 230/588 (39%), Gaps = 91/588 (15%)

Query: 100 FARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFK 159
            A  + +S       S++     +     +   K+ +   E KY+R+ I KI++V++   
Sbjct: 3   LANVWSYSMISTASISNLILSDKVYKKSIATISKDPIVSREEKYYREKIKKISTVEEFIN 62

Query: 160 DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG 219
           D+RLL+YVL++F ++    +  FL+ +LT  L+ P+    +    +++  A  F F P  
Sbjct: 63  DKRLLNYVLKAFDLSDMSHAKTFLQKILTSDLSVPESLVNKMNSKKYQTFASQFDFSP-- 120

Query: 220 SLSKRDKILTDMQIEKIVSNYFNNTID-CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFK 278
                  I T +Q +K++ +Y  +        + +  Y++  IN+++S    +K+ +L  
Sbjct: 121 ---APKSIQTTIQQKKVIEDYITSYKRKEKDALEESKYFRQNINNITSVDQLIKNRRLVN 177

Query: 279 MLQLSLFPLNPEITADKFLTLMQENDPIVSQVK---------YFFQINFHRDNSS--STK 327
               S    NP+  +  FL     ++   ++ K               F  + S     K
Sbjct: 178 YALQSFGI-NPQYISLSFLKESLTSELDHTKQKTPKENLLHALADNFRFQSNGSPIHKDK 236

Query: 328 IQQDSQIQKMLDLYKKNCQILH-DDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSA 386
           I  + QI+ M+  Y  +  +   ++ + S  K Y+  +  I S + LL            
Sbjct: 237 ILTNMQIENMVHNYFSHTIMSVPEEVIFSDQKYYRSSINSIPSFEQLLKD---------- 286

Query: 387 EEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNA 446
                  +    + +L+ +  + + L+ +  ++PS             ++++   F  + 
Sbjct: 287 ---PKLYKILQISLSLDPKVTENNFLKLIKNNDPS-------------IVQVKKFFQIDY 330

Query: 447 DGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDY 506
            G I   P +Q++  I   +  Y    + +                    + +I S ++ 
Sbjct: 331 AGDINSRPAIQTKKQIDKLLFLYQTNCKKL-------------------RSQKIESLIEN 371

Query: 507 YTLNI-NTIHSFEELLANK-------------RILNFLLESKGIDSQKVREDFLCEIFKS 552
           Y  +I   I S ++ L  K               L F L++ GI    + +  L +I  S
Sbjct: 372 YKKDISGDIKSVDQFLNMKPKSYISSNKSQPITPLEFALQAYGIKKNDLNKYRLRDILIS 431

Query: 553 DLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYK--HQMI 610
           D  D KS+ N  KDNR+  +  +FNF+  GE+   ++   Q    + D    Y    + +
Sbjct: 432 DSSDSKSYVNQLKDNRFINLHHAFNFNKKGEIGFNRLT--QSKLTLRDNVMNYIGYKKSL 489

Query: 611 --EKKEEEKDPNIAL-------ALYFKRTIPNIRNHYEILGDSKLFKV 649
             E K      NI +         Y+   I  I +  ++L + ++   
Sbjct: 490 YNENKIFSSAQNIRIKKDTDKEVEYYTSNIQTIHSFNDLLANKRILNF 537



 Score =  163 bits (412), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 112/612 (18%), Positives = 222/612 (36%), Gaps = 108/612 (17%)

Query: 14  IQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKF 73
           I+  + S   K+     E +Y+R+ I +I+++D+ IK++RL +YAL++FG++    +  F
Sbjct: 135 IEDYITSYKRKEKDALEESKYFRQNINNITSVDQLIKNRRLVNYALQSFGINPQYISLSF 194

Query: 74  IKKILESDLSDPKSLV---NQLNSLKYQYFARSYDFSPPPKV-----IQSDIQHKTIIQD 125
           +K+ L S+L   K      N L+       A ++ F           I +++Q + ++ +
Sbjct: 195 LKESLTSELDHTKQKTPKENLLH-----ALADNFRFQSNGSPIHKDKILTNMQIENMVHN 249

Query: 126 YKQSHQHKEEVAL--EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
           Y           +   + KY+R +I+ I S +QL KD +L   +  S S+ PK     FL
Sbjct: 250 YFSHTIMSVPEEVIFSDQKYYRSSINSIPSFEQLLKDPKLYKILQISLSLDPKVTENNFL 309

Query: 184 KDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNN 243
           K +     +                + + F+    G ++ R  I T  QI+K++  Y  N
Sbjct: 310 KLIKNNDPS-------------IVQVKKFFQIDYAGDINSRPAIQTKKQIDKLLFLYQTN 356

Query: 244 --TIDCVPIVSDQNYYKLAI-NSVSSFSDFL-------------KDPKLFKMLQLSLFPL 287
              +    I S    YK  I   + S   FL             +     +    +    
Sbjct: 357 CKKLRSQKIESLIENYKKDISGDIKSVDQFLNMKPKSYISSNKSQPITPLEFALQAYGIK 416

Query: 288 NPEIT----ADKFLTLMQENDPIVS------QVKYFFQINFHRDNSSSTKIQQDSQIQK- 336
             ++      D  ++   ++   V+       +      NF++           S++   
Sbjct: 417 KNDLNKYRLRDILISDSSDSKSYVNQLKDNRFINLHHAFNFNKKGEIGFNRLTQSKLTLR 476

Query: 337 ---------------MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLE 381
                             ++     I         ++ Y   +  I S ++LL+ K    
Sbjct: 477 DNVMNYIGYKKSLYNENKIFSSAQNIRIKKDTDKEVEYYTSNIQTIHSFNDLLANKR--- 533

Query: 382 GPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHA 441
                      L F L++  ++ + +    L  +  S+ ++  S AN  KD R  ++  +
Sbjct: 534 ----------ILNFLLESKEIDPKKVKNSFLEKIFKSDLNNTKSLANTYKDSRYKEIMLS 583

Query: 442 FNFNADGSIGPIPMM--QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
           FNF+  G+         Q    I   V  Y N+     +                  + +
Sbjct: 584 FNFDIHGTKSNENTGKVQDNFHIDHVVDLYKNQILQKKEE---------------EKDPD 628

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID------SQKVREDFLCEIFK-S 552
           +   + Y+   I TI +  ++L +K +   + +   +        +  +   L ++    
Sbjct: 629 VALLL-YFKRTIPTIKNIYDILGDKNLFQVISKKLRLSPHFPSLPESTKIHILKKLINIK 687

Query: 553 DLKDPKSFANTY 564
           D KDPK   N  
Sbjct: 688 DFKDPKKLENFL 699



 Score =  112 bits (280), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 47/229 (20%), Positives = 89/229 (38%), Gaps = 15/229 (6%)

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
            Y+    +       S    ++       +  ++ E  YY   I  I + EE + +KR+L
Sbjct: 8   SYSMISTASISNLILSDKVYKKSIATISKDPIVSREEKYYREKIKKISTVEEFINDKRLL 67

Query: 528 NFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK 587
           N++L++  +      + FL +I  SDL  P+S  N     +Y+   S F+F    +    
Sbjct: 68  NYVLKAFDLSDMSHAKTFLQKILTSDLSVPESLVNKMNSKKYQTFASQFDFSPAPKSIQT 127

Query: 588 KIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLF 647
               +Q    I+D    YK +  EK   E+        YF++ I NI +  +++ + +L 
Sbjct: 128 ---TIQQKKVIEDYITSYKRK--EKDALEESK------YFRQNINNITSVDQLIKNRRLV 176

Query: 648 KVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKK--VEDFLYAA 694
               +   ++P +  L   K    L   +     K  K+  +       
Sbjct: 177 NYALQSFGINPQYISLSFLK--ESLTSELDHTKQKTPKENLLHALADNF 223



 Score =  108 bits (270), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/213 (18%), Positives = 89/213 (41%), Gaps = 18/213 (8%)

Query: 5   HVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGL 64
           +     +++        +        E  YY   I+ I + ++ + +KR+ ++ L++  +
Sbjct: 485 YKKSLYNENKIFSSAQNIRIKKDTDKEVEYYTSNIQTIHSFNDLLANKRILNFLLESKEI 544

Query: 65  SDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-------SPPPKVIQSDI 117
                   F++KI +SDL++ KSL N     +Y+    S++F       +     +Q + 
Sbjct: 545 DPKKVKNSFLEKIFKSDLNNTKSLANTYKDSRYKEIMLSFNFDIHGTKSNENTGKVQDNF 604

Query: 118 QHKTIIQDYKQSH----QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
               ++  YK       + +++  +    YF++ I  I ++  +  D+ L   + +   +
Sbjct: 605 HIDHVVDLYKNQILQKKEEEKDPDVALLLYFKRTIPTIKNIYDILGDKNLFQVISKKLRL 664

Query: 174 TPKYISLP------FLKDVLT-LGLANPKKYFI 199
           +P + SLP       LK ++      +PKK   
Sbjct: 665 SPHFPSLPESTKIHILKKLINIKDFKDPKKLEN 697


>gi|222085079|ref|YP_002543609.1| hypothetical protein Arad_1171 [Agrobacterium radiobacter K84]
 gi|221722527|gb|ACM25683.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 836

 Score =  470 bits (1208), Expect = e-130,   Method: Composition-based stats.
 Identities = 184/742 (24%), Positives = 310/742 (41%), Gaps = 71/742 (9%)

Query: 29  SCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSL 88
             E  Y+ + I  + T+D+ + + RL +Y L+A+GL     +  F+K++L SDLSDP S 
Sbjct: 139 QTETTYFSQNISSVKTVDDLLGNSRLKNYVLQAYGLDPTYTSNSFLKQMLTSDLSDPDSF 198

Query: 89  VNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNI 148
           VNQ  S   +     ++F+    V  S                        ++ Y+  +I
Sbjct: 199 VNQNGSAADKAIVAEFNFNADGTVKTSTA--------------------DADTTYYENHI 238

Query: 149 HKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRA 208
             I SV QL  D +L +YV  +F I     +  F             K    +       
Sbjct: 239 STITSVSQLTADPKLFNYVKTAFDIPAYITATQF---------NAAAKDASVAATKGLTD 289

Query: 209 MAENFRFQPDGSLSKRDKILTDMQIEKIVSNY------------------------FNNT 244
           +   F FQ DG+++   +  T  QI      Y                          + 
Sbjct: 290 VMAQFNFQSDGTVASGSQAQTSAQISATTDAYATNYKGGPQTLGQMADVMSAYNSAVPSY 349

Query: 245 IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPL-NPEITADKFLTLMQEN 303
              V    +  YYK  I S+++  +   D +LF  ++ +     +      K        
Sbjct: 350 TTDVGANDNDLYYKEHIGSITTVDELTSDTRLFDYIKTAYGIDADTPAVVLKNAFSSSST 409

Query: 304 DPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ 361
             I        Q NF  D +  S    Q  + I      Y KN Q          + +YQ
Sbjct: 410 AAIFGLTDVVSQFNFQADGTLASGDTAQSQTAIDAASTAYMKNYQTSQTSLTTKAVSNYQ 469

Query: 362 LPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPS 421
             +  +K+ID+  +     +   S +      Q A+ AY ++  ++ + Q++ +L S+P 
Sbjct: 470 TRIAAVKTIDDFFATNATADSDTSNDSLPELYQMAMRAYGISPDEMTKTQMKKILESDPY 529

Query: 422 DPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAEN 481
           DP SY N  KD R   L  AFNF++DG + P     S+  I   V  Y++R +       
Sbjct: 530 DPKSYVNSLKDTRFTNLAKAFNFDSDGKLKPPVQALSQTQINSYVSEYSSRSKIGLTGAE 589

Query: 482 KSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKV 541
            +           +   +      Y+  NI  + S  +LLA+ ++ +++L++ GID + V
Sbjct: 590 LT-----------KATSDAKDAGTYFATNIVKVTSVTDLLADSKLTDYILKANGIDPKTV 638

Query: 542 REDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDT 601
               L + F SD  D KSF NT    ++K I+++FNFD  G L++ K+G  Q+   I DT
Sbjct: 639 DTATLKKAFASDPSDSKSFINTDDGAQFKSIVNAFNFDTDGNLTNTKLGTAQNQGTIADT 698

Query: 602 CDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
            DL+ HQ +E +E E +  + LALYF+R  P+I + Y+I+GD+ L++V++    L    +
Sbjct: 699 NDLFLHQTLEDQEGETNTGVQLALYFQRKAPDISSIYDIMGDTALYQVITTTYSLPSSMS 758

Query: 662 VLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNN 721
            +    + ++L K + ++D +D  KV   L    AM     D      SS +       +
Sbjct: 759 SMDVDTQAKLLAKFVDVSDLQDPTKVNKLLQRFSAM----YDLANNTTSSTSPALSILTS 814

Query: 722 SFDDPQNNVSLQLSPQKKSNGR 743
           S      +    LS  + S+ +
Sbjct: 815 SSSSVGISADTLLSIAQLSSTK 836



 Score =  349 bits (894), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 155/699 (22%), Positives = 266/699 (38%), Gaps = 86/699 (12%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI +++    +    +   + V+       +  YY   I  ++ +D+F+ D +L+SYA++
Sbjct: 1   MISTYLGYTVATRNMATTLNQVASQSQSKRQIDYYNANIGKVTNVDDFMGDYQLYSYAME 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP-PKVIQSDIQH 119
           A+GLSDM++A+ F+K++L SDLSD  S  N+L   +Y+ FA +++F        QS  Q 
Sbjct: 61  AYGLSDMTYAKAFMKQVLTSDLSDSTSFANKLTDPRYKEFAAAFNFGTGSSSTAQSSTQE 120

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y QS   +   A  E+ YF +NI  + +VD L  + RL +YVLQ++ + P Y S
Sbjct: 121 DDLIGLYNQSFTTEATNAQTETTYFSQNISSVKTVDDLLGNSRLKNYVLQAYGLDPTYTS 180

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLK +LT  L++P  +  ++     +A+   F F  DG++                  
Sbjct: 181 NSFLKQMLTSDLSDPDSFVNQNGSAADKAIVAEFNFNADGTVKTST-------------- 226

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-KFLT 298
                       +D  YY+  I++++S S    DPKLF  ++ +                
Sbjct: 227 ----------ADADTTYYENHISTITSVSQLTADPKLFNYVKTAFDIPAYITATQFNAAA 276

Query: 299 LMQENDPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNC----------- 345
                           Q NF  D +  S ++ Q  +QI    D Y  N            
Sbjct: 277 KDASVAATKGLTDVMAQFNFQSDGTVASGSQAQTSAQISATTDAYATNYKGGPQTLGQMA 336

Query: 346 -----------QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQ 394
                          D         Y+  +G I ++D L S                   
Sbjct: 337 DVMSAYNSAVPSYTTDVGANDNDLYYKEHIGSITTVDELTSDTR-------------LFD 383

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
           +   AY ++           V+  N     S A       L  +   FNF ADG++    
Sbjct: 384 YIKTAYGIDADTPA------VVLKNAFSSSSTAAIFG---LTDVVSQFNFQADGTLASGD 434

Query: 455 MMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTI 514
             QS+  I      Y    ++   +      S  Q        ++     +    +  + 
Sbjct: 435 TAQSQTAIDAASTAYMKNYQTSQTSLTTKAVSNYQTRIAAVKTIDDFFATNATADSDTSN 494

Query: 515 HSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
            S  E      +    + + GI   ++ +  + +I +SD  DPKS+ N+ KD R+  +  
Sbjct: 495 DSLPE------LYQMAMRAYGISPDEMTKTQMKKILESDPYDPKSYVNSLKDTRFTNLAK 548

Query: 575 SFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEK----DPNIALA-LYFKR 629
           +FNFD  G+L  K   +      I+     Y  +        +      +   A  YF  
Sbjct: 549 AFNFDSDGKL--KPPVQALSQTQINSYVSEYSSRSKIGLTGAELTKATSDAKDAGTYFAT 606

Query: 630 TIPNIRNHYEILGDSKLFKVVSKKLKL-SPYFAVLPERK 667
            I  + +  ++L DSKL   + K   +          +K
Sbjct: 607 NIVKVTSVTDLLADSKLTDYILKANGIDPKTVDTATLKK 645


>gi|90423974|ref|YP_532344.1| hypothetical protein RPC_2474 [Rhodopseudomonas palustris BisB18]
 gi|90105988|gb|ABD88025.1| protein of unknown function DUF1217 [Rhodopseudomonas palustris
           BisB18]
          Length = 801

 Score =  439 bits (1128), Expect = e-120,   Method: Composition-based stats.
 Identities = 160/726 (22%), Positives = 284/726 (39%), Gaps = 94/726 (12%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           V  + RYY  +I  ++T+D+ + D RL  Y   AFG+ +   +   ++K+L SD SDP S
Sbjct: 138 VGEDTRYYNAKIGSVTTVDQLLNDDRLRGYVFSAFGIDEDHWSRDTLRKVLSSDSSDPNS 197

Query: 88  LVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKN 147
            VN +                             +I    Q+     +   +   Y    
Sbjct: 198 YVNAVWGP----------------------PLDDLIAKLDQAQLDSSDAKSKIVDY---- 231

Query: 148 IHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRD-NRF 206
                                    +      +   +  L    A+   Y       + +
Sbjct: 232 ---------------TTQLTQPGADLADLNAKIAEQRTRLGKTAADISSYTGSITAISHY 276

Query: 207 RAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP--IVSDQNYYKLAINSV 264
             +A  F F PDG+L+      TD   +     +  +     P   + ++ +++  I   
Sbjct: 277 FDLAGAFEFSPDGTLAAGVSAQTDASRKTTNERFITSQPRTSPSTALLEKQFFQQKIAGA 336

Query: 265 SSFSDFLKDP----------KLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFF 314
            +    L  P            F +  L L  +   +T+D+               K  +
Sbjct: 337 RTVDQLLAAPDAARVASFIGTAFGLGTLPLSTIKSILTSDRDPNNPNSYVNSAGSKKDAY 396

Query: 315 -----QINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKI 367
                  NF++D +  +    Q ++Q    +  Y        +   +  I+ ++  +  I
Sbjct: 397 TRLMKAFNFNQDGTLDAGVDAQSETQTATTVGYYMVAYNDADEASDKLAIQRFRNGVYSI 456

Query: 368 KSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYA 427
            SI+  +S                   FAL +  L+   +    ++  L S+ S+P SY 
Sbjct: 457 TSIEKFVSTPA-------------VYNFALKSVGLDPDSVSAITVKAALESDLSNPRSYV 503

Query: 428 NKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSM 487
              KD+R ++L  +FNF++ G +    + Q    + +  K Y   K     A +K+    
Sbjct: 504 YTLKDERYVQLARSFNFDSKGHLTTPLVAQDTAEVGNIAKDYVIAKTKFATAADKATL-- 561

Query: 488 EQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC 547
                         ++   Y   I  + S  ELL++K+++NF+L +KG+D +KV  D L 
Sbjct: 562 ---------QKTAENDAVEYRSKIAGVDSVAELLSDKKLVNFILVAKGLDPKKVTPDTLK 612

Query: 548 EIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKH 607
           +I  SDL DPKSFANT  D R+ E+ +SFNFD  G+++   +   Q+   + +T   Y  
Sbjct: 613 KILSSDLSDPKSFANTASDTRFAELAASFNFDKTGKVARFVVAGPQNREQLLETQTKYLQ 672

Query: 608 QMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERK 667
           Q +E ++   +P + LALYF+R  P+I + Y+IL D  L +VV     L    A  P  +
Sbjct: 673 QSLEAQQGGANPGVRLALYFQRKAPDITSAYDILADKALSEVVRTTYNLPDSMANAPIEQ 732

Query: 668 KIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQ 727
           + +I++K++K+ D  D  ++   L     M     D K A     +QN+ P         
Sbjct: 733 QAKIVEKYLKLKDLSDPAQLAKILSRFSVM----YDVKNA-----SQNQSPALAILTGSG 783

Query: 728 NNVSLQ 733
            ++S  
Sbjct: 784 ASISQD 789



 Score =  344 bits (882), Expect = 4e-92,   Method: Composition-based stats.
 Identities = 151/697 (21%), Positives = 268/697 (38%), Gaps = 86/697 (12%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ ++++    +++++  L + V+K   V+ E  YY++ I  + T+D+ +K+ RL+ YA+
Sbjct: 1   MVSTYLSYDLVARNLKQSL-TRVAKQTDVTREAAYYKDNIGKVKTVDDLLKNDRLYRYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQ 118
           KA+GL DM+ A+ F++K+LESDLSD KS  N+L   +Y+ FA ++ F        QS  Q
Sbjct: 60  KAYGLEDMTFAKAFMRKVLESDLSDTKSFANKLTDKRYREFASAFSFTGGTTAAAQSSYQ 119

Query: 119 HKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYI 178
              ++  Y  + Q + +   E+++Y+   I  + +VDQL  D RL  YV  +F I   + 
Sbjct: 120 TDEMVGLYTATLQRQADAVGEDTRYYNAKIGSVTTVDQLLNDDRLRGYVFSAFGIDEDHW 179

Query: 179 SLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVS 238
           S   L+ VL+   ++P  Y           +                     +      S
Sbjct: 180 SRDTLRKVLSSDSSDPNSYVNAVWGPPLDDLIAKLD-------------QAQLDSSDAKS 226

Query: 239 NYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLT 298
              + T       +D       I    +           ++ + +    +   +      
Sbjct: 227 KIVDYTTQLTQPGADLADLNAKIAEQRT-----------RLGKTAADISSYTGSI----- 270

Query: 299 LMQENDPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSL 356
                  I           F  D +  +    Q D+  +   + +  +            
Sbjct: 271 -----TAISHYFDLAGAFEFSPDGTLAAGVSAQTDASRKTTNERFITSQPRTSPSTALLE 325

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
            + +Q  +   +++D LL+                   F   A+ L    L    ++++L
Sbjct: 326 KQFFQQKIAGARTVDQLLAAPDA----------ARVASFIGTAFGLGTLPLST--IKSIL 373

Query: 417 TS--NPSDPDSYANK--SKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANR 472
           TS  +P++P+SY N   SK D   +L  AFNFN DG++      QS       V +Y   
Sbjct: 374 TSDRDPNNPNSYVNSAGSKKDAYTRLMKAFNFNQDGTLDAGVDAQSETQTATTVGYYMVA 433

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                             + +    L I      +   + +I S E+ ++   + NF L+
Sbjct: 434 ---------------YNDADEASDKLAIQR----FRNGVYSITSIEKFVSTPAVYNFALK 474

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK---KI 589
           S G+D   V    +    +SDL +P+S+  T KD RY ++  SFNFD  G L+     + 
Sbjct: 475 SVGLDPDSVSAITVKAALESDLSNPRSYVYTLKDERYVQLARSFNFDSKGHLTTPLVAQD 534

Query: 590 GKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKV 649
                N   D      K      K   +      A+ ++  I  + +  E+L D KL   
Sbjct: 535 TAEVGNIAKDYVIAKTKFATAADKATLQKTAENDAVEYRSKIAGVDSVAELLSDKKLVNF 594

Query: 650 VSKKLKL-SPYFAVLPERKKIRILKKHIKINDFKDSK 685
           +     L                  K I  +D  D K
Sbjct: 595 ILVAKGLDPKKVTPDTL--------KKILSSDLSDPK 623



 Score =  111 bits (276), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 46/209 (22%), Positives = 84/209 (40%), Gaps = 18/209 (8%)

Query: 8   PFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDM 67
              +K   +      +       +   YR +I  + ++ E + DK+L ++ L A GL   
Sbjct: 545 YVIAKTKFATAADKATLQKTAENDAVEYRSKIAGVDSVAELLSDKKLVNFILVAKGLDPK 604

Query: 68  SHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVI-------QSDIQHK 120
                 +KKIL SDLSDPKS  N  +  ++   A S++F    KV        Q+  Q  
Sbjct: 605 KVTPDTLKKILSSDLSDPKSFANTASDTRFAELAASFNFDKTGKVARFVVAGPQNREQLL 664

Query: 121 TIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
                Y +QS + ++  A    +   YF++    I S   +  D+ L + V  ++++   
Sbjct: 665 ETQTKYLQQSLEAQQGGANPGVRLALYFQRKAPDITSAYDILADKALSEVVRTTYNLPDS 724

Query: 177 YISLPFLKDVLT-------LGLANPKKYF 198
             + P  +             L++P +  
Sbjct: 725 MANAPIEQQAKIVEKYLKLKDLSDPAQLA 753


>gi|209548151|ref|YP_002280068.1| hypothetical protein Rleg2_0545 [Rhizobium leguminosarum bv. trifolii
            WSM2304]
 gi|209533907|gb|ACI53842.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
            trifolii WSM2304]
          Length = 1111

 Score =  417 bits (1072), Expect = e-114,   Method: Composition-based stats.
 Identities = 157/693 (22%), Positives = 281/693 (40%), Gaps = 62/693 (8%)

Query: 32   ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
              ++   I  ++++D+ + D    SY   +  ++D S ++  ++  L     DP +   Q
Sbjct: 456  AAHFNAMIDSVTSVDDIMSDPVAVSYLRTSMQVAD-SVSDATLRTFLV----DPAAASAQ 510

Query: 92   LNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKI 151
                 Y      ++F     V                        A   + Y++  I  I
Sbjct: 511  G----YSDVHDLFNFKTDGSVATLYASQTA------AQSASTSSKADNAAVYYQATIAGI 560

Query: 152  NSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAE 211
             +VDQL  D++L ++V  +F I      +  L+ +LT           +S    +  +A 
Sbjct: 561  ANVDQLLSDQKLNNFVRNAFGIPSTVTDVA-LRGILTD----------QSGTGTYADVAA 609

Query: 212  NFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFL 271
             F F+ DGSL       TD QI                  +  + Y   + ++++  D +
Sbjct: 610  AFNFKADGSLKDGLAAQTDTQIRNTKF----------AAGARTDDYSARMATIANVDDLI 659

Query: 272  KDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS--TKI 328
             DP +   L+ +         AD K                     NF  D S    + +
Sbjct: 660  ADPAITNFLKSTYNLPLNISNADLKSYLTDATAASAAGYADLNADFNFAADGSLPVVSSV 719

Query: 329  QQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK---------IKSIDNLLSGKCQ 379
            Q   Q Q   D Y        ++ +  +  +Y   +           IKS+++ +     
Sbjct: 720  QTADQAQTTNDNYMARYDDEREEAIDEVASNYSSMMADSTSLLDTAEIKSVNDFMRTNAT 779

Query: 380  LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
             +   S +        AL A+ L  QD+ R  +R +LTS+  DP+ Y    KD+R+  + 
Sbjct: 780  ADFKKSNDNLPDPYHVALQAFGLTEQDVPRSMMRKILTSDAYDPNGYIASLKDERITNMA 839

Query: 440  HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
             AFNF  DG            T+      Y      +  A             + + + +
Sbjct: 840  RAFNFGPDGKAASPFQALPDATLAKYATDYKAHMTMLLKA----------GPVKDKASKD 889

Query: 500  INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
              +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  D KS
Sbjct: 890  ATTEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKS 949

Query: 560  FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            + N   D R+K+I+++FNFD  G L+  K+G +Q+    + T +LY  Q +E ++ E + 
Sbjct: 950  YLNAKADARFKDIVAAFNFDKDGNLTRAKMGTIQNKAAEEHTQELYVQQTMEAQQGESND 1009

Query: 620  NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
             + LALYF R  P+I + Y ILGD  L++VV+    L    + +   K+  +L + +K+ 
Sbjct: 1010 GVRLALYFSRKAPSITSIYSILGDKALYQVVTTAYSLPSQMSGMDVTKQADLLNRFVKLE 1069

Query: 680  DFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            D +D KKV+  +    AM     D + +   SP
Sbjct: 1070 DLQDPKKVDKLVRRFTAM----YDVQNSTQQSP 1098



 Score =  348 bits (892), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 154/677 (22%), Positives = 279/677 (41%), Gaps = 108/677 (15%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  +  YY + I  ++++D+F+ D +L+SYA+
Sbjct: 1   MITASLAYTILSKDMTSSL-NKVASQATVKKDAEYYADHINKVTSVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFASAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++    ES Y+  NI  + +VD L  + RL  YVL++F+I P Y S
Sbjct: 120 DDLIGLYKQSFIDADKATTAESTYYSNNIDSVTTVDDLVNNTRLRTYVLKTFNIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++  
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASVIET 237

Query: 240 YFNNT---------------IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+               ++      +Q YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVVYVNKTAADYNQAYYTAKIGTITNVDDLVADKRLTSYIKTAY 297

Query: 285 FP-LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
               +    A + +        ++     +   NF  D S+S+  +  +  Q        
Sbjct: 298 SMGADFTAAALRTVLTDPGYAQLMGFTNVYNAFNFKSDGSTSSTARVRTLDQA------- 350

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
             ++       +           I ++D LL+                  ++  DAY L 
Sbjct: 351 -NKLSSAASQTANYYKVTSQSSSITNVDALLAD-------------GNMARYIKDAYGLG 396

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
                   L+N+LT       +YA          LN  FNF ADGSI    +        
Sbjct: 397 TG-FSNADLKNILT-----DSAYAAAQG---HADLNADFNFQADGSINGSVIQTD----- 442

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
                                      + +K    +  +   ++   I+++ S ++++++
Sbjct: 443 ---------------------------TQRKSTTDKSAANAAHFNAMIDSVTSVDDIMSD 475

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
              +++L  S  +              ++ L DP + +       Y ++   FNF   G 
Sbjct: 476 PVAVSYLRTSMQVADSVSDA-----TLRTFLVDPAAASAQG----YSDVHDLFNFKTDGS 526

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
           ++                  LY  Q   +           A+Y++ TI  I N  ++L D
Sbjct: 527 VAT-----------------LYASQTAAQSASTSSKADNAAVYYQATIAGIANVDQLLSD 569

Query: 644 SKLFKVVSKKLKLSPYF 660
            KL   V     +    
Sbjct: 570 QKLNNFVRNAFGIPSTV 586



 Score =  148 bits (373), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 80/437 (18%), Positives = 148/437 (33%), Gaps = 59/437 (13%)

Query: 239 NYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT------ 292
           +  N       +  D  YY   IN V+S  DFL D KL+     +    +          
Sbjct: 17  SSLNKVASQATVKKDAEYYADHINKVTSVDDFLGDYKLYSYAMKAYGLEDMTYAKAFMKK 76

Query: 293 ----ADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQIL 348
                                 ++    NF+        +Q D+Q   ++ LYK++    
Sbjct: 77  VLESDLTDPNSYANKLSDTRYREFASAFNFNAPEKD---VQTDAQEDDLIGLYKQSFIDA 133

Query: 349 HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
                      Y   +  + ++D+L++                   + L  +N++     
Sbjct: 134 DKATTAEST-YYSNNIDSVTTVDDLVNNTR-------------LRTYVLKTFNIDPTYAS 179

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKH 468
           +D LR VLTS+ SDP S  N    D+   L   F+FNADG++      Q+       ++ 
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVTG--TAQTAAQKASVIET 237

Query: 469 YANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN 528
           Y    +S+    +   + +    T    N        YYT  I TI + ++L+A+KR+ +
Sbjct: 238 YTLNSQSVIIDNSVGSDVVYVNKTAADYNQA------YYTAKIGTITNVDDLVADKRLTS 291

Query: 529 FLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKK 588
           ++  +       +  DF     ++ L DP  +A       +  + ++FNF   G  S   
Sbjct: 292 YIKTAY-----SMGADFTAAALRTVLTDPG-YAQLMG---FTNVYNAFNFKSDGSTSSTA 342

Query: 589 IGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFK 648
             +  D  +   +         +                     +I N   +L D  + +
Sbjct: 343 RVRTLDQANKLSSAASQTANYYK---------------VTSQSSSITNVDALLADGNMAR 387

Query: 649 VVSKKLKLSPYFAVLPE 665
            +     L   F+    
Sbjct: 388 YIKDAYGLGTGFSNADL 404


>gi|86356543|ref|YP_468435.1| hypothetical protein RHE_CH00897 [Rhizobium etli CFN 42]
 gi|86280645|gb|ABC89708.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 1110

 Score =  416 bits (1069), Expect = e-114,   Method: Composition-based stats.
 Identities = 165/693 (23%), Positives = 289/693 (41%), Gaps = 62/693 (8%)

Query: 32   ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
              ++   I +++ +D+ + D    SY   +  ++D           L S L DP +   Q
Sbjct: 456  AAHFNSMIGNVTNVDDIMSDPVAVSYLRTSMQIAD-----SVSDATLRSFLVDPAAASAQ 510

Query: 92   LNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKI 151
                 Y      ++F     V                        A + + Y++  I  I
Sbjct: 511  G----YSDVHDLFNFKTDGSVAT------LYATQSAAQSASTASKADDAAVYYQATIAGI 560

Query: 152  NSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAE 211
            ++VDQL  DRRL +++  ++ I P  +S   L+ +LT           +S    +  +A 
Sbjct: 561  SNVDQLLSDRRLNNFIRNAYGI-PSTVSDVDLRAILTD----------QSGTGTYADVAA 609

Query: 212  NFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFL 271
             F F+ DGSL       T  QI          T   +   +  + Y   +  +S+  D +
Sbjct: 610  AFNFKADGSLEDGMAAQTAAQI----------TNTKIAATARTDDYSARVARISNVDDLI 659

Query: 272  KDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS--TKI 328
             DP +   L+ +         AD K +                   NF  D S    + I
Sbjct: 660  ADPAITNFLKSTYNLPFDITDADLKSILTDATAAAAAGYSDLNADFNFAADGSLPVVSSI 719

Query: 329  QQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK---------IKSIDNLLSGKCQ 379
            Q   Q Q   D Y        D+ ++ +  +Y+  +           +K++++ L     
Sbjct: 720  QTADQAQTTNDNYMARYDDERDEAIEEVADNYKSMMADSSSLLNFSDVKTVNDFLRTNRS 779

Query: 380  LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
             +   S +        AL A+ L  QD+ R  +R +LTS+  DPD Y    KD+R+  L 
Sbjct: 780  ADFTKSNDNLPDLYHVALQAFGLTDQDVPRSMMRKILTSDAYDPDGYIASLKDERITNLA 839

Query: 440  HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
             AFNF  DG          + T+      Y      +  A             + + + +
Sbjct: 840  RAFNFGPDGKAASPLQALPQATMAKYATDYKAHVTMLLKA----------GPVKDKASKD 889

Query: 500  INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
              +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  D KS
Sbjct: 890  ATAEVDYFAKGMAKVQSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKS 949

Query: 560  FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            + NT  D R+K+I+++FNFD  G L+  KIG +Q+    ++T +LY  Q +E ++ E + 
Sbjct: 950  YLNTKADARFKDIVAAFNFDKDGNLTRAKIGAIQNKAAEENTQELYIKQTLETQQGESND 1009

Query: 620  NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
             + LALYF R  P+I + Y ILGD  L++V++    L    + +   K+  ++ + +K++
Sbjct: 1010 GVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVAKQADLINRFVKLD 1069

Query: 680  DFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            D +D KKV+  L    AM     D + +   SP
Sbjct: 1070 DLQDPKKVDKLLRRFTAM----YDVQNSTQQSP 1098



 Score =  351 bits (900), Expect = 3e-94,   Method: Composition-based stats.
 Identities = 150/682 (21%), Positives = 277/682 (40%), Gaps = 108/682 (15%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  +  +D+F+ D RL+SYA+
Sbjct: 1   MITASLAYTILSKDMTSSL-NKVAAQATVKKDAQYYADNINKVKDVDDFLGDYRLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DELIGLYKQSFVDADKAAATESTYYSNNIDSVQTVDDLVDNARLRTYVLKAFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   I+  
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVN--GSAQTATQKASIIET 237

Query: 240 YFNNT---------------IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+               +       +Q YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVVYVSKTAAEYNQAYYTAKIGTITNVDDLVADSRLTSYIKTAY 297

Query: 285 FP-LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
               +    A + +        ++     +   NF  D ++ST  +  +  Q        
Sbjct: 298 SMGADFTAAALRTVLTDPGYAQLMGFTNVYNAFNFKADGTTSTTARAQTIDQS------- 350

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
             ++       +           I ++D+LL+               +  ++  DAY L 
Sbjct: 351 -NKLKDAAASTANYYSVTSRSTSITNVDDLLADS-------------VLARYIKDAYGLG 396

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
                  +L+++LT +          +       LN  FNF ADGSI    +        
Sbjct: 397 -TSFSNAELKSILTDSTY--------ATAQGHADLNADFNFQADGSINGSMIQTD----- 442

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
                                      + +K    +  +   ++   I  + + ++++++
Sbjct: 443 ---------------------------AQRKSTTDKSAANAAHFNSMIGNVTNVDDIMSD 475

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
              +++L  S  I              +S L DP + +       Y ++   FNF   G 
Sbjct: 476 PVAVSYLRTSMQIADSVSDA-----TLRSFLVDPAAASAQG----YSDVHDLFNFKTDGS 526

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
           ++     +         +                      A+Y++ TI  I N  ++L D
Sbjct: 527 VATLYATQSAAQSASTASKADDA-----------------AVYYQATIAGISNVDQLLSD 569

Query: 644 SKLFKVVSKKLKLSPYFAVLPE 665
            +L   +     +    + +  
Sbjct: 570 RRLNNFIRNAYGIPSTVSDVDL 591


>gi|327188120|gb|EGE55342.1| hypothetical protein RHECNPAF_944004 [Rhizobium etli CNPAF512]
          Length = 1111

 Score =  413 bits (1061), Expect = e-113,   Method: Composition-based stats.
 Identities = 157/693 (22%), Positives = 286/693 (41%), Gaps = 62/693 (8%)

Query: 32   ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
              ++   I +++ +D+ + D    SY   +  ++D S ++  ++  L     DP +   Q
Sbjct: 456  AAHFNAMIGNVTNVDDIMSDPVAVSYLRTSMQIAD-SVSDATLRTFLV----DPAAASAQ 510

Query: 92   LNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKI 151
                 Y      ++F     V                   +    A   + Y++  I  I
Sbjct: 511  G----YSDVHDLFNFKTDGSVATLHATQTA------AQSANTTSKADSAAVYYQSTIAGI 560

Query: 152  NSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAE 211
            ++VDQL  D++L ++V  ++ I      +  L+++LT           +S    +  +A 
Sbjct: 561  SNVDQLLADQKLNNFVRNAYGIPSTVTDVD-LRNILTD----------QSGTGTYADVAA 609

Query: 212  NFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFL 271
             F F+ DGSL       T  Q           T   +   +  + Y   + ++++  + +
Sbjct: 610  AFNFKADGSLEDGLAAQTSSQ----------TTNTKIAAGARTDDYSSRMATIANVDELI 659

Query: 272  KDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS--TKI 328
             DP +   L+ +         A+ K +                   NF  D S    + +
Sbjct: 660  ADPAITNFLKSTYNLPFDISDAELKSILTDATAAAAAGHADLNADFNFAADGSLPAVSSV 719

Query: 329  QQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKS---------IDNLLSGKCQ 379
            Q   Q Q   D Y        D+ ++ +  +Y   +    S         +++ L     
Sbjct: 720  QTADQAQTTNDNYMARYDDERDEAIEEVADNYSSMMADSTSLLDTAEIKTVNDFLRTNAA 779

Query: 380  LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
             +   S ++       AL A+ L  Q++ R  +R +LTS+  DP+ Y    KD+R+  L 
Sbjct: 780  ADFKKSNDKLPDPYHVALQAFGLTDQEVPRSMMRKILTSDAYDPNGYIASLKDERITNLA 839

Query: 440  HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
             AFNF  DG            T+      Y      +  A             + + + +
Sbjct: 840  RAFNFGPDGKAAAPLQALPDATLAKYATDYKAHVTMLLKA----------GPVKDKASKD 889

Query: 500  INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
              +EVDY+   +  + S ++ LA+ R+ + +L++  +D +K  +  L +IF SD  D KS
Sbjct: 890  ATTEVDYFAKGMAKVQSLDDFLADSRLTDLVLKANNLDPKKYDKATLEKIFTSDPDDKKS 949

Query: 560  FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            + NT  D R+K+I+++FNFD  G L+  KIG +Q+      T DLY  Q +E ++ E + 
Sbjct: 950  YLNTKADARFKDIVAAFNFDKDGNLTRAKIGTIQNKAAEAHTQDLYVKQTLETQQGESND 1009

Query: 620  NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
             + LALYF R  P+I + Y ILGD  L++V++    L    + +   K+  ++ + +K+ 
Sbjct: 1010 GVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVAKQADLINRFVKLE 1069

Query: 680  DFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            D +D KKV+  L    AM     D +     SP
Sbjct: 1070 DLQDPKKVDKLLRRFTAM----YDVQNNTQQSP 1098



 Score =  354 bits (909), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 156/682 (22%), Positives = 281/682 (41%), Gaps = 108/682 (15%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  +  +D+F+ D +L+SYA+
Sbjct: 1   MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVKDVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPDKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DDLIGLYKQSFVDADKAAAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++  
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASVIET 237

Query: 240 YFNNT---------------IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+               +       ++ YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVVYVSKTAADYNKAYYTAKIGTITNVDDLVADARLTSYIKTAY 297

Query: 285 FP-LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
               +    A + +        ++     +   NF  D S+ST  +  +  Q        
Sbjct: 298 SMGADFTAPALRMVLTDPSYAQLMGFTNVYNAFNFKADGSTSTTARAQTIDQA------- 350

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
             ++       +           I ++D+LL+               +  ++  DAY L 
Sbjct: 351 -NKLASAASSTANYYSVTSQSSGITNVDDLLADS-------------VMARYIKDAYGLG 396

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
           +      +L+N+LT       SYA          LN  FNFNADGSI    +        
Sbjct: 397 VN-FSNAELKNILT-----DSSYAAAQGQ---AGLNADFNFNADGSINGSVIQ------- 440

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
                                      + +K    +  +   ++   I  + + ++++++
Sbjct: 441 -------------------------TAAQRKSTTDKSAANAAHFNAMIGNVTNVDDIMSD 475

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
              +++L  S  I              ++ L DP + +       Y ++   FNF   G 
Sbjct: 476 PVAVSYLRTSMQIADSVSDA-----TLRTFLVDPAAASAQG----YSDVHDLFNFKTDGS 526

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
           ++   +   Q      +T                      A+Y++ TI  I N  ++L D
Sbjct: 527 VAT--LHATQTAAQSANTTSKADSA---------------AVYYQSTIAGISNVDQLLAD 569

Query: 644 SKLFKVVSKKLKLSPYFAVLPE 665
            KL   V     +      +  
Sbjct: 570 QKLNNFVRNAYGIPSTVTDVDL 591


>gi|190890609|ref|YP_001977151.1| hypothetical protein RHECIAT_CH0000988 [Rhizobium etli CIAT 652]
 gi|190695888|gb|ACE89973.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 1111

 Score =  413 bits (1060), Expect = e-113,   Method: Composition-based stats.
 Identities = 156/693 (22%), Positives = 284/693 (40%), Gaps = 62/693 (8%)

Query: 32   ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
              ++   I  ++ +D+ + D    SY   +  ++D S ++  ++  L     DP +   Q
Sbjct: 456  AAHFNAMIGSVTNVDDIMSDPVAVSYLRTSMQIAD-SVSDATLRTFLV----DPAAASAQ 510

Query: 92   LNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKI 151
                 Y      ++F     V                   +    A   + Y++  I  I
Sbjct: 511  G----YSDVHDLFNFKTDGSVATLYATQTA------AQSANTTSKADSAAVYYQSTIAGI 560

Query: 152  NSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAE 211
            ++VDQL  D++L ++V  ++ I      +  L+++LT           +S    +  +A 
Sbjct: 561  SNVDQLLADQKLNNFVRNAYGIPATVTDVD-LRNILTD----------QSGTGTYANVAA 609

Query: 212  NFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFL 271
             F F+ DGSL       T  Q           T   +   +  + Y   + ++++  + +
Sbjct: 610  AFNFKADGSLEDGLAAQTSSQ----------TTNTKIAAGARTDDYSSRMATIANVDELI 659

Query: 272  KDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS--TKI 328
             DP +   L+ +         A+ K +                   NF  D S    + +
Sbjct: 660  ADPAITNFLKSTYNLPFDISDAELKSILTDATAAAAAGHADLNADFNFAADGSLPAVSSV 719

Query: 329  QQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKS---------IDNLLSGKCQ 379
            Q   Q Q   D Y        D+ ++ +  +Y   +    S         +++ L     
Sbjct: 720  QTADQAQTTNDNYMARYDDERDEAIEEVADNYSSMMADSTSLLDTAEIKTVNDFLRTNAA 779

Query: 380  LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
             +   S ++       AL A+ L  Q++ R  +R +LTS+  DP+ Y    KD+R+  L 
Sbjct: 780  ADFKKSNDKLPDPYHVALQAFGLTDQEVPRSMMRKILTSDAYDPNGYIASLKDERITNLA 839

Query: 440  HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
             AFNF  DG            T+      Y      +  A             + + + +
Sbjct: 840  RAFNFGPDGKAAAPLQALPDATLAKYATDYKAHVTMLLKA----------GPVKDKASKD 889

Query: 500  INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
              +EVDY+   +  + S ++ LA+ R+ + +L++  +D +   +  L +IF SD  D KS
Sbjct: 890  ATTEVDYFAKGMAKVQSLDDFLADSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKS 949

Query: 560  FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
            + NT  D R+K+I+++FNFD  G L+  KIG +Q+      T DLY  Q +E ++ E + 
Sbjct: 950  YLNTKADARFKDIVAAFNFDKDGNLTRAKIGAIQNKAAEAHTQDLYVKQTLETQQGESND 1009

Query: 620  NIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIN 679
             + LALYF R  P+I + Y ILGD  L++V++    L    + +   K+  ++ + +K+ 
Sbjct: 1010 GVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVAKQADLINRFVKLE 1069

Query: 680  DFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            D +D KKV+  L    AM     D +     SP
Sbjct: 1070 DLQDPKKVDKLLRRFTAM----YDVQNNTQQSP 1098



 Score =  352 bits (904), Expect = 9e-95,   Method: Composition-based stats.
 Identities = 158/682 (23%), Positives = 282/682 (41%), Gaps = 108/682 (15%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  +  +D+F+ D +L+SYA+
Sbjct: 1   MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVKDVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPDKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DDLIGLYKQSFVDADKAAAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q    +  
Sbjct: 180 KDFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASAIET 237

Query: 240 YFNNT---------------IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+               +       +Q YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNAVGSDVVYVSKTAADYNQAYYTAKIGTITNVDDLVADARLTSYIKTAY 297

Query: 285 FP-LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
               +    A + +        ++     +   NF  D S+ST  +  +  Q        
Sbjct: 298 SMGADFTAPALRMVLTDPSYAQLMGFTNVYNAFNFKSDGSTSTTARAQTIDQA------- 350

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
             ++       +           I ++D+LL+               +  ++  DAY L 
Sbjct: 351 -NKLASAASSTANYYSVTSQSSGITNVDDLLADS-------------VMARYIKDAYGLG 396

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
           +      +L+N+LT       SYA          LN  FNFNADGSI    +        
Sbjct: 397 VN-FSNAELKNILT-----DSSYAAAQGQ---AGLNADFNFNADGSINGSVIQ------- 440

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
                                      + +K    +  +   ++   I ++ + ++++++
Sbjct: 441 -------------------------TAAQRKSTTDKSAANAAHFNAMIGSVTNVDDIMSD 475

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
              +++L  S  I              ++ L DP + +       Y ++   FNF   G 
Sbjct: 476 PVAVSYLRTSMQIADSVSDA-----TLRTFLVDPAAASAQG----YSDVHDLFNFKTDGS 526

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
           ++                  LY  Q   +         + A+Y++ TI  I N  ++L D
Sbjct: 527 VAT-----------------LYATQTAAQSANTTSKADSAAVYYQSTIAGISNVDQLLAD 569

Query: 644 SKLFKVVSKKLKLSPYFAVLPE 665
            KL   V     +      +  
Sbjct: 570 QKLNNFVRNAYGIPATVTDVDL 591


>gi|15887995|ref|NP_353676.1| hypothetical protein Atu0653 [Agrobacterium tumefaciens str. C58]
 gi|15155605|gb|AAK86461.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 812

 Score =  407 bits (1045), Expect = e-111,   Method: Composition-based stats.
 Identities = 149/720 (20%), Positives = 290/720 (40%), Gaps = 78/720 (10%)

Query: 28  VSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKS 87
           ++ E RYY+  I  ++  D+ +++ R  +Y  + F + + +++   IK ++ SD++DP S
Sbjct: 137 LAEETRYYKAIIGTVTNADQLLRNDRTRAYIFQVFNIDEKTYSYAHIKGLMTSDVNDPNS 196

Query: 88  LVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKN 147
            +NQ     Y             ++        T I           E   +        
Sbjct: 197 YINQNYGAAYNDAVEKLTMKGNIELHAQVTARITAIDTDLAGTGLTAEERTKLEAEKVTR 256

Query: 148 IHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFR 207
            +++  ++ +   +   D  L +       +S    +                   N+  
Sbjct: 257 QNQLTQLEAVLPPKDQWDAKLAAIKAEQTTLSNAVTQY------------------NKMA 298

Query: 208 AMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP--IVSDQNYYKLAINSVS 265
            +A  F F+ DG++       T  +++ I  +Y  +     P     +++Y++  I S++
Sbjct: 299 QIANAFEFKNDGTVDAGG-AQTADKLKAITDSYIGSAPRVTPTVATLNRDYFESKIGSIT 357

Query: 266 SFSDFLKDPKLFKMLQLSLFPLN---------PEITAD-----KFLTLMQENDPIVSQVK 311
           +  + + D +L   ++ +    +           +T+D      ++  M +ND     +K
Sbjct: 358 TVEELMSDARLLNYVRTAFDLNDLTIVPATIKNILTSDLSDPNNYIATMGKNDKRYLALK 417

Query: 312 YFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKS 369
                NF  D +  + T  Q  +Q       Y  +     D      +  ++  + K+ S
Sbjct: 418 --NAFNFLPDGTLAAGTTPQTTTQTATTTSGYMTHYNDADDAADAKALSLFKSSISKVTS 475

Query: 370 IDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANK 429
           +++ L                    +AL A  L+   ++   ++ VLTS+  D  SY   
Sbjct: 476 VNDFLGTNA-------------VYTYALRAVGLDPAKVNISDIQRVLTSDLQDKKSYVYT 522

Query: 430 SKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQ 489
            KDDR +KL   FNF  DGS+G   + QS + ++     Y  +K +    ++K       
Sbjct: 523 LKDDRYVKLAELFNFTKDGSVGSPILAQSEIELQTMSADYIKKKSAFGTEKDK------- 575

Query: 490 ISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
                       +E  Y++  +  I +  E LAN R+  F +ES GID + V ++ L +I
Sbjct: 576 --------EAAQTEAKYFSGEMQKIKTLSEFLANDRLTKFAMESLGIDPKSVTKEQLQKI 627

Query: 550 FKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
           F S+L D  S+ N   D  ++ ++++FNFD  G+L H+    +Q    + +T D Y  Q 
Sbjct: 628 FTSNLDDKNSYVNKEMDPVFRRLVTAFNFDTEGKLLHEDRSAIQTRRGLYETLDNYLTQT 687

Query: 610 IEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKI 669
           +E +  E++  + LALYFKR      ++Y IL D+ +   +     +           ++
Sbjct: 688 LESQAGEENAGVRLALYFKRMAAGTTSYYSILADTAIQNFIKTTFGIPDELGNANVDTQV 747

Query: 670 RILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNN 729
            ++KK+  I DF+D  KV+  +     M     D K+ +        DP    F+   + 
Sbjct: 748 AMMKKYFDIKDFQDPDKVKKLIARFTIM----YDNKQNVA-------DPIMTLFNGSGSA 796



 Score =  354 bits (909), Expect = 3e-95,   Method: Composition-based stats.
 Identities = 139/663 (20%), Positives = 271/663 (40%), Gaps = 56/663 (8%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ + ++    ++D++S + S VS+  +V  + +YY+E I ++ ++DEF+ + +L+SYA+
Sbjct: 1   MVSTFLSYDLINRDMKSSI-SRVSQQGLVERQTKYYKENIGNVKSVDEFLGNYQLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
            AFGL +M++A+ F+KK+LESDL+D  S  N+L   +Y+ FA S++F+   K +Q+D Q 
Sbjct: 60  DAFGLGEMTYAKAFMKKVLESDLNDQNSFANKLTDERYREFAASFNFTASTKTVQTDAQL 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y  S  +      EE++Y++  I  + + DQL ++ R   Y+ Q F+I  K  S
Sbjct: 120 DKMIGLYDTSITNLNGSLAEETRYYKAIIGTVTNADQLLRNDRTRAYIFQVFNIDEKTYS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
              +K ++T  + +P  Y  ++           +    +    K +  L      +I + 
Sbjct: 180 YAHIKGLMTSDVNDPNSYINQNYG-------AAYNDAVEKLTMKGNIELHAQVTARITAI 232

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
             +     +            +   +  +         + +       + ++ A K    
Sbjct: 233 DTDLAGTGLTAEERTKLEAEKVTRQNQLTQL-------EAVLPPKDQWDAKLAAIKAEQT 285

Query: 300 MQEND--PIVSQVKYFFQINFHRDNS-SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSL 356
              N         +      F  D +  +   Q   +++ + D Y  +   +        
Sbjct: 286 TLSNAVTQYNKMAQIANAFEFKNDGTVDAGGAQTADKLKAITDSYIGSAPRVTPTVATLN 345

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              ++  +G I +++ L+S                 L +   A++LN   +    ++N+L
Sbjct: 346 RDYFESKIGSITTVEELMSDAR-------------LLNYVRTAFDLNDLTIVPATIKNIL 392

Query: 417 TSNPSDPDSYANKSK--DDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKR 474
           TS+ SDP++Y       D R + L +AFNF  DG++      Q+          Y     
Sbjct: 393 TSDLSDPNNYIATMGKNDKRYLALKNAFNFLPDGTLAAGTTPQTTTQTATTTSGYMTH-- 450

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
                                 +      +  +  +I+ + S  + L    +  + L + 
Sbjct: 451 -----------------YNDADDAADAKALSLFKSSISKVTSVNDFLGTNAVYTYALRAV 493

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G+D  KV    +  +  SDL+D KS+  T KD+RY ++   FNF   G +    +   Q 
Sbjct: 494 GLDPAKVNISDIQRVLTSDLQDKKSYVYTLKDDRYVKLAELFNFTKDGSVGSPIL--AQS 551

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIAL-ALYFKRTIPNIRNHYEILGDSKLFKVVSKK 653
              +      Y  +      E+        A YF   +  I+   E L + +L K   + 
Sbjct: 552 EIELQTMSADYIKKKSAFGTEKDKEAAQTEAKYFSGEMQKIKTLSEFLANDRLTKFAMES 611

Query: 654 LKL 656
           L +
Sbjct: 612 LGI 614


>gi|241203339|ref|YP_002974435.1| hypothetical protein Rleg_0592 [Rhizobium leguminosarum bv. trifolii
            WSM1325]
 gi|240857229|gb|ACS54896.1| protein of unknown function DUF1217 [Rhizobium leguminosarum bv.
            trifolii WSM1325]
          Length = 1111

 Score =  406 bits (1043), Expect = e-111,   Method: Composition-based stats.
 Identities = 161/695 (23%), Positives = 285/695 (41%), Gaps = 66/695 (9%)

Query: 32   ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
              ++   I +++ +D+ + D    SY   +  ++D             SD +    LV++
Sbjct: 456  AAHFNSMIGNVTNVDDIMSDAVAVSYIRNSMQIADSV-----------SDATLRTFLVDR 504

Query: 92   LNSLK--YQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIH 149
              +    Y      ++F     V                        A + + Y++  I 
Sbjct: 505  TAASAQGYSDVHDLFNFKSDGSVPTLYASQSAT------QSASTTSKASDAAVYYQATIA 558

Query: 150  KINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAM 209
             I++VDQL  D++L ++V  +F I      +  L+++LT           +S    +  +
Sbjct: 559  GISNVDQLLADQKLNNFVRNAFGIPSTVTDVA-LRNILTD----------QSGTGTYADV 607

Query: 210  AENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSD 269
            A  F F+ DG+L    +  T  QI                  +  + Y   + ++++  D
Sbjct: 608  AGAFNFKADGTLEDGLQAQTATQISSTKF----------AAEARTDDYSARMATIANVDD 657

Query: 270  FLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS--T 326
             L D  +   L+ +         AD K +                   NF  D S    +
Sbjct: 658  LLADSAITNFLKSTYNLPFDISDADLKSILTDATAAAAAGHADLNADFNFAADGSLPVVS 717

Query: 327  KIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK---------IKSIDNLLSGK 377
             +Q   Q Q   D Y        D+ +  +  +YQ  +           +KS+++ L   
Sbjct: 718  SVQTADQAQTTNDNYAARYDDERDEALDEVASNYQKLMADSSSLLNFSDVKSVNDFLRSN 777

Query: 378  CQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIK 437
               +   S +        AL A+ L  QD+ R  +R VLTS+  DPD Y    KD+R+  
Sbjct: 778  SAADFSKSNDNLPDLYHVALQAFGLTDQDVPRSMMRKVLTSDAYDPDGYIASLKDERITN 837

Query: 438  LNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRIN 497
            L  AFNF  DG            T+      Y +    +          M+    + +  
Sbjct: 838  LARAFNFGPDGKAASPFQALPDATLAKYATDYKSHITML----------MKDGPVKDKAA 887

Query: 498  LEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDP 557
             +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  D 
Sbjct: 888  KDATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDK 947

Query: 558  KSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEK 617
            KS+ NT  D R+++I+++FNFD  G L+  KIG +Q+    + T +LY  Q +E ++ E 
Sbjct: 948  KSYLNTKADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEEHTQELYVQQTMEAQQGES 1007

Query: 618  DPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK 677
            +  + LALYF R  P+I + Y ILGD  L++V++    L    + +   K+  +L + +K
Sbjct: 1008 NDGVRLALYFARKAPSITSIYSILGDKALYQVITTAYNLPSQISGMDVTKQRDLLSRFVK 1067

Query: 678  INDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            + D +D KKV+  L    AM     D + A   SP
Sbjct: 1068 LEDLQDPKKVDKLLRRFTAM----YDVQNAAQQSP 1098



 Score =  345 bits (884), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 149/677 (22%), Positives = 272/677 (40%), Gaps = 108/677 (15%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    S+D+ S L + V+    V  + +YY + I  ++++D+F+ D +L+SYA+
Sbjct: 1   MITASLAYTILSRDMTSSL-NKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNEPAKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+   I  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DDLIGLYKQSFIDADKAASAESSYYGTAIDGVTTVDDLVNNTRLRTYVLKTFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++  
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFGFNADGTVN--GTAQTAAQKASVIET 237

Query: 240 YFNNT---------------IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+               +       ++ YY   I ++++  D + D +L   +  + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVYYVGKTAADYNKAYYTAKIGTITNVDDLVADKRLTSYITTAY 297

Query: 285 FP-LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
               +    A + +        ++     +   NF  D S+S+  +  +  Q        
Sbjct: 298 SMGADFTAAALRTVLTDPGYAQLMGFTNVYNAFNFKADGSTSSTARVQTVDQA------- 350

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
              +                   I ++D LL+               +  ++  DAY L 
Sbjct: 351 -NSLQAAASGTKNYYTVTSQSSGITNVDALLADN-------------VLARYIKDAYGLG 396

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
                   L+++LT       +YA          LN  FNF ADGSI    +        
Sbjct: 397 -TSFSNADLKSILT-----DSTYAAAQG---HADLNADFNFQADGSINGSVIQ------- 440

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
                                      + +K    +  +   ++   I  + + ++++++
Sbjct: 441 -------------------------TAAQRKSTTDKSAANAAHFNSMIGNVTNVDDIMSD 475

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
              ++++  S  I              ++ L D  + +       Y ++   FNF   G 
Sbjct: 476 AVAVSYIRNSMQIADSVSDA-----TLRTFLVDRTAASAQG----YSDVHDLFNFKSDGS 526

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
           +                   LY  Q   +           A+Y++ TI  I N  ++L D
Sbjct: 527 VPT-----------------LYASQSATQSASTTSKASDAAVYYQATIAGISNVDQLLAD 569

Query: 644 SKLFKVVSKKLKLSPYF 660
            KL   V     +    
Sbjct: 570 QKLNNFVRNAFGIPSTV 586


>gi|116250732|ref|YP_766570.1| hypothetical protein RL0958 [Rhizobium leguminosarum bv. viciae 3841]
 gi|115255380|emb|CAK06455.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
            3841]
          Length = 1109

 Score =  404 bits (1039), Expect = e-110,   Method: Composition-based stats.
 Identities = 156/695 (22%), Positives = 282/695 (40%), Gaps = 66/695 (9%)

Query: 32   ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
              ++   I +++ +D+ + D    SY   +  ++D             SD +    LV++
Sbjct: 456  AAHFNSMIGNVTNVDDIMSDAVAVSYIRNSMQIADSV-----------SDATLRTFLVDR 504

Query: 92   LNSLK--YQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIH 149
              +    Y      ++F     +                        A   + Y++  I 
Sbjct: 505  TAASAQGYSDVHDLFNFKSDGSIATLYASQTAT------QSASTTSKADNAAVYYQSTIA 558

Query: 150  KINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAM 209
             I++VDQL  D++L ++V  ++ I P  +S   L+ +LT           +S    +  +
Sbjct: 559  GISNVDQLLADQKLNNFVRNAYGI-PSTVSDVDLRAILTD----------QSGTGTYADV 607

Query: 210  AENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSD 269
            A  F F+ DG+L       T  QI                  +  + Y   ++++S+  D
Sbjct: 608  AAAFNFKADGTLEDGMAAQTATQISSTKF----------AATARTDDYSARMSTISNVDD 657

Query: 270  FLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS--T 326
             L D  +   L+ +         AD K +                   NF  D S    +
Sbjct: 658  LLADSAITNFLKSTYNLPFNISDADLKSILTDATAAAAAGHADLNADFNFAADGSLPVVS 717

Query: 327  KIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK---------IKSIDNLLSGK 377
             +Q   Q Q   D Y        D+ +  +  +YQ  +           + S+++ L   
Sbjct: 718  SVQTADQAQTTNDNYAARYDDERDEAIDEVASNYQKLMADSSSLLNFSDVNSVNDFLRSN 777

Query: 378  CQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIK 437
               +   S +        AL A+ L  Q++ R  +R +LTS+  DPD Y    KD+R+  
Sbjct: 778  SAADFSKSNDNLPDLFHVALQAFGLTDQEVSRSMMRKILTSDAYDPDGYVASLKDERITN 837

Query: 438  LNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRIN 497
            L  AFNF  DG            T+      Y +    +          M+    + +  
Sbjct: 838  LARAFNFGPDGKAASPFQALPDATMAKYATDYRSHITML----------MKDGPVKDKAA 887

Query: 498  LEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDP 557
             +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  D 
Sbjct: 888  KDATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDK 947

Query: 558  KSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEK 617
            KS+ N   D R+++I+++FNFD  G L+  KIG +Q+    + T +LY  Q +E ++ E 
Sbjct: 948  KSYLNATADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEEHTQELYVQQTMEAQQGES 1007

Query: 618  DPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK 677
            +  + LALYF R   +I + Y ILGD  L++V++    L    + +   K+  ++ + +K
Sbjct: 1008 NDGVRLALYFSRKASSITSIYGILGDKALYQVITTAYSLPSQISGMDVAKQADLINRFVK 1067

Query: 678  INDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            + D +D KKV+  L    AM     D + A   SP
Sbjct: 1068 LEDLQDPKKVDKLLRRFTAM----YDVQNATQQSP 1098



 Score =  352 bits (903), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 152/682 (22%), Positives = 276/682 (40%), Gaps = 108/682 (15%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    S+D+ S L + V+    V  + +YY + I  +  +D+F+ D +L+SYA+
Sbjct: 1   MISASLAYTILSRDMTSSL-NKVASQATVKKDAQYYADHINKVENVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F+I P Y S
Sbjct: 120 DDLIGLYKQSFVDADKAASAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFNIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++ +
Sbjct: 180 KDFLRQVLTSDLSDPTSVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASVIES 237

Query: 240 YFNNT---------------IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+               +       ++ YY   I ++++  D + D +L   +  + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVYYVGQTAADYNKAYYTAKIGTITNVDDLVADKRLTSYITTAY 297

Query: 285 FP-LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
               +    A + +        ++     +   NF  D S+S+  +  +  Q        
Sbjct: 298 SMGADFTAAALRTVLTDPGYAQLMGFTNVYNAFNFKADGSASSTARVQTVDQA------- 350

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
              + +   M             I ++D+LL+               +  ++  DAY L 
Sbjct: 351 -NSLKNAATMTGNYYTTTSQSTGITNVDDLLADN-------------VLARYIKDAYGLG 396

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
                   L+N+LT       +YA          LN  FNF ADGSI    +        
Sbjct: 397 TD-FSNADLKNILT-----DSAYAAAQG---HADLNADFNFQADGSINGSVIQ------- 440

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
                                      + +K    +      ++   I  + + ++++++
Sbjct: 441 -------------------------TAAQRKSTTDKSAVNAAHFNSMIGNVTNVDDIMSD 475

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
              ++++  S  I              ++ L D  + +       Y ++   FNF   G 
Sbjct: 476 AVAVSYIRNSMQIADSVSDA-----TLRTFLVDRTAASAQG----YSDVHDLFNFKSDGS 526

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
                               LY  Q   +           A+Y++ TI  I N  ++L D
Sbjct: 527 -----------------IATLYASQTATQSASTTSKADNAAVYYQSTIAGISNVDQLLAD 569

Query: 644 SKLFKVVSKKLKLSPYFAVLPE 665
            KL   V     +    + +  
Sbjct: 570 QKLNNFVRNAYGIPSTVSDVDL 591



 Score =  100 bits (248), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 40/190 (21%), Positives = 75/190 (39%), Gaps = 18/190 (9%)

Query: 31   EERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVN 90
            E  Y+ + +  + ++D+F+ D RL    LKA  L    + +  +KKI  SD  D KS +N
Sbjct: 893  EVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLN 952

Query: 91   QLNSLKYQYFARSYDFSPPPK-------VIQSDIQHKTIIQDYKQSHQHKEEVALEE--- 140
                 ++Q    +++F             IQ+    +   + Y Q     ++    +   
Sbjct: 953  ATADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEEHTQELYVQQTMEAQQGESNDGVR 1012

Query: 141  -SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD-------VLTLGLA 192
             + YF +    I S+  +  D+ L   +  ++S+  +   +   K        V    L 
Sbjct: 1013 LALYFSRKASSITSIYGILGDKALYQVITTAYSLPSQISGMDVAKQADLINRFVKLEDLQ 1072

Query: 193  NPKKYFIESR 202
            +PKK     R
Sbjct: 1073 DPKKVDKLLR 1082


>gi|325292035|ref|YP_004277899.1| hypothetical protein AGROH133_04160 [Agrobacterium sp. H13-3]
 gi|325059888|gb|ADY63579.1| hypothetical protein AGROH133_04160 [Agrobacterium sp. H13-3]
          Length = 812

 Score =  387 bits (993), Expect = e-105,   Method: Composition-based stats.
 Identities = 144/733 (19%), Positives = 276/733 (37%), Gaps = 100/733 (13%)

Query: 25  DPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSD 84
           D  +S E RYY+  I  ++ +D+ +++ R  +Y  + F + + +++   IK ++ SD+ D
Sbjct: 134 DDSLSEETRYYKAIIGTVTNVDQLLQNDRTRAYIFEVFSIDEKTYSYSHIKGLMTSDIDD 193

Query: 85  PKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYF 144
           P S +NQ              F          +  K  I+ +                  
Sbjct: 194 PNSYLNQ-------------KFGAAYSAAVEKLTTKGNIELH------------------ 222

Query: 145 RKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK------------DVLTLGLA 192
                +I ++D    D  L      +             +              L    A
Sbjct: 223 GDVTDRITAIDTALADTTLTAEQRTALETEKTTRQDQLTQLEAVLPPKDQWAATLASITA 282

Query: 193 NPKKYFIESRD-NRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP-- 249
              +        N    MA+ F F  DG+++   +  T   ++ +   Y  +     P  
Sbjct: 283 EQTQLSNTVSQYNTMAQMAQAFEFANDGTVAAG-QAQTADNVKILTQAYVGSAPRVTPTV 341

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT------------ADKFL 297
              +++Y++  I S+ +  + + DP+L   ++++    +  I             +D   
Sbjct: 342 ATLNRDYFESKIGSIKTVDELMADPRLVNYIKVAFDLNDLTIVNATIENILTSDLSDPNN 401

Query: 298 TLMQENDPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS 355
            + +  +     +      NF  D +    T  Q  +Q     + Y  +     +   ++
Sbjct: 402 YIAKFGNGDKRYIALREAFNFKADGTLPDGTAPQTTTQTVTTTNGYMNHYNDKDEAADEN 461

Query: 356 LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNV 415
            +K ++  +  +KS+ + L                    +AL A  L+   ++   +R  
Sbjct: 462 ALKLFKSDIANVKSVADFLESSA-------------VYTYALKAVGLDPTKVNIADVRRA 508

Query: 416 LTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRS 475
           LTS+  D  SY    KDDR +KL   FNF +DGS G   + QS L I+     Y  +K +
Sbjct: 509 LTSDLLDKKSYVYALKDDRYVKLAELFNFKSDGSPGSPVLAQSELEIQSMSVDYIKKKSA 568

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
               + K     E                 ++   +  + +  + L N R+  F +ES G
Sbjct: 569 FGTDQEKEAAKKEAE---------------FFRSELQKVKTLSDFLGNDRLTKFAMESLG 613

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           ID  KV +D L ++F S+L D  S+ N   D  ++ ++++FNFD  G +  +    +Q  
Sbjct: 614 IDPTKVTKDQLQKMFTSNLDDKDSYLNKEMDPAFRRLVTAFNFDTDGNILREDRSSIQTR 673

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
             + +T D Y  Q +E +  E++  + LALYFKR      ++Y IL D+ +   ++    
Sbjct: 674 RGLYETLDNYLTQTLETQAGEENAGVRLALYFKRMAAGTTSYYSILADTAIQNFITTTFG 733

Query: 656 LSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQN 715
           +           ++ ++KK+  I DF+D  KV+  +     M     +            
Sbjct: 734 IPDELGNAGVDTQVAMMKKYFDIEDFQDPDKVKKLIARFTIMYDDKQNTTN--------- 784

Query: 716 KDPWNNSFDDPQN 728
             P    F+   +
Sbjct: 785 --PIMMLFNGSGS 795



 Score =  342 bits (876), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 148/745 (19%), Positives = 303/745 (40%), Gaps = 62/745 (8%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ + ++    ++D+++ + S VS+  IV  + +YY+E I ++ ++DEF+ + +L+SYA+
Sbjct: 1   MVSTFLSYDLINRDMKASI-SRVSQQGIVERQTKYYKENIGNVKSVDEFLNNYQLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
            AFGL +M++A+ F+KK+LESDL+D  S  N+L   +Y+ FA S++F+     +Q++ Q 
Sbjct: 60  DAFGLGEMTYAKAFMKKVLESDLNDQNSFANKLTDERYREFAASFNFTQSTTTVQTEAQL 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  Y  S  + ++   EE++Y++  I  + +VDQL ++ R   Y+ + FSI  K  S
Sbjct: 120 DKMIGLYDTSITNLDDSLSEETRYYKAIIGTVTNVDQLLQNDRTRAYIFEVFSIDEKTYS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRA----MAENFRFQPDGSLSKRDKILTDMQIEK 235
              +K ++T  + +P  Y  +     + A    +      +  G ++ R   + D  +  
Sbjct: 180 YSHIKGLMTSDIDDPNSYLNQKFGAAYSAAVEKLTTKGNIELHGDVTDRITAI-DTALAD 238

Query: 236 IVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADK 295
                   T       + Q+        +     +          Q  L           
Sbjct: 239 TTLTAEQRTALETEKTTRQDQLTQLEAVLPPKDQWAATLASITAEQTQLS---------- 288

Query: 296 FLTLMQENDPIVSQVKYFFQINFHRDNS-SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQ 354
                       +  +      F  D + ++ + Q    ++ +   Y  +   +      
Sbjct: 289 -----NTVSQYNTMAQMAQAFEFANDGTVAAGQAQTADNVKILTQAYVGSAPRVTPTVAT 343

Query: 355 SLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRN 414
                ++  +G IK++D L++                 + +   A++LN   +    + N
Sbjct: 344 LNRDYFESKIGSIKTVDELMADPR-------------LVNYIKVAFDLNDLTIVNATIEN 390

Query: 415 VLTSNPSDPDSYANKS--KDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANR 472
           +LTS+ SDP++Y  K    D R I L  AFNF ADG++      Q+          Y N 
Sbjct: 391 ILTSDLSDPNNYIAKFGNGDKRYIALREAFNFKADGTLPDGTAPQTTTQTVTTTNGYMNH 450

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                +A +                    + +  +  +I  + S  + L +  +  + L+
Sbjct: 451 YNDKDEAAD-------------------ENALKLFKSDIANVKSVADFLESSAVYTYALK 491

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G+D  KV    +     SDL D KS+    KD+RY ++   FNF   G      + + 
Sbjct: 492 AVGLDPTKVNIADVRRALTSDLLDKKSYVYALKDDRYVKLAELFNFKSDGSPGSPVLAQS 551

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           +          + K       + EK+     A +F+  +  ++   + LG+ +L K   +
Sbjct: 552 ELEIQSMSVDYIKKKSAFGTDQ-EKEAAKKEAEFFRSELQKVKTLSDFLGNDRLTKFAME 610

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            L + P    + + +  ++   ++   D   +K+++        +   + D    +    
Sbjct: 611 SLGIDPT--KVTKDQLQKMFTSNLDDKDSYLNKEMDPAFRR--LVTAFNFDTDGNILRED 666

Query: 713 NQNKDPWNNSFDDPQNNVSLQLSPQ 737
             +       ++   N ++  L  Q
Sbjct: 667 RSSIQTRRGLYETLDNYLTQTLETQ 691


>gi|163740770|ref|ZP_02148163.1| hypothetical protein RG210_13056 [Phaeobacter gallaeciensis 2.10]
 gi|161385761|gb|EDQ10137.1| hypothetical protein RG210_13056 [Phaeobacter gallaeciensis 2.10]
          Length = 591

 Score =  352 bits (904), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 133/706 (18%), Positives = 236/706 (33%), Gaps = 164/706 (23%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
             K PI+    + + ++I+ I + D+ + D  +   AL AFGL +  +   FIKK+L+SD
Sbjct: 29  FEKSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKVLDSD 88

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
           LS+P S  N+LN  +Y   A+++ F                                 E 
Sbjct: 89  LSEPTSFANRLNDNRYLGLAQTFGFGNDAGPQLPSSSV--------------------EK 128

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
            Y       + S + L  ++ LL+  L  F +     +  FL  VL     +P  +    
Sbjct: 129 PY-----ANVASPEDLLSNQTLLNQALDDFGLEKYAGNEFFLMRVLESDTTDPASFVNRL 183

Query: 202 RDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAI 261
            D++    A  F+F      +          +E +V  +        P            
Sbjct: 184 SDSKLADFANAFQFNQPPEYTSS--------MEALVGEFNAMNDGNGPA----------- 224

Query: 262 NSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRD 321
               +  + L++  L K +  S      E T   FL  M E++P               D
Sbjct: 225 ----NADELLENEGLLKAVVDSFDL---EYTNTIFLKRMLESNPY--------------D 263

Query: 322 NSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLE 381
             S    Q+D +   M   +                      +    S + LL+    LE
Sbjct: 264 PDSPVNQQEDPRYLAMSRAF----------------GFGISDINSFTSPEELLAQPQLLE 307

Query: 382 GPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHA 441
                         AL+ +NL+  +     +R+VL S+ SDP+S+ N+  +        A
Sbjct: 308 D-------------ALEQFNLS--NPGEQYIRDVLESDLSDPNSFVNQPSNLAFYDFAEA 352

Query: 442 FNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEIN 501
           F                                              +  +       + 
Sbjct: 353 F--------------------------------------------QNEWPSAPSRMQVLA 368

Query: 502 SEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFA 561
            EV      +      ++ + +       L+   I  +++  D + + F+SDL    S+A
Sbjct: 369 DEVG---GKLAGYEQPQQFVFDFDAFEAGLDVFNISERELDFDVMIKAFESDLSSEISYA 425

Query: 562 NTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNI 621
           N ++D   K +  +F F+  G       G  Q      +  DLYK +  E    E DPN+
Sbjct: 426 NLHRDPNLKAMAHAFAFNPGGSDHTYPAGFAQ------EIADLYKDRNFEIAIGESDPNM 479

Query: 622 ALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILK 673
            LAL  +R + +I +         + I+G   L  +    L L   F  L   +++  +K
Sbjct: 480 RLALSLERELQSIADAGGSEDAHWFGIIGSPPLKSMFETALGLPASFGQLDVDRQVNEMK 539

Query: 674 KHIKI-------NDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
           +  +         D  + + ++ F      +   + D     FS P
Sbjct: 540 ERAQTSFGTTHPADLLEPETLDAFRNRFLLLSGLNSDQAANGFSDP 585



 Score = 97.2 bits (240), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 67/181 (37%), Gaps = 13/181 (7%)

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
           N    +  Q       +  ++  V  +T  I  I S ++LL +  +L   L + G+D   
Sbjct: 16  NFLDRTRVQQQQIFEKSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDI 75

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
               F+ ++  SDL +P SFAN   DNRY  +  +F F              +   ++  
Sbjct: 76  NNRAFIKKVLDSDLSEPTSFANRLNDNRYLGLAQTFGFGNDAGPQLPSSSVEKPYANVAS 135

Query: 601 TCDLYKHQM----------IEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVV 650
             DL  +Q           +EK    +   + +    +    +  +    L DSKL    
Sbjct: 136 PEDLLSNQTLLNQALDDFGLEKYAGNEFFLMRV---LESDTTDPASFVNRLSDSKLADFA 192

Query: 651 S 651
           +
Sbjct: 193 N 193


>gi|163761036|ref|ZP_02168114.1| hypothetical protein HPDFL43_03334 [Hoeflea phototrophica DFL-43]
 gi|162281817|gb|EDQ32110.1| hypothetical protein HPDFL43_03334 [Hoeflea phototrophica DFL-43]
          Length = 961

 Score =  352 bits (903), Expect = 1e-94,   Method: Composition-based stats.
 Identities = 123/585 (21%), Positives = 233/585 (39%), Gaps = 53/585 (9%)

Query: 153 SVDQLFKDRRLLDYVLQSF-SITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAE 211
           +   +       D  + ++  +         L   L   +A  + Y      +++ A+A 
Sbjct: 376 TTSDIDDAVAAKDVAIAAYTDLPELGDDTNQLAAQLNTDVAAARNYINA--TDKYLALAY 433

Query: 212 NFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI--DCVPIVSDQNYYKLAINSVSSFSD 269
            + F  DG++       T+ ++E     Y  +         + + +Y++  I S ++  +
Sbjct: 434 AYNFNDDGTVPAGG-FQTEAELEATTELYVTSQDRLTLTGAMLNDDYFRETIGSFTTAEE 492

Query: 270 FLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVS--------------------- 308
            ++D ++   L+ +             L     +    +                     
Sbjct: 493 MMEDERIVSYLKSAFNLDTYLTVVTSTLENAITSPATDADLEDETNYLVAFHKGKPYFDD 552

Query: 309 QVKYFFQINFHRDNSSSTKIQ--QDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
            V      NF  D +    +Q         +   Y        +   Q  I+  Q+    
Sbjct: 553 LVALSRAFNFEEDGTLPDGLQPVDAENQSVLSSRYFSGYDDADEAADQEAIRRMQI---- 608

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
                +L+    +               FA+ A  L+  ++ +  +R VLTS+  DP+SY
Sbjct: 609 -----DLVGLNTEGATVEDLFNSSAVYSFAMQAAELDPNEIPQRIMRKVLTSDLQDPNSY 663

Query: 427 ANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNS 486
               KD+R +K  + FNF+++G        Q +  + D  + Y  +K      E      
Sbjct: 664 VYTLKDERYVKFANLFNFDSEGVATAPLTAQDQARMDDISRDYIVQKTRFLTGEE----- 718

Query: 487 MEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL 546
                       +  +E  YY   ++ I + ++LL N+R+++F L +KGID + V  D L
Sbjct: 719 ------AATARSDAEAEASYYQRTVSNIETLDQLLGNRRLIDFALTAKGIDPETVSNDEL 772

Query: 547 CEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYK 606
             +F+SDL DP S+ANT  D R  E+++SFNFD  G+L  +   ++     + +T +LY 
Sbjct: 773 QLLFRSDLDDPDSYANTVSDFRLTEVVTSFNFDEAGKLMQRDAAEISSRGDLYETMNLYL 832

Query: 607 HQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER 666
            Q IE +  E+D  + LALYF+R  P I + Y+ILGD+ L++V      L    + +   
Sbjct: 833 RQTIELERGEEDNGVRLALYFERMAPTITSVYDILGDTALYEVFKTIFSLPDEISGMSVD 892

Query: 667 KKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSS 711
            +  +L+  + + D  D +K++  +     M     D + +  S 
Sbjct: 893 SQAALLEDRMDMADLADPEKLKKLVERFTIM----YDLENSSSSP 933



 Score =  257 bits (656), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 123/640 (19%), Positives = 248/640 (38%), Gaps = 54/640 (8%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +++     ++D+++++ + VS+   VS E  Y++E I  + + +EF+ D RL+SYA+
Sbjct: 1   MTTTYLNYNLVAQDLKAEM-NRVSQQTQVSRETAYFKENIGKVRSAEEFVGDYRLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA GL DM +AE F+ K+LESDLSD  S  N+L   +Y+ FA ++ F    KV  S  Q 
Sbjct: 60  KAHGLEDMIYAEAFMLKVLESDLSDSDSYANRLTDSRYRDFAAAFQFEDGSKVPMSVNQI 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
              I  Y ++    ++    E  Y+      + +VDQ   D RL D++ QS+ I    + 
Sbjct: 120 DEAIGLYDETVASLDDKISGEVNYYNAMAGLVENVDQFLADPRLFDFITQSYGIDGSTVD 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ +L     +P  Y   +      +            L+      +++  +  +  
Sbjct: 180 RTFLRGILASDPDDPNSYLNTNLIANRTSSETTLS-TAQPILNDIAARQSEVDDKATMVA 238

Query: 240 YFNNTIDCVPIVSDQNYYK----LAINSVSSFSDFLKDPKLFKMLQ-LSLFPLNPEITAD 294
           Y    +     + +    +      + S+ +  D L D         + L  ++      
Sbjct: 239 YGEGIVSIQAAIDEALVRQSEPGADVASIQTEIDVLTDGLHTTYRNFIELAMIDFREEES 298

Query: 295 KFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQ 354
             +    EN P ++ ++    + +  D  +   I         L+  K   +      +Q
Sbjct: 299 ALIADGLENSPEMTALRNKIDV-WTADTDARWTISTSLNEIVELEASKTQ-EGADLAAIQ 356

Query: 355 SLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAY-NLNMQDLDRDQLR 413
           S I   ++ +          +        +  ++ +     A+ AY +L     D +QL 
Sbjct: 357 SQIDALRVTITG--------AEANLTLTTSDIDDAVAAKDVAIAAYTDLPELGDDTNQLA 408

Query: 414 NVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRK 473
             L ++ +   +Y N +  D+ + L +A+NFN DG++      Q+   +    + Y   +
Sbjct: 409 AQLNTDVAAARNYINAT--DKYLALAYAYNFNDDGTVPAGGF-QTEAELEATTELYVTSQ 465

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
             +        +                   DY+   I +  + EE++ ++RI+++L  +
Sbjct: 466 DRLTLTGAMLND-------------------DYFRETIGSFTTAEEMMEDERIVSYLKSA 506

Query: 534 KGID------SQKVREDFLCEIFKSDLKDPKSFANTYKDNR-----YKEIISSFNFDIHG 582
             +D      +  +          +DL+D  ++   +   +        +  +FNF+  G
Sbjct: 507 FNLDTYLTVVTSTLENAITSPATDADLEDETNYLVAFHKGKPYFDDLVALSRAFNFEEDG 566

Query: 583 ELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIA 622
            L      +  D  +       Y     +  E      I 
Sbjct: 567 TL--PDGLQPVDAENQSVLSSRYFSGYDDADEAADQEAIR 604



 Score =  147 bits (370), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 61/283 (21%), Positives = 115/283 (40%), Gaps = 21/283 (7%)

Query: 44  TIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARS 103
           T+++      ++S+A++A  L      ++ ++K+L SDL DP S V  L   +Y  FA  
Sbjct: 619 TVEDLFNSSAVYSFAMQAAELDPNEIPQRIMRKVLTSDLQDPNSYVYTLKDERYVKFANL 678

Query: 104 YDFSPPP-----KVIQSDIQHKTIIQDY---------KQSHQHKEEVALEESKYFRKNIH 149
           ++F            Q   +   I +DY          +        A  E+ Y+++ + 
Sbjct: 679 FNFDSEGVATAPLTAQDQARMDDISRDYIVQKTRFLTGEEAATARSDAEAEASYYQRTVS 738

Query: 150 KINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAM 209
            I ++DQL  +RRL+D+ L +  I P+ +S   L+ +    L +P  Y     D R   +
Sbjct: 739 NIETLDQLLGNRRLIDFALTAKGIDPETVSNDELQLLFRSDLDDPDSYANTVSDFRLTEV 798

Query: 210 AENFRFQPDGSLSKRDKIL--TDMQIEKIVSNYFNNTIDCVPIVSD-----QNYYKLAIN 262
             +F F   G L +RD     +   + + ++ Y   TI+      D       Y++    
Sbjct: 799 VTSFNFDEAGKLMQRDAAEISSRGDLYETMNLYLRQTIELERGEEDNGVRLALYFERMAP 858

Query: 263 SVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDP 305
           +++S  D L D  L+++ +      +               D 
Sbjct: 859 TITSVYDILGDTALYEVFKTIFSLPDEISGMSVDSQAALLEDR 901



 Score = 99.1 bits (245), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 82/222 (36%), Gaps = 13/222 (5%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
              +       E  YY+  + +I T+D+ + ++RL  +AL A G+   + +   ++ +  
Sbjct: 718 EAATARSDAEAEASYYQRTVSNIETLDQLLGNRRLIDFALTAKGIDPETVSNDELQLLFR 777

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH--------KTIIQDYKQSHQ 131
           SDL DP S  N ++  +      S++F    K++Q D           +T+    +Q+ +
Sbjct: 778 SDLDDPDSYANTVSDFRLTEVVTSFNFDEAGKLMQRDAAEISSRGDLYETMNLYLRQTIE 837

Query: 132 HKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
            +        +   YF +    I SV  +  D  L +     FS+  +   +        
Sbjct: 838 LERGEEDNGVRLALYFERMAPTITSVYDILGDTALYEVFKTIFSLPDEISGMSVDSQA-- 895

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
             L +       +   + + + E F    D   S       +
Sbjct: 896 ALLEDRMDMADLADPEKLKKLVERFTIMYDLENSSSSPTAAE 937


>gi|163737657|ref|ZP_02145074.1| hypothetical protein RGBS107_19038 [Phaeobacter gallaeciensis
           BS107]
 gi|161389183|gb|EDQ13535.1| hypothetical protein RGBS107_19038 [Phaeobacter gallaeciensis
           BS107]
          Length = 591

 Score =  350 bits (898), Expect = 5e-94,   Method: Composition-based stats.
 Identities = 133/706 (18%), Positives = 236/706 (33%), Gaps = 164/706 (23%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
             K PI+    + + ++I+ I + D+ + D  +   AL AFGL +  +   FIKK+L+SD
Sbjct: 29  FEKSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDINNRAFIKKVLDSD 88

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
           LS+P S  N+LN  +Y   A+++ F                                 E 
Sbjct: 89  LSEPTSFANRLNDNRYLGLAQTFGFGNDAGPQLPSSSV--------------------EK 128

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
            Y       + S + L  ++ LL+  L  F +     +  FL  VL     +P  +    
Sbjct: 129 PY-----ANVASPEDLLSNQTLLNQALDDFGLKKYAGNEFFLMRVLESDTTDPASFVNRL 183

Query: 202 RDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAI 261
            D++    A  F+F      +          +E +V  +        P            
Sbjct: 184 SDSKLADFANAFQFNQPPEYTSS--------MEALVGEFNAMNDGNGPA----------- 224

Query: 262 NSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRD 321
               +  + L++  L K +  S      E T   FL  M E++P               D
Sbjct: 225 ----NADELLENEDLLKAVVDSFDL---EYTNTIFLKRMLESNPY--------------D 263

Query: 322 NSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLE 381
             S    Q+D +   M   +                      +    S + LL+    LE
Sbjct: 264 PDSPVNQQEDPRYLAMSRAF----------------GFGISDINSFTSPEELLAQPQLLE 307

Query: 382 GPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHA 441
                         AL+ +NL+  +     +R+VL S+ SDP+S+ N+  +        A
Sbjct: 308 D-------------ALEQFNLS--NPGEQYIRDVLESDLSDPNSFVNQPSNLAFYDFAEA 352

Query: 442 FNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEIN 501
           F                                              +  +       + 
Sbjct: 353 F--------------------------------------------QNEWPSAPSRMQVLA 368

Query: 502 SEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFA 561
            EV      +      ++ + +       L+   I  +++  D + + F+SDL    S+A
Sbjct: 369 DEVG---GKLAGYEQPQQFVFDFDAFEAGLDVFNISERELDFDVMIKAFESDLSSEISYA 425

Query: 562 NTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNI 621
           N ++D   K +  +F F+  G       G  Q      +  DLYK +  E    E DPN+
Sbjct: 426 NLHRDPNLKAMAHAFAFNPGGSDHTYPAGFAQ------EIADLYKDRNFEIAIGESDPNM 479

Query: 622 ALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILK 673
            LAL  +R + +I +         + I+G   L  +    L L   F  L   +++  +K
Sbjct: 480 RLALSLERELQSIADAGGSEDAHWFGIIGSPPLKSMFETALGLPASFGQLDVDRQVNEMK 539

Query: 674 KHIKI-------NDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
           +  +         D  + + ++ F      +   + D     FS P
Sbjct: 540 ERAQTSFGTTHPADLLEPETLDAFRNRFLLLSGLNSDQAANGFSDP 585



 Score = 96.4 bits (238), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 54/134 (40%)

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
           N    +  Q       +  ++  V  +T  I  I S ++LL +  +L   L + G+D   
Sbjct: 16  NFLDRTRVQQQQIFEKSPILDRAVQDFTQKIEGIQSSDQLLDDYNVLKVALGAFGLDEDI 75

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
               F+ ++  SDL +P SFAN   DNRY  +  +F F              +   ++  
Sbjct: 76  NNRAFIKKVLDSDLSEPTSFANRLNDNRYLGLAQTFGFGNDAGPQLPSSSVEKPYANVAS 135

Query: 601 TCDLYKHQMIEKKE 614
             DL  +Q +  + 
Sbjct: 136 PEDLLSNQTLLNQA 149


>gi|319781688|ref|YP_004141164.1| hypothetical protein Mesci_1961 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167576|gb|ADV11114.1| protein of unknown function DUF1217 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 603

 Score =  349 bits (894), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 136/600 (22%), Positives = 229/600 (38%), Gaps = 62/600 (10%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            ++ V   ++KY+  NI K+ S+D   K+ RL  Y ++++ +     +  F+   L  G+
Sbjct: 23  EQQPVVDRDTKYYLDNITKVKSIDDFVKNDRLFKYAMKAYGLEDMAYAKAFMVKALKEGV 82

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR--DKILTDMQIEKIVSNYFNNTIDCVP 249
           ++P  +  +  D R+      F F  +G+ +               +      +      
Sbjct: 83  SDPNSFANKLTDKRYAEFVRAFNFAANGTSTTVYNKAQQLVTSNYALQVQIGASQKGLPY 142

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND----- 304
             S+  YY   I  V S  D + D +L      +         A   +  M E       
Sbjct: 143 YQSETAYYVTNIAKVKSVDDLMGDSRLLTYAMAAFGLDAATEPA-ATVKAMLEGGVSDPD 201

Query: 305 ------PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK----NCQILHDDKMQ 354
                 P  S  K+    +F +    +T   +D   Q +   Y               ++
Sbjct: 202 SPANKLPDKSYAKFVAAFDFAQYGDQTTM--RDDVQQAVPKGYMAGAGLTLVEPSAQYIK 259

Query: 355 SLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRN 414
                Y   + K+ SIDNL++ K               L FA+ +Y L+       Q+R 
Sbjct: 260 GEADYYAANISKVTSIDNLMADKR-------------LLTFAMASYGLDASTETPQQIRT 306

Query: 415 VLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKR 474
           +L    SDP+S ANK  D R      AFNF   G              +D  K Y     
Sbjct: 307 MLEGGVSDPESPANKLTDKRYANFVTAFNFAQYGDQTTSR----DEVQKDTPKIYTTESA 362

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
               A N                  I SE  YY  N+  + S ++L+AN R+ N++L + 
Sbjct: 363 LGLIAPN---------------ADYIKSETAYYLANVTNVKSVDDLMANSRLYNYVLSAY 407

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G+D     +D +  +    ++D  S AN   +  Y  + ++FNF+ +GE +       Q 
Sbjct: 408 GLDPATESKDLIRNVLAGGIRDADSVANKMTNKAYAGLAAAFNFEQYGEAATTINPAQQP 467

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKL 654
                 T D Y  Q +E+   + +  + LALYF R  P I + Y++L D+ L  VV   L
Sbjct: 468 ------TVDKYMRQTLEEDAGQTNQGVRLALYFDRKAPTITSWYDVLADTALASVVRTVL 521

Query: 655 KLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQ 714
            L   FA     K+ ++ ++ + I+DF D +K+  FL    +M     +      S+   
Sbjct: 522 GLPDSFATADVDKQAQLFEQKLDISDFSDPEKLGKFLTRFTSM----YEINNPTSSAVTS 577



 Score =  297 bits (761), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 122/604 (20%), Positives = 224/604 (37%), Gaps = 68/604 (11%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +  +    ++DI SK    + + P+V  + +YY + I  + +ID+F+K+ RLF YA+
Sbjct: 1   MLNTFTSYQLITRDI-SKSIDRIEQQPVVDRDTKYYLDNITKVKSIDDFVKNDRLFKYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+ K L+  +SDP S  N+L   +Y  F R+++F+          + 
Sbjct: 60  KAYGLEDMAYAKAFMVKALKEGVSDPNSFANKLTDKRYAEFVRAFNFAANGTSTTVYNKA 119

Query: 120 KTIIQDYKQSHQHKEEVALE------ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
           + ++                      E+ Y+  NI K+ SVD L  D RLL Y + +F +
Sbjct: 120 QQLVTSNYALQVQIGASQKGLPYYQSETAYYVTNIAKVKSVDDLMGDSRLLTYAMAAFGL 179

Query: 174 TPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP--DGSLSKRDKILTDM 231
                    +K +L  G+++P     +  D  +      F F    D +  + D      
Sbjct: 180 DAATEPAATVKAMLEGGVSDPDSPANKLPDKSYAKFVAAFDFAQYGDQTTMRDDVQQAVP 239

Query: 232 QIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEI 291
           +     +           I  + +YY   I+ V+S  + + D +L      S        
Sbjct: 240 KGYMAGAGLTLVEPSAQYIKGEADYYAANISKVTSIDNLMADKRLLTFAMASYGLDASTE 299

Query: 292 TADKFLTLMQENDPIVS----------QVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
           T  +  T+++                    +    NF +    +T   +D   +    +Y
Sbjct: 300 TPQQIRTMLEGGVSDPESPANKLTDKRYANFVTAFNFAQYGDQTTS--RDEVQKDTPKIY 357

Query: 342 KKNCQI----LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFAL 397
                +     + D ++S    Y   +  +KS+D+L++                   + L
Sbjct: 358 TTESALGLIAPNADYIKSETAYYLANVTNVKSVDDLMANSR-------------LYNYVL 404

Query: 398 DAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQ 457
            AY L+     +D +RNVL     D DS ANK  +     L  AFNF   G         
Sbjct: 405 SAYGLDPATESKDLIRNVLAGGIRDADSVANKMTNKAYAGLAAAFNFEQYGEAATTINPA 464

Query: 458 SRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSF 517
            + T+                         + +        +      Y+     TI S+
Sbjct: 465 QQPTVDKY--------------------MRQTLEEDAGQTNQGVRLALYFDRKAPTITSW 504

Query: 518 EELLANKRILNFLLESKGIDSQKVRED-------FLCEIFKSDLKDPKSFANTYKDNRYK 570
            ++LA+  + + +    G+       D       F  ++  SD  DP+         R+ 
Sbjct: 505 YDVLADTALASVVRTVLGLPDSFATADVDKQAQLFEQKLDISDFSDPEKLGKFLT--RFT 562

Query: 571 EIIS 574
            +  
Sbjct: 563 SMYE 566



 Score =  109 bits (273), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 70/184 (38%), Gaps = 15/184 (8%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +       + +   +      ++ +  YY  NI  + S ++ + N R+  + +++ G++
Sbjct: 6   TSYQLITRDISKSIDRIEQQPVVDRDTKYYLDNITKVKSIDDFVKNDRLFKYAMKAYGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                + F+ +  K  + DP SFAN   D RY E + +FNF  +G  +       Q    
Sbjct: 66  DMAYAKAFMVKALKEGVSDPNSFANKLTDKRYAEFVRAFNFAANGTSTTVYNKAQQL--- 122

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNI-----ALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
                  Y  Q    +       +       A Y    I  +++  +++GDS+L      
Sbjct: 123 ---VTSNYALQ---VQIGASQKGLPYYQSETAYYVT-NIAKVKSVDDLMGDSRLLTYAMA 175

Query: 653 KLKL 656
              L
Sbjct: 176 AFGL 179


>gi|218674655|ref|ZP_03524324.1| hypothetical protein RetlG_25976 [Rhizobium etli GR56]
          Length = 469

 Score =  349 bits (894), Expect = 1e-93,   Method: Composition-based stats.
 Identities = 128/474 (27%), Positives = 230/474 (48%), Gaps = 14/474 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ ++V+        S   S V+    V+ +  YY+E I  ++T+DEF+ D +L+SYA+K
Sbjct: 1   MVSAYVSYLAVARNLSASLSNVASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ FS   K  QSD+Q  
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFSGETKTAQSDVQRD 120

Query: 121 TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISL 180
           +++  Y++S + + +   +E+ YF +NI  I SVD      RL +YVL +F ++ +Y S 
Sbjct: 121 SLLDAYEESFETEADAIEDETDYFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTST 180

Query: 181 PFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNY 240
            FLKDVLT  L +   +  +  D+ + ++A+ F F  DGS+     ++++ QI  + S Y
Sbjct: 181 SFLKDVLTSDLDDADSFVNQLGDDVYVSLAKAFNFNEDGSVD--GDLMSEDQILLVTSAY 238

Query: 241 FNNTIDCVPIVSDQN---YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
              +       + +    Y+   I +++S    + D KL   L+ +    + E  +D F+
Sbjct: 239 AVASATIASSETGEAYDTYFAAEIGNITSVDQLMSDDKLVSYLRTAYGLTDDE--SDTFI 296

Query: 298 TLMQENDPIV---SQVKYFFQINFHRDN--SSSTKIQQDSQIQKMLDLYKKNCQIL-HDD 351
           +   ++  I             NF  D   +     Q   Q       + +N Q+L  + 
Sbjct: 297 SAALKSADIADAIGLSDLHDAFNFDEDGALADGDTAQTSDQTAATTAAFDENYQVLIANT 356

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
             +  + +Y   +  + SID+ L      +  +  ++     + AL A++++   + R +
Sbjct: 357 DTEDAVDNYTTRIASVTSIDDFLVSNADDDD-DDNDDLPEMWEMALRAFDIDPDSVSRSE 415

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
           +R +L S+P+D  SY N   DDR +         A  ++           + D 
Sbjct: 416 VRKILESDPTDAKSYVNSLDDDRFVAFRKHSISTAMATLPFPCRPCRNSVVDDY 469



 Score =  154 bits (389), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 69/350 (19%), Positives = 124/350 (35%), Gaps = 51/350 (14%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
             +     +      Y+  + K+ ++D  +                    +A+ AY L  
Sbjct: 20  SNVASQATVARDSAYYKENIDKVTTVDEFMGDY-------------KLYSYAMKAYGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  ++ VL S+ SD  S+AN   D R  +   AF F+ +         QS +    
Sbjct: 67  MTYAKAFMKKVLESDLSDSSSFANSLSDGRYAEFAAAFKFSGETK-----TAQSDVQRDS 121

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            +  Y                      + +     I  E DY+  NI +I S ++ L++ 
Sbjct: 122 LLDAYEE--------------------SFETEADAIEDETDYFEENIASITSVDDFLSSS 161

Query: 525 RILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGEL 584
           R+ N++L + G+ ++     FL ++  SDL D  SF N   D+ Y  +  +FNF+  G +
Sbjct: 162 RLKNYVLTAFGLSTEYTSTSFLKDVLTSDLDDADSFVNQLGDDVYVSLAKAFNFNEDGSV 221

Query: 585 SHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDS 644
                G +     I      Y            +   A   YF   I NI +  +++ D 
Sbjct: 222 D----GDLMSEDQILLVTSAYAVAS--ATIASSETGEAYDTYFAAEIGNITSVDQLMSDD 275

Query: 645 KLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAA 694
           KL   +     L+         +    +   +K  D  D+  + D   A 
Sbjct: 276 KLVSYLRTAYGLTD-------DESDTFISAALKSADIADAIGLSDLHDAF 318



 Score =  129 bits (325), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 79/417 (18%), Positives = 149/417 (35%), Gaps = 56/417 (13%)

Query: 237 VSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT---- 292
           +S   +N      +  D  YYK  I+ V++  +F+ D KL+     +    +        
Sbjct: 15  LSASLSNVASQATVARDSAYYKENIDKVTTVDEFMGDYKLYSYAMKAYGLEDMTYAKAFM 74

Query: 293 ----ADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQIL 348
                          + +       F   F     +    Q D Q   +LD Y+++ +  
Sbjct: 75  KKVLESDLSDSSSFANSLSDGRYAEFAAAFKFSGET-KTAQSDVQRDSLLDAYEESFETE 133

Query: 349 HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
            D  ++     ++  +  I S+D+ LS                   + L A+ L+ +   
Sbjct: 134 AD-AIEDETDYFEENIASITSVDDFLSSSR-------------LKNYVLTAFGLSTEYTS 179

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKH 468
              L++VLTS+  D DS+ N+  DD  + L  AFNFN DGS+    M  S   I      
Sbjct: 180 TSFLKDVLTSDLDDADSFVNQLGDDVYVSLAKAFNFNEDGSVDGDLM--SEDQILLVTSA 237

Query: 469 YANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN 528
           YA    +I  +E                         Y+   I  I S ++L+++ ++++
Sbjct: 238 YAVASATIASSETGEAYD------------------TYFAAEIGNITSVDQLMSDDKLVS 279

Query: 529 FLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKK 588
           +L  + G+   +        +  +D+ D    +         ++  +FNFD  G L+   
Sbjct: 280 YLRTAYGLTDDESDTFISAALKSADIADAIGLS---------DLHDAFNFDEDGALA--D 328

Query: 589 IGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSK 645
               Q +     T   +     +      D   A+  Y  R I ++ +  + L  + 
Sbjct: 329 GDTAQTSDQTAATTAAFDEN-YQVLIANTDTEDAVDNYTTR-IASVTSIDDFLVSNA 383


>gi|254477619|ref|ZP_05091005.1| flagellar protein, putative [Ruegeria sp. R11]
 gi|214031862|gb|EEB72697.1| flagellar protein, putative [Ruegeria sp. R11]
          Length = 590

 Score =  348 bits (892), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 136/706 (19%), Positives = 235/706 (33%), Gaps = 164/706 (23%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
             K PI+    + +  +I  I T D+ + D  +   AL AFGL +      FIK++LESD
Sbjct: 29  FEKSPILDRAVQDFTNKIDSIQTADQLLDDYNVLQVALGAFGLEEDIANRAFIKQVLESD 88

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES 141
           LSDP+S  N+LN  +Y   A+++ F                          +   A  E 
Sbjct: 89  LSDPRSFANRLNDNRYLGLAQTFGFGSEDGP--------------------QLPSASAEK 128

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
            Y       + S + L  ++ LL+  L  F +     +  FL+ VL   L++   +    
Sbjct: 129 PYVN-----VASPEDLLSNKTLLNQALDDFGLQRYAGNEFFLQKVLESDLSDDNSFVNRL 183

Query: 202 RDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAI 261
            D R    A  F+F      +     +        +  +        P            
Sbjct: 184 SDTRLADFASQFKFNAPPEYTSSMDAM--------LGEFTAMNDGAGPA----------- 224

Query: 262 NSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRD 321
               +  + L +  L   +  +      E T   FL  M E DP               D
Sbjct: 225 ----NADELLGNETLLNAVIETFDL---EYTNPIFLKRMLEADPY--------------D 263

Query: 322 NSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLE 381
            +S+ + Q+D ++  M   +                      +    S D L +      
Sbjct: 264 ENSAVRQQEDPRVLAMSRAF----------------GFGMPDINSFSSPDELFA------ 301

Query: 382 GPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHA 441
                      L+  LD +N    +   D LR VL S+ SDP+S+ N+  +     L  A
Sbjct: 302 -------RPELLEEVLDQFN--NSNPGEDFLRQVLESDLSDPNSFVNQPGNLAFFDLAEA 352

Query: 442 FNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEIN 501
           +                                              + +        + 
Sbjct: 353 Y--------------------------------------------QTEWTPPPSKVKVLA 368

Query: 502 SEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFA 561
            EV      ++   +  + + +       L+   ++ +++   F+ ++F+SDL    S+A
Sbjct: 369 DEVG---TKLSGYENPRQFVFDFDAFEAGLDVFNMNERQLDFSFMLKVFESDLSSETSYA 425

Query: 562 NTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNI 621
           N Y+D   + + ++F F+  G       G        ++  DLY  +  E    E DPN+
Sbjct: 426 NLYRDPNVQAMANAFAFNPGGNDRTYPPG------FAEEIADLYTDRNFEIAIGESDPNM 479

Query: 622 ALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILK 673
            LAL  +R + +I +         Y I+G   L  V    L L   F  L   +++  +K
Sbjct: 480 RLALALERELQSIADAGGSEDAHWYGIIGSPPLKTVFESALGLPSSFGQLDVDRQVNEMK 539

Query: 674 KHI-------KINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
                        D     K+E+F      +   + D   A FS P
Sbjct: 540 DRAFASFGTTHPADLLKPDKLEEFRNRFLLLSELNSDTASAGFSDP 585



 Score = 97.6 bits (241), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 82/220 (37%), Gaps = 14/220 (6%)

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
           N    +  Q       +  ++  V  +T  I++I + ++LL +  +L   L + G++   
Sbjct: 16  NFLDRTRTQQQQIFEKSPILDRAVQDFTNKIDSIQTADQLLDDYNVLQVALGAFGLEEDI 75

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
               F+ ++ +SDL DP+SFAN   DNRY  +  +F F              +   ++  
Sbjct: 76  ANRAFIKQVLESDLSDPRSFANRLNDNRYLGLAQTFGFGSEDGPQLPSASAEKPYVNVAS 135

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALY-------FKRTIPNIRNHYEILGDSKLFKVV-SK 652
             DL  ++ +  +  +       A          +  + +  +    L D++L       
Sbjct: 136 PEDLLSNKTLLNQALDDFGLQRYAGNEFFLQKVLESDLSDDNSFVNRLSDTRLADFASQF 195

Query: 653 KLKLSPY-FAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
           K    P   + +       +L +   +ND       ++ L
Sbjct: 196 KFNAPPEYTSSMD-----AMLGEFTAMNDGAGPANADELL 230


>gi|218674013|ref|ZP_03523682.1| hypothetical protein RetlG_21992 [Rhizobium etli GR56]
          Length = 993

 Score =  346 bits (886), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 157/677 (23%), Positives = 279/677 (41%), Gaps = 108/677 (15%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  ++++D+F+ D +L+SYA+
Sbjct: 1   MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPDSYANKLSDTRYREFAAAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ A  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 120 DELIGLYKQSFVDADKAAATESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYAS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   ++  
Sbjct: 180 KDFLRQVLTSDLSDPTSIVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASVIET 237

Query: 240 YFNNT---------------IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           Y  N+               +       ++ YY   I ++++  D + D +L   ++ + 
Sbjct: 238 YTLNSQSVIIDNSVGSDVYYVGKTAAEYNKAYYTAKIGTITNVDDLVADSRLTSYIKTAY 297

Query: 285 FP-LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
               +    A + +        ++     +   NF  D S+S   +  S  Q        
Sbjct: 298 SMGADFTAAALRTVLTDPSYAQLMGFTNVYNAFNFKSDGSTSNTARVQSVEQA------- 350

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
             Q+       +           I ++D+LL+               +  ++  DAY L 
Sbjct: 351 -NQLKSAASSTTNYYSVTSQSSSITNVDDLLADS-------------VLARYIKDAYGLG 396

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
           +      +L+N+LT       +YA          LN  FNFNADGSI    +        
Sbjct: 397 VN-FSNAELKNILT-----DSAYAAAQGK---AGLNADFNFNADGSINGSVIQTDTQRQS 447

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
              K                                  +   ++   I ++ + ++++++
Sbjct: 448 TTGKS--------------------------------AANATHFNSMIASVTNVDDIMSD 475

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
              ++++  S  I              ++ L DP + +       Y ++   FNF   G 
Sbjct: 476 PIAVSYIRNSMQIADSVSDA-----TLRTFLVDPAAASAQG----YSDVHDLFNFKTDGS 526

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGD 643
           ++    G  Q       T                D     A+Y++ TI  I N  ++L D
Sbjct: 527 VATLYSG--QTAAQSASTASK------------ADDA---AVYYQATIAGISNVDQLLAD 569

Query: 644 SKLFKVVSKKLKLSPYF 660
            KL   V     +    
Sbjct: 570 QKLNNFVRNAFGIPSTV 586



 Score =  287 bits (734), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 126/584 (21%), Positives = 231/584 (39%), Gaps = 58/584 (9%)

Query: 32  ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQ 91
             ++   I  ++ +D+ + D    SY   +  ++D S ++  ++  L     DP +   Q
Sbjct: 456 ATHFNSMIASVTNVDDIMSDPIAVSYIRNSMQIAD-SVSDATLRTFLV----DPAAASAQ 510

Query: 92  LNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKI 151
                Y      ++F     V                        A + + Y++  I  I
Sbjct: 511 G----YSDVHDLFNFKTDGSVATLYSGQTA------AQSASTASKADDAAVYYQATIAGI 560

Query: 152 NSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAE 211
           ++VDQL  D++L ++V  +F I      L  L+D+LT           +S    +  +A 
Sbjct: 561 SNVDQLLADQKLNNFVRNAFGIPSTVTDLA-LRDILTD----------QSGTGTYADVAA 609

Query: 212 NFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFL 271
            F F+ DG+L       TD Q+  I           +   +  N Y   + ++++  D +
Sbjct: 610 AFNFKADGTLEDGMPAQTDSQVTNIK----------IAATARTNDYSARMGTIANVDDLI 659

Query: 272 KDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDNSSS--TKI 328
            DP +   L+ +         AD + +                   NF  D S    + +
Sbjct: 660 ADPAITNFLKSTYNLPFNISDADLRSILTDSTAAAAAGYADLNADFNFAADGSLPAVSSV 719

Query: 329 QQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK---------IKSIDNLLSGKCQ 379
           Q  +Q Q   D Y        D+ +  +  +Y+  +           I S+++ L     
Sbjct: 720 QTAAQAQTTNDNYMARYDDERDEAIAEVASNYKSMMADSTSLLDFSEITSVNDFLRTNSS 779

Query: 380 LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
            +   S +        AL A+ L  Q++ R  +R +LTS+  DPD Y    KD+R+  L 
Sbjct: 780 ADFKKSNDNLPDPFHVALQAFGLTDQEVSRSMMRKILTSDAYDPDGYIASLKDERITNLA 839

Query: 440 HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
            AFNF  DG            T+      Y      +  A             + +   +
Sbjct: 840 RAFNFGPDGKAASPFQALPDATMAKYATDYKAHMTMLLKA----------GPVKDKAAKD 889

Query: 500 INSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKS 559
             +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  D KS
Sbjct: 890 ATAEVDYFAKTMAKVKSLDDFLDDSRLTDLVLKANNLDPEDYDKATLKKIFTSDPDDKKS 949

Query: 560 FANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
           + N+  D R+K+I+++FNFD  G L+  KIG +Q+    ++T +
Sbjct: 950 YLNSKADARFKDIVAAFNFDKDGNLTRAKIGTIQNKAAEENTQE 993



 Score =  203 bits (516), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 121/677 (17%), Positives = 232/677 (34%), Gaps = 103/677 (15%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
           V  D   + E  YY   I  + T+D+ + + RL +Y LK F +     ++ F++++L SD
Sbjct: 131 VDADKAAATESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYASKDFLRQVLTSD 190

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFSPPPK---VIQSDIQHKTIIQDYKQSHQHKEEVAL 138
           LSDP S+VN     KY+  A  + F+         Q+  Q  ++I+ Y  + Q       
Sbjct: 191 LSDPTSIVNTQGGDKYKALAAQFSFNADGTVTGTAQTAAQKASVIETYTLNSQSVIIDNS 250

Query: 139 EESK--------------YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
             S               Y+   I  I +VD L  D RL  Y+  ++S+   + +   L+
Sbjct: 251 VGSDVYYVGKTAAEYNKAYYTAKIGTITNVDDLVADSRLTSYIKTAYSMGADFTAAA-LR 309

Query: 185 DVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNT 244
            VLT    +P    +    N +      F F+ DGS S   ++ +  Q  ++ S      
Sbjct: 310 TVLT----DPSYAQLMGFTNVY----NAFNFKSDGSTSNTARVQSVEQANQLKSA----- 356

Query: 245 IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQEN 303
                  ++        +S+++  D L D  L + ++ +         A+ K +      
Sbjct: 357 ---ASSTTNYYSVTSQSSSITNVDDLLADSVLARYIKDAYGLGVNFSNAELKNILTDSAY 413

Query: 304 DPIVSQVKYFFQINFHRDNS-SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQL 362
                +       NF+ D S + + IQ D+Q Q                K  +    +  
Sbjct: 414 AAAQGKAGLNADFNFNADGSINGSVIQTDTQRQSTTG------------KSAANATHFNS 461

Query: 363 PLGKIKSIDNLLSGK-CQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNV-----L 416
            +  + ++D+++S         NS +         L  + ++          +V      
Sbjct: 462 MIASVTNVDDIMSDPIAVSYIRNSMQIADSVSDATLRTFLVDPAAASAQGYSDVHDLFNF 521

Query: 417 TSNPSDPDSYANK--------------------------------SKDDRLIKLNH-AFN 443
            ++ S    Y+ +                                  D +L      AF 
Sbjct: 522 KTDGSVATLYSGQTAAQSASTASKADDAAVYYQATIAGISNVDQLLADQKLNNFVRNAFG 581

Query: 444 FNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSE 503
             +  +   +  + +  +        A       D   +     +  S    I +   + 
Sbjct: 582 IPSTVTDLALRDILTDQSGTGTYADVAAAFNFKADGTLEDGMPAQTDSQVTNIKIAATAR 641

Query: 504 VDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANT 563
            + Y+  + TI + ++L+A+  I NFL  +  +    + +  L  I              
Sbjct: 642 TNDYSARMGTIANVDDLIADPAITNFLKSTYNL-PFNISDADLRSILTDSTAAAA----- 695

Query: 564 YKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIAL 623
                Y ++ + FNF   G L    +  VQ       T D Y  +  +    E+D  IA 
Sbjct: 696 ---AGYADLNADFNFAADGSL--PAVSSVQTAAQAQTTNDNYMARYDD----ERDEAIAE 746

Query: 624 -ALYFKRTIPNIRNHYE 639
            A  +K  + +  +  +
Sbjct: 747 VASNYKSMMADSTSLLD 763


>gi|254464676|ref|ZP_05078087.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
 gi|206685584|gb|EDZ46066.1| conserved hypothetical protein [Rhodobacterales bacterium Y4I]
          Length = 574

 Score =  342 bits (878), Expect = 1e-91,   Method: Composition-based stats.
 Identities = 130/707 (18%), Positives = 236/707 (33%), Gaps = 169/707 (23%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++D Q +++    K P++    + + +RI  I + D+ + D  L +  L AFGL +  + 
Sbjct: 21  TRDQQQEVYE---KSPVLDRTVKDFTQRITSIQSADQLLDDYNLLTVTLGAFGLDEDINN 77

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSH 130
             FIK++LESD+SDPKS+VN+LN  +YQ  A ++ F                        
Sbjct: 78  RAFIKQVLESDMSDPKSIVNRLNDSRYQALAETFGFG----------------------- 114

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
              +   L  ++   +    I + D L  +R LL   L +  +     +  FL+ VL   
Sbjct: 115 -SADGPKLPSARAENEFAG-IATPDDLLSNRTLLRKALGNAGLEGLENNQFFLQKVLESD 172

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPI 250
           L +P  +  +  D R+ A A  F F              +  IE +VS +  +T      
Sbjct: 173 LDDPSSFANKLSDPRYAAFAGQFNFGQ--------VPAYESSIEALVSEFNQHTDGLASA 224

Query: 251 VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQV 310
                   L    + +          F + +     L   + +D                
Sbjct: 225 DDLLADEDLLQAVIDT----------FGLERTYPDFLRRVLNSDT--------------- 259

Query: 311 KYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSI 370
                                       D +    +      +          +  +   
Sbjct: 260 -------------------------TDPDSFVNQLEDKRYLAVSEAFGFGWPDINAMTDP 294

Query: 371 DNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKS 430
           + LLS                 L+ ALD +N++ +      LR VL S+ SDP+S+ N+ 
Sbjct: 295 EELLSN-------------PQLLEHALDTFNVSDR--GETYLRQVLESDLSDPNSFVNQP 339

Query: 431 KDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQI 490
           ++        AF                                              + 
Sbjct: 340 ENLAYYNFAEAF--------------------------------------------QNEW 355

Query: 491 STQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIF 550
                       E+   T  + T  +  EL+ +  +    L+  G   +    D + + F
Sbjct: 356 PEPVSKMQVFADEI---TDKLGTFTNPRELVFDLGLFEATLDLFGQSKRSTDFDTVLKAF 412

Query: 551 KSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMI 610
            SDL    SFAN + D   K +  +F+F+  GE+S +           ++  +LY  +  
Sbjct: 413 DSDLSSRTSFANMHYDTGLKAMAQAFSFNA-GEVSREYPE-----GFAEELAELYTTRQF 466

Query: 611 EKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAV 662
           E +    DPN+ LAL  +R + ++ +         Y I+G   L  +    L L    A 
Sbjct: 467 EIEIGNSDPNMRLALALERELQDVVDAGGSENAHWYNIIGSPPLRSIFETALGLPSGIAQ 526

Query: 663 LPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQSI 702
           L   +++  +K             DF + + ++ F      +   + 
Sbjct: 527 LDIERQLEEMKDRAFSAFGTTHPADFLEPEMLDQFRKRFLLLSDLNS 573



 Score = 92.6 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 67/196 (34%), Gaps = 16/196 (8%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            + +Q       +  ++  V  +T  I +I S ++LL +  +L   L + G+D       
Sbjct: 20  RTRDQQQEVYEKSPVLDRTVKDFTQRITSIQSADQLLDDYNLLTVTLGAFGLDEDINNRA 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +SD+ DPKS  N   D+RY+ +  +F F               +   I    DL
Sbjct: 80  FIKQVLESDMSDPKSIVNRLNDSRYQALAETFGFGSADGPKLPSARAENEFAGIATPDDL 139

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
             ++ +          +  AL          N +       L KV+   L     FA   
Sbjct: 140 LSNRTL----------LRKALGNAGLEGLENNQF------FLQKVLESDLDDPSSFANKL 183

Query: 665 ERKKIRILKKHIKIND 680
              +            
Sbjct: 184 SDPRYAAFAGQFNFGQ 199


>gi|115524603|ref|YP_781514.1| hypothetical protein RPE_2596 [Rhodopseudomonas palustris BisA53]
 gi|115518550|gb|ABJ06534.1| protein of unknown function DUF1217 [Rhodopseudomonas palustris
           BisA53]
          Length = 799

 Score =  337 bits (863), Expect = 5e-90,   Method: Composition-based stats.
 Identities = 158/750 (21%), Positives = 284/750 (37%), Gaps = 84/750 (11%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +++     +++++  L + V++   V+    YY+E I  + T+D+F+K+ RL+ YA+
Sbjct: 1   MVSTYLGFDLVARNLRRSL-TLVAQQTDVTRAASYYKENIGKVKTVDDFMKNDRLYRYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS-PPPKVIQSDIQ 118
           KA+GL DM+ A+ F+KK+LESDL+D KS  N+L   +YQ FA ++ F+     V Q+  Q
Sbjct: 60  KAYGLEDMTFAKAFMKKVLESDLTDSKSFANKLTDKRYQEFAAAFSFNSATTAVAQTSYQ 119

Query: 119 HKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYI 178
              ++  Y  + Q + +   E+++Y+   I  I +VDQL  + RL  YV  +F I     
Sbjct: 120 TDEMVGLYTATLQQQADAVGEDTRYYNAKIGSIATVDQLLNNDRLRTYVFSAFGIDDGTW 179

Query: 179 SLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVS 238
           S   +K++L    ++P  Y              +F      S     K      I+   +
Sbjct: 180 SRATMKNILGSDPSDPGSYINTVWGPPLDDAIASFNLAQAESTDASSK------IDDYTA 233

Query: 239 NYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLT 298
                  D   + +     +  +   SS      D   F    +++              
Sbjct: 234 QMAQPGADLADLKAKIALEQGRVAKASS------DMSGFNKTIIAIG------------- 274

Query: 299 LMQENDPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSL 356
                       +      F  D +  S    Q D   +   + +  +            
Sbjct: 275 ---------HYFELASAFEFSTDGTLASGVAAQTDENRKITNEKFIADQPRTSPAAALVE 325

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              ++      +++D L +                  +F   A+ +    L    L+++L
Sbjct: 326 KAYFEQQASSARTVDELFADDAF-----------RMAKFIGVAFGVGTLPLST--LKSIL 372

Query: 417 TS--NPSDPDSYANK--SKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANR 472
           TS  + ++  S+ N   S  D   +L +AFNF  DG++      QS       +  Y   
Sbjct: 373 TSDRDVNNASSFVNLAGSNKDAYTRLMNAFNFKQDGTLDAGVDAQSATQSSATIGRY--- 429

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                         M   +     + ++  ++  +   +  I S E+ ++   + NF LE
Sbjct: 430 --------------MTAYNDADEASEKLAKQM--FKSGVYGITSIEKFVSTPSVYNFALE 473

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK---KI 589
           + G+D   V    +    KSDL DPKS+  T KD+RY ++   FNFD  G+L+     + 
Sbjct: 474 AVGLDPDSVSATTVKAALKSDLSDPKSYVYTLKDDRYVQLARYFNFDSKGQLTTPLVAQD 533

Query: 590 GKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKV 649
                N   D      K     +K   ++     ALY+K  I  + +  E+L D KL   
Sbjct: 534 AAEVTNIAKDYVIAKTKFASAAEKAGLQEAAEKDALYYKNAIAGVDSVSELLADKKLVNF 593

Query: 650 VSKKLKL-SPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKAL 708
           +     L              +I      ++D K     E  L  A+     + D K  +
Sbjct: 594 ILVAKGLDPKKVTN---DYLRKIFSS--DLSDAKSFANKESDLRFAEIAASFNFDKKGKV 648

Query: 709 FSSPNQNKDPWNNSFDDPQNNVSLQLSPQK 738
                          +   N +   L  Q+
Sbjct: 649 TRIAATGPQSREQLLETQNNYLQQSLESQQ 678


>gi|255601155|ref|XP_002537616.1| conserved hypothetical protein [Ricinus communis]
 gi|223515719|gb|EEF24767.1| conserved hypothetical protein [Ricinus communis]
          Length = 386

 Score =  298 bits (762), Expect = 3e-78,   Method: Composition-based stats.
 Identities = 105/402 (26%), Positives = 182/402 (45%), Gaps = 16/402 (3%)

Query: 342 KKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
             N Q          + +Y+  +  +K+I +  +     +   + +      Q AL AY 
Sbjct: 1   MNNYQSSQSTLTTDAVNNYKNRIASVKTIKDFFASN-TSDSSAANDSAPELYQMALRAYG 59

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
           +   ++ + +L  +L S+P DP SY N  KD R   L  AFNF++ G++       S+  
Sbjct: 60  IGENEVTKSRLTKILESDPYDPKSYVNSLKDSRFTALAKAFNFDSKGNLKAPVQSLSQTQ 119

Query: 462 IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL 521
           I   +  Y++R  +       +           +   +  +   Y+  NI  + S  +LL
Sbjct: 120 INSYISEYSSRTTAGLSGAELT-----------KATSDAKTAGTYFATNIVKVTSVTDLL 168

Query: 522 ANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
           A+ ++ NF+L +  ID + V    L + F SD  D KSF NT    ++K I+ +FNF   
Sbjct: 169 ADSKLTNFILTANSIDPKTVDTATLKKAFASDPSDSKSFINTTDGAKFKSIVEAFNFGTD 228

Query: 582 GELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEIL 641
           G L+  K+G  Q+   +  T DL+ HQ +E ++ E +P + LALYF+R   +I + Y+I+
Sbjct: 229 GNLTDSKLGTAQNQGALAATNDLFLHQTLEDQQGETNPGVRLALYFQRKASDINSIYDIM 288

Query: 642 GDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQS 701
           GDS L++V++    L    + +    +  +L K + ++D +D  KV   L    AM    
Sbjct: 289 GDSALYEVITTTYNLPSSISNMDVDTQASMLSKFVNVSDLQDPDKVNQLLQRFSAM---- 344

Query: 702 IDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSNGR 743
            D +    SS +        S      +    LS  + S+ R
Sbjct: 345 YDMENNTTSSTSPALSILTGSSSSSGISADTLLSIAQLSSSR 386



 Score =  170 bits (430), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 64/312 (20%), Positives = 121/312 (38%), Gaps = 33/312 (10%)

Query: 21  TVSKDPIVSCEERYYRERIKHISTIDEFIKD------------KRLFSYALKAFGLSDMS 68
             S+  + +     Y+ RI  + TI +F                 L+  AL+A+G+ +  
Sbjct: 5   QSSQSTLTTDAVNNYKNRIASVKTIKDFFASNTSDSSAANDSAPELYQMALRAYGIGENE 64

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP---KVIQSDIQHK----- 120
             +  + KILESD  DPKS VN L   ++   A++++F         +QS  Q +     
Sbjct: 65  VTKSRLTKILESDPYDPKSYVNSLKDSRFTALAKAFNFDSKGNLKAPVQSLSQTQINSYI 124

Query: 121 ------TIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
                 T               A     YF  NI K+ SV  L  D +L +++L + SI 
Sbjct: 125 SEYSSRTTAGLSGAELTKATSDAKTAGTYFATNIVKVTSVTDLLADSKLTNFILTANSID 184

Query: 175 PKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR--DKILTDMQ 232
           PK +    LK       ++ K +   +   +F+++ E F F  DG+L+            
Sbjct: 185 PKTVDTATLKKAFASDPSDSKSFINTTDGAKFKSIVEAFNFGTDGNLTDSKLGTAQNQGA 244

Query: 233 IEKIVSNYFNNTIDCVPIVSD-----QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPL 287
           +      + + T++     ++       Y++   + ++S  D + D  L++++  +    
Sbjct: 245 LAATNDLFLHQTLEDQQGETNPGVRLALYFQRKASDINSIYDIMGDSALYEVITTTYNLP 304

Query: 288 NPEITADKFLTL 299
           +     D     
Sbjct: 305 SSISNMDVDTQA 316


>gi|218459363|ref|ZP_03499454.1| hypothetical protein RetlK5_07677 [Rhizobium etli Kim 5]
          Length = 332

 Score =  295 bits (756), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 95/337 (28%), Positives = 163/337 (48%), Gaps = 14/337 (4%)

Query: 376 GKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRL 435
                +   S +        AL A+ L  QD+ R  +R +LTS+  DPD Y    KD+R+
Sbjct: 1   TNAAADFKKSNDNLPDPYHVALQAFGLTDQDVPRSMMRKILTSDAYDPDGYIASLKDERI 60

Query: 436 IKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKR 495
             L  AFNF  DG            T+      Y      +  A             + +
Sbjct: 61  TNLARAFNFGPDGKAASPFQALPDATLAKYATDYKAHMTMLLKA----------GPVKDK 110

Query: 496 INLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLK 555
            + +  +EVDY+   +  + S ++ L + R+ + +L++  +D +   +  L +IF SD  
Sbjct: 111 ASKDATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPD 170

Query: 556 DPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEE 615
           D KS+ N+  D R+++I+++FNFD  G L+  KIG +Q+    ++T +LY  Q +E ++ 
Sbjct: 171 DKKSYLNSKADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEENTQELYVRQTLEAQQG 230

Query: 616 EKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKH 675
           E +  + LALYF R  P+I + Y ILGD  L++V++    L    + +   K+  ++ + 
Sbjct: 231 ETNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVTKQADLINRF 290

Query: 676 IKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
           +K+ D +D KKV+  L    AM     D + +   SP
Sbjct: 291 VKLEDLQDPKKVDKLLRRFTAM----YDVQNSAQQSP 323



 Score =  170 bits (430), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 66/271 (24%), Positives = 103/271 (38%), Gaps = 22/271 (8%)

Query: 55  FSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ 114
           +  AL+AFGL+D       ++KIL SD  DP   +  L   +    AR+++F P  K   
Sbjct: 18  YHVALQAFGLTDQDVPRSMMRKILTSDAYDPDGYIASLKDERITNLARAFNFGPDGKAAS 77

Query: 115 S-----DIQHKTIIQDYKQSHQ----------HKEEVALEESKYFRKNIHKINSVDQLFK 159
                 D        DYK                 + A  E  YF K + K+ S+D    
Sbjct: 78  PFQALPDATLAKYATDYKAHMTMLLKAGPVKDKASKDATAEVDYFAKGMAKVKSLDDFLD 137

Query: 160 DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG 219
           D RL D VL++ ++ PK      LK + T    + K Y     D RF+ +   F F  DG
Sbjct: 138 DSRLTDLVLKANNLDPKDYDKATLKKIFTSDPDDKKSYLNSKADARFQDIVAAFNFDKDG 197

Query: 220 SL--SKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD-----QNYYKLAINSVSSFSDFLK 272
           +L  +K   I      E     Y   T++     ++       Y+     S++S    L 
Sbjct: 198 NLTRAKIGTIQNKAAEENTQELYVRQTLEAQQGETNDGVRLALYFSRKAPSITSIYSILG 257

Query: 273 DPKLFKMLQLSLFPLNPEITADKFLTLMQEN 303
           D  L++++  +        + D        N
Sbjct: 258 DKALYQVITTAYSLPAQISSMDVTKQADLIN 288



 Score =  111 bits (277), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/197 (20%), Positives = 80/197 (40%), Gaps = 18/197 (9%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
                + E  Y+ + +  + ++D+F+ D RL    LKA  L    + +  +KKI  SD  
Sbjct: 111 ASKDATAEVDYFAKGMAKVKSLDDFLDDSRLTDLVLKANNLDPKDYDKATLKKIFTSDPD 170

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPK-------VIQSDIQHKTIIQDY-KQSHQHKEE 135
           D KS +N     ++Q    +++F             IQ+    +   + Y +Q+ + ++ 
Sbjct: 171 DKKSYLNSKADARFQDIVAAFNFDKDGNLTRAKIGTIQNKAAEENTQELYVRQTLEAQQG 230

Query: 136 VALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD------- 185
              +  +   YF +    I S+  +  D+ L   +  ++S+  +  S+   K        
Sbjct: 231 ETNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSLPAQISSMDVTKQADLINRF 290

Query: 186 VLTLGLANPKKYFIESR 202
           V    L +PKK     R
Sbjct: 291 VKLEDLQDPKKVDKLLR 307



 Score = 93.4 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 41/253 (16%), Positives = 82/253 (32%), Gaps = 42/253 (16%)

Query: 310 VKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQ-------------ILHDDKMQSL 356
                  NF  D  +++  Q        L  Y  + +                     + 
Sbjct: 61  TNLARAFNFGPDGKAASPFQALP--DATLAKYATDYKAHMTMLLKAGPVKDKASKDATAE 118

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
           +  +   + K+KS+D+ L                      L A NL+ +D D+  L+ + 
Sbjct: 119 VDYFAKGMAKVKSLDDFLDDSRLT-------------DLVLKANNLDPKDYDKATLKKIF 165

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSI 476
           TS+P D  SY N   D R   +  AFNF+ DG++    +                 +   
Sbjct: 166 TSDPDDKKSYLNSKADARFQDIVAAFNFDKDGNLTRAKIG--------------TIQNKA 211

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI 536
            +   +     + +  Q+    +      Y++    +I S   +L +K +   +  +  +
Sbjct: 212 AEENTQELYVRQTLEAQQGETNDGVRLALYFSRKAPSITSIYSILGDKALYQVITTAYSL 271

Query: 537 DSQKVREDFLCEI 549
            +Q    D   + 
Sbjct: 272 PAQISSMDVTKQA 284


>gi|260466626|ref|ZP_05812814.1| protein of unknown function DUF1217 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029632|gb|EEW30920.1| protein of unknown function DUF1217 [Mesorhizobium opportunistum
           WSM2075]
          Length = 373

 Score =  279 bits (714), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 92/378 (24%), Positives = 162/378 (42%), Gaps = 42/378 (11%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             D+ K   +I     +    + Y   + K+KSID+ +                   ++A
Sbjct: 12  TRDISKSIDRIEKQPTVDRDTQYYLANITKVKSIDDFVKNDR-------------LFKYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + AY L   D  +  +   L    +DPDS+ANK  D R  +   AFNF A+G+   I   
Sbjct: 59  MKAYGLEDMDYAKAFMVKALKEGVTDPDSFANKLTDKRYAQFVSAFNFAANGADATIYNK 118

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
             +L +++                        QI+     +  +  E  YY  NI  + S
Sbjct: 119 AQQLVMKNYAT-------------------QAQIAGLDPNSDYVKGETTYYLANITKVKS 159

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSF 576
            ++L++N R+  + L + G+DS    +D + ++ +S + DP S AN   +  Y  +  +F
Sbjct: 160 VDDLMSNSRLYTYALAAYGLDSATEDKDLIKQVLQSKVSDPDSVANKQTNPAYAGLALAF 219

Query: 577 NFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN 636
           NF+ +GE +       Q       T D Y  Q +E+   + +  + LALYF+R  P+I +
Sbjct: 220 NFEANGENATTISPAQQP------TVDKYLRQTLEEDAGQTNQGVRLALYFQRKAPDITS 273

Query: 637 HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKA 696
            Y++L D+ L  VV   L L   FA     K+ ++ ++ + + DF D  K+  FL    +
Sbjct: 274 WYDVLADTALASVVRTALGLPDSFATANIDKQAQLFEQKLDLTDFTDPAKLTKFLTRFTS 333

Query: 697 MDHQSIDYKKALFSSPNQ 714
           M     +      ++ + 
Sbjct: 334 M----YEINNPTSTAVSS 347



 Score =  248 bits (634), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 72/312 (23%), Positives = 140/312 (44%), Gaps = 15/312 (4%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +  +    ++DI SK    + K P V  + +YY   I  + +ID+F+K+ RLF YA+
Sbjct: 1   MLNTFTSYQLITRDI-SKSIDRIEKQPTVDRDTQYYLANITKVKSIDDFVKNDRLFKYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM +A+ F+ K L+  ++DP S  N+L   +Y  F  +++F+          + 
Sbjct: 60  KAYGLEDMDYAKAFMVKALKEGVTDPDSFANKLTDKRYAQFVSAFNFAANGADATIYNKA 119

Query: 120 KTIIQDYKQSHQHKEEVA------LEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
           + ++     +      +         E+ Y+  NI K+ SVD L  + RL  Y L ++ +
Sbjct: 120 QQLVMKNYATQAQIAGLDPNSDYVKGETTYYLANITKVKSVDDLMSNSRLYTYALAAYGL 179

Query: 174 TPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG----SLSKRDKILT 229
                    +K VL   +++P     +  +  +  +A  F F+ +G    ++S   +   
Sbjct: 180 DSATEDKDLIKQVLQSKVSDPDSVANKQTNPAYAGLALAFNFEANGENATTISPAQQPTV 239

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP 289
           D  + + +      T   V +     Y++     ++S+ D L D  L  +++ +L   + 
Sbjct: 240 DKYLRQTLEEDAGQTNQGVRLAL---YFQRKAPDITSWYDVLADTALASVVRTALGLPDS 296

Query: 290 EITADKFLTLMQ 301
             TA+       
Sbjct: 297 FATANIDKQAQL 308



 Score =  108 bits (269), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/213 (16%), Positives = 78/213 (36%), Gaps = 14/213 (6%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +       + +   +      ++ +  YY  NI  + S ++ + N R+  + +++ G++
Sbjct: 6   TSYQLITRDISKSIDRIEKQPTVDRDTQYYLANITKVKSIDDFVKNDRLFKYAMKAYGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                + F+ +  K  + DP SFAN   D RY + +S+FNF  +G  +       Q    
Sbjct: 66  DMDYAKAFMVKALKEGVTDPDSFANKLTDKRYAQFVSAFNFAANGADATIYNKAQQL--- 122

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNI-ALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL 656
                  Y  Q      +     +     Y+   I  +++  +++ +S+L+        L
Sbjct: 123 ---VMKNYATQAQIAGLDPNSDYVKGETTYYLANITKVKSVDDLMSNSRLYTYALAAYGL 179

Query: 657 SPYFAVLPERKKIRILKKHIKINDFKDSKKVED 689
                     K++         +   D   V +
Sbjct: 180 DSATEDKDLIKQVLQ-------SKVSDPDSVAN 205



 Score = 98.8 bits (244), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 43/278 (15%), Positives = 91/278 (32%), Gaps = 13/278 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            K+     +++Y+  NI K+ S+D   K+ RL  Y ++++ +     +  F+   L  G+
Sbjct: 23  EKQPTVDRDTQYYLANITKVKSIDDFVKNDRLFKYAMKAYGLEDMDYAKAFMVKALKEGV 82

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSK--RDKILTDMQIEKIVSNYFNNTIDCVP 249
            +P  +  +  D R+      F F  +G+ +          M+     +       +   
Sbjct: 83  TDPDSFANKLTDKRYAQFVSAFNFAANGADATIYNKAQQLVMKNYATQAQIAGLDPNSDY 142

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI--- 306
           +  +  YY   I  V S  D + + +L+     +    +     D    ++Q        
Sbjct: 143 VKGETTYYLANITKVKSVDDLMSNSRLYTYALAAYGLDSATEDKDLIKQVLQSKVSDPDS 202

Query: 307 -------VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQ-SLIK 358
                   +        NF  +  ++T I    Q      L +   +          L  
Sbjct: 203 VANKQTNPAYAGLALAFNFEANGENATTISPAQQPTVDKYLRQTLEEDAGQTNQGVRLAL 262

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
            +Q     I S  ++L+         +A     +   A
Sbjct: 263 YFQRKAPDITSWYDVLADTALASVVRTALGLPDSFATA 300


>gi|99082811|ref|YP_614965.1| hypothetical protein TM1040_2971 [Ruegeria sp. TM1040]
 gi|99039091|gb|ABF65703.1| conserved hypothetical protein [Ruegeria sp. TM1040]
          Length = 650

 Score =  269 bits (687), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 77/699 (11%), Positives = 191/699 (27%), Gaps = 114/699 (16%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
            + +    +   +  +  Y+ E I  +++ ++ + D+RL   A+KAFGL +  +    ++
Sbjct: 23  DRQYDAFVQSGKLKNDSEYFAENIGEVTSSEDLLNDRRLLQVAVKAFGLEEEINYRALLQ 82

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH-KTIIQDYKQSHQHKE 134
           + L    S   +L N +N  +Y  F+ ++ F P    + SD +  + +I  ++ +   + 
Sbjct: 83  RALNEGTSASDALANTMNDERYVEFSNAFGFGPGQSPMTSDSKAMQAVIDKFQSASFEEA 142

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANP 194
              ++E+                         +  +      +     ++        + 
Sbjct: 143 VGEVDET-------------------------MRTAL-----FAKRAMIEVFGEPDEDDV 172

Query: 195 KKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQ 254
            +  +  R  R   +A       D                                    
Sbjct: 173 SQLSVRERALREFDLAMKEINGKD------------------------------------ 196

Query: 255 NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFF 314
                 +  V+S  D  +D      L+                    E+D  +   +   
Sbjct: 197 ----DDVPGVTSVEDQWEDIIERDTLREFFDTTLRISAG----AAGLEDDERIQLYRERA 248

Query: 315 QINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLL 374
           QI F  D    T          ++  +K    +  DD  ++     +        +D ++
Sbjct: 249 QIIFGTD--DPTVFFSAENKDTIISAFKTRATVNGDDAAETA----KTAELSEHILDQMI 302

Query: 375 SGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDR 434
           S    L            L   +        D+   +    +        +      DD 
Sbjct: 303 SRDAALNEEWDFISRQEPLAEFMKTALELPDDIATRETSEAMR--IYREKAIEAFGTDDP 360

Query: 435 LIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQK 494
            +    A N +A   +       + L+  +   +    +  +  + N+        +   
Sbjct: 361 NV-FASAANLDATLEVYRENATNAGLSSSEISSNLRTAETILKFSYNQGDAIDGGDADAA 419

Query: 495 RINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDL 554
                   +  +Y+  +         L     ++  L + G     +  D    I+    
Sbjct: 420 ATAE---IDAGWYS--VMGQTGVPRFLNTALDVSSAL-APGEIFSDLTIDEQLTIY---- 469

Query: 555 KDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK-------VQDNFHIDDTCDLYKH 607
                    +     KE+   +      +               +     I +       
Sbjct: 470 --KDKAVELFGTADLKELTGPYQIGAVNDAYRTNAEAAGESEFFITYYSDIAERELNTLF 527

Query: 608 QMIEKKEEEKDPNIALALYF---KRTIPNIRN-HYEILGDSKLFKVVSKKLKLSPYFAVL 663
           Q  +   E+        L     +   P+  +  + I+G   +   +   L L      +
Sbjct: 528 QSDDTDAEKAFEEALEELRTMNDEDNGPSANSQWFTIMGQQAMTDFMQVALGLPKEVGQM 587

Query: 664 PERKKIRILKKHI-------KINDFKDSKKVEDFLYAAK 695
              + + + K+         K ++F    K+++ +    
Sbjct: 588 DIDQAVEVYKRKAQQVLGTDKPSEFISGDKMDELVNMYL 626


>gi|259417640|ref|ZP_05741559.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259346546|gb|EEW58360.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 650

 Score =  260 bits (663), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 80/699 (11%), Positives = 194/699 (27%), Gaps = 114/699 (16%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
            + +    K   +  +  Y+ E I  +++ ++ + D+RL   A+KAFGL +  +    ++
Sbjct: 23  DRQYDAFVKSGSLKNDSEYFAENIGGVTSSEDLLNDRRLLQVAVKAFGLEEEINYRALLQ 82

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH-KTIIQDYKQSHQHKE 134
           + L    S   +L N +N  +Y  F+ ++ F P    + SD +  + +I  ++ +   + 
Sbjct: 83  RALNEGTSASDALANTMNDERYVEFSNAFGFGPGQSPMTSDSKAMQAVIDKFQSASFEEA 142

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANP 194
              ++E+                         +  +      +     ++        + 
Sbjct: 143 VGEVDET-------------------------MRTAL-----FAKRAMIEVFGEPDEDDV 172

Query: 195 KKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQ 254
            +  ++ R  R   ++                                            
Sbjct: 173 SQLSVKERALREFDLSMKEINGKG------------------------------------ 196

Query: 255 NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFF 314
                 +  V+S  D  +D      L+                    E D  +   +   
Sbjct: 197 ----DDVPGVTSVEDQWQDIVQRDTLREFFDTTLRIPAG----AAGLEEDERIQLYRERA 248

Query: 315 QINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLL 374
           Q+ F  D    T          ++  +K    +  DD  +      ++       +D ++
Sbjct: 249 QVVFGTD--DPTMFFSGENKGIIVSAFKTRATVDGDDAAEIA----KIAKLSEHILDQMV 302

Query: 375 SGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDR 434
           S    L            L   +        D+      + +        +      DD 
Sbjct: 303 SRDAALNEEWDFISRQEPLAEFMKVALELPDDIATRNTSDAMR--IYREKAIEVFGTDDP 360

Query: 435 LIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQK 494
            I    A N +A  +       +S +   +   +    +  +  +  K        +   
Sbjct: 361 NI-FASAANLDATLNTYRENAAESGMRSSEISGNLRTVETILKFSFGKEDAVDGGDTDAA 419

Query: 495 RINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDL 554
                   +  +Y+  I         L     ++  LE  G   + +  +    I+K   
Sbjct: 420 DTAAV---DAGWYS--IMGQTGVPRFLNTALDVSSGLE-PGETFEALTVEEQLAIYKE-- 471

Query: 555 KDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK-------VQDNFHIDDTCDLYKH 607
                    +  +  KE+   +      E               +     I +       
Sbjct: 472 ----KAVEIFGTDDLKELTGPYQMGAVSEAYRTNAEAAGESEFFITYYSQIAERELDILF 527

Query: 608 QMIEKKEEEKDPNIALALYF---KRTIPNIRN-HYEILGDSKLFKVVSKKLKLSPYFAVL 663
           Q  E   E++       L     +   P+  +  Y I+G   + + +   L L      +
Sbjct: 528 QSDETDAEKEFEEALEKLRTMNDEDDGPSANSQWYTIMGQQAMTEFMQVALGLPKEVGQM 587

Query: 664 PERKKIRILKKHI-------KINDFKDSKKVEDFLYAAK 695
              + + + ++         K ++F    K+++ +    
Sbjct: 588 DIDQAVGVYRRKAEQVLGTDKPSEFISRDKMDELVNMYL 626


>gi|239834449|ref|ZP_04682777.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239822512|gb|EEQ94081.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 264

 Score =  253 bits (647), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 56/263 (21%), Positives = 100/263 (38%), Gaps = 12/263 (4%)

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
           R      +     + M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ L
Sbjct: 2   RMVDTMTSYRLIASDMARSLQRVSKEPMVERETAYYKENIGKVKSVDDFMADSRLYNYAL 61

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           ++ G++     + F+ +I    +K   + AN   D RYKE  + F+F+  G         
Sbjct: 62  KAFGLEDMAFAKAFVRKILTEGIKSDDAMANKLTDKRYKEFATVFDFEGKG------AEA 115

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
            Q         D Y  Q +E +   ++  + LALYF+R  P + N YEILGD  L  ++ 
Sbjct: 116 TQSTAAQQGVVDKYLRQTLETEAGSQNEGVRLALYFQRKAPTLTNAYEILGDKALVSMIQ 175

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSS 711
                    +     K+ ++++  I      D   V   +    AM     +      SS
Sbjct: 176 TTFGWPSTISNADIDKQAKMIEDKIDFTKMSDPDYVSKLISRFTAM----YEMNNPTASS 231

Query: 712 PNQNKDPWNNSFDDPQNNVSLQL 734
           P                 +S+ +
Sbjct: 232 PASIASLLLG--GTSSVGISMDI 252



 Score =  198 bits (502), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 97/191 (50%), Gaps = 7/191 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +  +    + D+ ++    VSK+P+V  E  YY+E I  + ++D+F+ D RL++YAL
Sbjct: 3   MVDTMTSYRLIASDM-ARSLQRVSKEPMVERETAYYKENIGKVKSVDDFMADSRLYNYAL 61

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQ 118
           KAFGL DM+ A+ F++KIL   +    ++ N+L   +Y+ FA  +DF        QS   
Sbjct: 62  KAFGLEDMAFAKAFVRKILTEGIKSDDAMANKLTDKRYKEFATVFDFEGKGAEATQSTAA 121

Query: 119 HKTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
            + ++  Y +Q+ + +     E  +   YF++    + +  ++  D+ L+  +  +F   
Sbjct: 122 QQGVVDKYLRQTLETEAGSQNEGVRLALYFQRKAPTLTNAYEILGDKALVSMIQTTFGWP 181

Query: 175 PKYISLPFLKD 185
               +    K 
Sbjct: 182 STISNADIDKQ 192



 Score =  104 bits (259), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/182 (20%), Positives = 77/182 (42%), Gaps = 7/182 (3%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI K+ SVD    D RL +Y L++F +     +  F++ +LT
Sbjct: 22  QRVSKEPMVERETAYYKENIGKVKSVDDFMADSRLYNYALKAFGLEDMAFAKAFVRKILT 81

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKIL----TDMQIEKIVSNYFNNT 244
            G+ +      +  D R++  A  F F+  G+ + +         D  + + +     + 
Sbjct: 82  EGIKSDDAMANKLTDKRYKEFATVFDFEGKGAEATQSTAAQQGVVDKYLRQTLETEAGSQ 141

Query: 245 IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND 304
            + V +     Y++    ++++  + L D  L  M+Q +    +    AD         D
Sbjct: 142 NEGVRLAL---YFQRKAPTLTNAYEILGDKALVSMIQTTFGWPSTISNADIDKQAKMIED 198

Query: 305 PI 306
            I
Sbjct: 199 KI 200



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 32/205 (15%), Positives = 71/205 (34%), Gaps = 33/205 (16%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +GK+KS+D+ ++                   +AL A+ L  
Sbjct: 22  QRVSKEPMVERETAYYKENIGKVKSVDDFMADSR-------------LYNYALKAFGLED 68

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT      D+ ANK  D R  +    F+F   G+         +  +  
Sbjct: 69  MAFAKAFVRKILTEGIKSDDAMANKLTDKRYKEFATVFDFEGKGAEATQSTAAQQGVVDK 128

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            ++                    + + T+     E      Y+     T+ +  E+L +K
Sbjct: 129 YLR--------------------QTLETEAGSQNEGVRLALYFQRKAPTLTNAYEILGDK 168

Query: 525 RILNFLLESKGIDSQKVREDFLCEI 549
            +++ +  + G  S     D   + 
Sbjct: 169 ALVSMIQTTFGWPSTISNADIDKQA 193



 Score = 39.8 bits (91), Expect = 1.6,   Method: Composition-based stats.
 Identities = 31/232 (13%), Positives = 69/232 (29%), Gaps = 19/232 (8%)

Query: 251 VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN--------PEITADKFLTLMQE 302
             +  YYK  I  V S  DF+ D +L+     +    +         +I  +   +    
Sbjct: 31  ERETAYYKENIGKVKSVDDFMADSRLYNYALKAFGLEDMAFAKAFVRKILTEGIKSDDAM 90

Query: 303 NDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK---D 359
            + +  +    F   F  +   +   Q  +  Q ++D Y +             ++    
Sbjct: 91  ANKLTDKRYKEFATVFDFEGKGAEATQSTAAQQGVVDKYLRQTLETEAGSQNEGVRLALY 150

Query: 360 YQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSN 419
           +Q     + +   +L  K  +    +      T+  A      ++    +     +  + 
Sbjct: 151 FQRKAPTLTNAYEILGDKALVSMIQTTFGWPSTISNA------DIDKQAKMIEDKIDFTK 204

Query: 420 PSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
            SDPD Y +K    R   +    N  A        ++    +         +
Sbjct: 205 MSDPD-YVSKLI-SRFTAMYEMNNPTASSPASIASLLLGGTSSVGISMDILS 254


>gi|260428823|ref|ZP_05782800.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260419446|gb|EEX12699.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 399

 Score =  253 bits (647), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 78/380 (20%), Positives = 146/380 (38%), Gaps = 39/380 (10%)

Query: 331 DSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPI 390
            S ++     + K+ +I  D       + ++  +G I S + L++ +             
Sbjct: 14  QSTLESQRTAFNKSAEITRDS------EYFKEKIGTINSAEELVNDRR------------ 55

Query: 391 ITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI 450
             L  AL A+ ++ Q   +  +R VL     D D+ ANK  D R   L   F+F   G  
Sbjct: 56  -LLSVALSAFGMDDQIDSKYLIRRVLEEGTKDDDALANKLSDSRFTVLAEVFDFEKTGGY 114

Query: 451 GPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLN 510
                  +        K                 +       + ++   I    +Y+  N
Sbjct: 115 RMQEEGFADPIFAAYEKKVLADLEVKLAEPEYVADPEYAALFETQVKRNIEISREYFNDN 174

Query: 511 INTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYK 570
           I +I S +ELL +  ++  ++ + GI+ ++  +  L  + +    DP + AN   D R  
Sbjct: 175 IGSITSPDELLLDFDLMQVVMGAFGIEDRRGSKALLKRVLEEGASDPNALANVLGDKRLI 234

Query: 571 EIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRT 630
            +  +F+FD            +Q +   ++  + Y+ Q  E    E DP I  AL F+R+
Sbjct: 235 RLAEAFSFDK-----SVPTNALQADSFANNIVEQYRWQRFEDAVGEVDPAIGTALQFQRS 289

Query: 631 IPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK----- 677
           IP++           Y ILG +    VV   L L   F+ +   K++ ILK  +      
Sbjct: 290 IPDLATSDISDSAKWYSILGSTTSRSVVETALSLPKGFSQIDIDKQVEILKDKMDRRFGV 349

Query: 678 --INDFKDSKKVEDFLYAAK 695
             ++D +D   +   +++  
Sbjct: 350 KEVSDLEDPATLRKIVHSYL 369



 Score =  197 bits (501), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 70/318 (22%), Positives = 125/318 (39%), Gaps = 41/318 (12%)

Query: 17  KLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKK 76
              +  +K   ++ +  Y++E+I  I++ +E + D+RL S AL AFG+ D   ++  I++
Sbjct: 19  SQRTAFNKSAEITRDSEYFKEKIGTINSAEELVNDRRLLSVALSAFGMDDQIDSKYLIRR 78

Query: 77  ILESDLSDPKSLVNQLNSLKYQYFARSYDFS-PPPKVIQSDIQHKTIIQDYKQSHQHKEE 135
           +LE    D  +L N+L+  ++   A  +DF       +Q +     I   Y++      E
Sbjct: 79  VLEEGTKDDDALANKLSDSRFTVLAEVFDFEKTGGYRMQEEGFADPIFAAYEKKVLADLE 138

Query: 136 VALEES------------------------KYFRKNIHKINSVDQLFKDRRLLDYVLQSF 171
           V L E                         +YF  NI  I S D+L  D  L+  V+ +F
Sbjct: 139 VKLAEPEYVADPEYAALFETQVKRNIEISREYFNDNIGSITSPDELLLDFDLMQVVMGAF 198

Query: 172 SITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
            I  +  S   LK VL  G ++P        D R   +AE F F  D S+   + +  D 
Sbjct: 199 GIEDRRGSKALLKRVLEEGASDPNALANVLGDKRLIRLAEAFSF--DKSVPT-NALQADS 255

Query: 232 QIEKIVSNY-----FNNTIDCVPIVSDQNYYKLAINSVSS--------FSDFLKDPKLFK 278
               IV  Y      +   +  P +     ++ +I  +++        +   L       
Sbjct: 256 FANNIVEQYRWQRFEDAVGEVDPAIGTALQFQRSIPDLATSDISDSAKWYSILGSTTSRS 315

Query: 279 MLQLSLFPLNPEITADKF 296
           +++ +L         D  
Sbjct: 316 VVETALSLPKGFSQIDID 333


>gi|256014917|ref|YP_003104926.1| hypothetical protein BMI_II127 [Brucella microti CCM 4915]
 gi|255997577|gb|ACU49264.1| hypothetical protein BMI_II127 [Brucella microti CCM 4915]
          Length = 258

 Score =  252 bits (643), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 102/257 (39%), Gaps = 12/257 (4%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++
Sbjct: 2   TSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLE 61

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                + F+ +I    + D  + AN   D RYKE  + F+F   G          Q    
Sbjct: 62  DMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQATQSTAA 115

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLS 657
                D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V       
Sbjct: 116 QQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWP 175

Query: 658 PYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKD 717
              +     K+ +++   I  +   D   V  F+    AM     +      SSP     
Sbjct: 176 STMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH----EMNNPTASSPASIAS 231

Query: 718 PWNNSFDDPQNNVSLQL 734
                       +S+ +
Sbjct: 232 FLLG--GTSSIGISMNI 246



 Score =  200 bits (507), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 52/175 (29%), Positives = 94/175 (53%), Gaps = 5/175 (2%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++
Sbjct: 12  TRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVR 71

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQHKTIIQDY-KQSHQHK 133
           KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    + +I  Y +Q+ + +
Sbjct: 72  KILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKE 131

Query: 134 EEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
                E  +   YF +    + +  ++  D+ LL  V  +F       +    K 
Sbjct: 132 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNADIDKQ 186



 Score =  106 bits (263), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/179 (21%), Positives = 72/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 16  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 75

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 76  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 135

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  M+Q +    +    AD         D I
Sbjct: 136 NEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNADIDKQAKMIADKI 194



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/237 (15%), Positives = 82/237 (34%), Gaps = 42/237 (17%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 16  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 62

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 63  MAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 122

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 123 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 162

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
            +L  +  + G        D  K  +    +I  S + DP  + + +  +R+  +  
Sbjct: 163 ALLTMVQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 217


>gi|306841068|ref|ZP_07473791.1| flagellar basal-body rod protein FLGF [Brucella sp. BO2]
 gi|306288906|gb|EFM60209.1| flagellar basal-body rod protein FLGF [Brucella sp. BO2]
          Length = 262

 Score =  252 bits (643), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 102/262 (38%), Gaps = 12/262 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ +I    + D  + AN   D RYKE  + F+F   G          
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQAT 114

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q         D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V  
Sbjct: 115 QSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
                   +     K+ +++   I  +   D   V  F+    AM     +      SSP
Sbjct: 175 TFGWPSTMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH----EMNNPTTSSP 230

Query: 713 NQNKDPWNNSFDDPQNNVSLQL 734
                            +S+ +
Sbjct: 231 ASIASFLLG--GTSSIGISMNI 250



 Score =  201 bits (512), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 53/190 (27%), Positives = 98/190 (51%), Gaps = 5/190 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +Q+ + +     E  +   YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPS 180

Query: 176 KYISLPFLKD 185
              +    K 
Sbjct: 181 TMSNADIDKQ 190



 Score =  106 bits (263), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/179 (21%), Positives = 72/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  M+Q +    +    AD         D I
Sbjct: 140 NEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNADIDKQAKMIADKI 198



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/237 (15%), Positives = 82/237 (34%), Gaps = 42/237 (17%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 67  MAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 126

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 127 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 166

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
            +L  +  + G        D  K  +    +I  S + DP  + + +  +R+  +  
Sbjct: 167 ALLTMVQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 221


>gi|17989453|ref|NP_542086.1| flagellar basal-body rod protein FLGF [Brucella melitensis bv. 1
           str. 16M]
 gi|148558502|ref|YP_001257193.1| hypothetical protein BOV_A0118 [Brucella ovis ATCC 25840]
 gi|225628602|ref|ZP_03786636.1| flagellar basal-body rod protein FLGF [Brucella ceti str. Cudo]
 gi|225685988|ref|YP_002733960.1| hypothetical protein BMEA_B0130 [Brucella melitensis ATCC 23457]
 gi|254699438|ref|ZP_05161266.1| hypothetical protein Bsuib55_01044 [Brucella suis bv. 5 str. 513]
 gi|254706315|ref|ZP_05168143.1| hypothetical protein BpinM_04810 [Brucella pinnipedialis
           M163/99/10]
 gi|254711393|ref|ZP_05173204.1| hypothetical protein BpinB_14282 [Brucella pinnipedialis B2/94]
 gi|254720630|ref|ZP_05182441.1| hypothetical protein Bru83_14188 [Brucella sp. 83/13]
 gi|256029977|ref|ZP_05443591.1| hypothetical protein BpinM2_04885 [Brucella pinnipedialis
           M292/94/1]
 gi|256043050|ref|ZP_05445995.1| hypothetical protein Bmelb1R_01137 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059630|ref|ZP_05449827.1| hypothetical protein Bneo5_04665 [Brucella neotomae 5K33]
 gi|256111964|ref|ZP_05452915.1| hypothetical protein Bmelb3E_04760 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158142|ref|ZP_05456058.1| hypothetical protein BcetM4_04805 [Brucella ceti M490/95/1]
 gi|256252907|ref|ZP_05458443.1| hypothetical protein BcetB_01052 [Brucella ceti B1/94]
 gi|256262886|ref|ZP_05465418.1| flagellar basal-body rod protein FLGF [Brucella melitensis bv. 2
           str. 63/9]
 gi|260564282|ref|ZP_05834767.1| flagellar basal body rod protein FlgF [Brucella melitensis bv. 1
           str. 16M]
 gi|261219996|ref|ZP_05934277.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313762|ref|ZP_05952959.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318999|ref|ZP_05958196.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261323600|ref|ZP_05962797.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261749889|ref|ZP_05993598.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|265985674|ref|ZP_06098409.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265986998|ref|ZP_06099555.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265989488|ref|ZP_06102045.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993413|ref|ZP_06105970.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996659|ref|ZP_06109216.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294853151|ref|ZP_06793823.1| hypothetical protein BAZG_02096 [Brucella sp. NVSL 07-0026]
 gi|306837354|ref|ZP_07470233.1| flagellar basal-body rod protein FLGF [Brucella sp. NF 2653]
 gi|306846299|ref|ZP_07478860.1| flagellar basal-body rod protein FLGF [Brucella sp. BO1]
 gi|17985332|gb|AAL54350.1| flagellar basal-body rod protein flgf [Brucella melitensis bv. 1
           str. 16M]
 gi|148369787|gb|ABQ62659.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|225616448|gb|EEH13496.1| flagellar basal-body rod protein FLGF [Brucella ceti str. Cudo]
 gi|225642093|gb|ACO02006.1| protein of unknown function DUF1217 [Brucella melitensis ATCC
           23457]
 gi|260151925|gb|EEW87018.1| flagellar basal body rod protein FlgF [Brucella melitensis bv. 1
           str. 16M]
 gi|260918580|gb|EEX85233.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261298222|gb|EEY01719.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261299580|gb|EEY03077.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261302788|gb|EEY06285.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261739642|gb|EEY27568.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|262550956|gb|EEZ07117.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262764283|gb|EEZ10315.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000157|gb|EEZ12847.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263092723|gb|EEZ16932.1| flagellar basal-body rod protein FLGF [Brucella melitensis bv. 2
           str. 63/9]
 gi|264659195|gb|EEZ29456.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264664266|gb|EEZ34527.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|294818806|gb|EFG35806.1| hypothetical protein BAZG_02096 [Brucella sp. NVSL 07-0026]
 gi|306273294|gb|EFM55163.1| flagellar basal-body rod protein FLGF [Brucella sp. BO1]
 gi|306407546|gb|EFM63746.1| flagellar basal-body rod protein FLGF [Brucella sp. NF 2653]
 gi|326410314|gb|ADZ67378.1| flagellar basal-body rod protein FLGF [Brucella melitensis M28]
 gi|326553607|gb|ADZ88246.1| flagellar basal-body rod protein FLGF [Brucella melitensis M5-90]
          Length = 262

 Score =  252 bits (642), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 102/262 (38%), Gaps = 12/262 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ +I    + D  + AN   D RYKE  + F+F   G          
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQAT 114

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q         D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V  
Sbjct: 115 QSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
                   +     K+ +++   I  +   D   V  F+    AM     +      SSP
Sbjct: 175 TFGWPSTMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH----EMNNPTASSP 230

Query: 713 NQNKDPWNNSFDDPQNNVSLQL 734
                            +S+ +
Sbjct: 231 ASIASFLLG--GTSSIGISMNI 250



 Score =  201 bits (511), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 53/190 (27%), Positives = 98/190 (51%), Gaps = 5/190 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +Q+ + +     E  +   YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPS 180

Query: 176 KYISLPFLKD 185
              +    K 
Sbjct: 181 TMSNADIDKQ 190



 Score =  106 bits (263), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/179 (21%), Positives = 72/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  M+Q +    +    AD         D I
Sbjct: 140 NEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNADIDKQAKMIADKI 198



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 36/237 (15%), Positives = 82/237 (34%), Gaps = 42/237 (17%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 67  MAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 126

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 127 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 166

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
            +L  +  + G        D  K  +    +I  S + DP  + + +  +R+  +  
Sbjct: 167 ALLTMVQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 221


>gi|153011531|ref|YP_001372745.1| hypothetical protein Oant_4216 [Ochrobactrum anthropi ATCC 49188]
 gi|151563419|gb|ABS16916.1| protein of unknown function DUF1217 [Ochrobactrum anthropi ATCC
           49188]
          Length = 264

 Score =  251 bits (640), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 55/263 (20%), Positives = 99/263 (37%), Gaps = 12/263 (4%)

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
           R      +     + M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +
Sbjct: 2   RMVDTMTSYRLIASDMARSLQRVSKEPMVERETAYYKENIGKVKSIDDFMADSRLYNYAM 61

Query: 532 ESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           ++ G++     + F+ +I    +    + AN   D RYKE  + F+F   G  + +    
Sbjct: 62  KAFGLEDMAFAKAFVRKILTEGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTAA 121

Query: 592 VQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVS 651
            Q         D Y  Q +E +   ++  + LALYF R  P I N YEILGD  L  ++ 
Sbjct: 122 QQ------GVVDKYLRQTLETEAGSQNEGVRLALYFARKAPTITNAYEILGDKALVSMIQ 175

Query: 652 KKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSS 711
                    +     K+ ++++  I      D   V   +    AM     +      SS
Sbjct: 176 TTFGWPSSISNADVDKQAKMIEDKIDFTKMSDPDYVSKLISRFTAM----YEMNNPTASS 231

Query: 712 PNQNKDPWNNSFDDPQNNVSLQL 734
           P                 +S+ +
Sbjct: 232 PASIASLLLG--GTSSVGISMDI 252



 Score =  197 bits (500), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 97/191 (50%), Gaps = 7/191 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +  +    + D+ ++    VSK+P+V  E  YY+E I  + +ID+F+ D RL++YA+
Sbjct: 3   MVDTMTSYRLIASDM-ARSLQRVSKEPMVERETAYYKENIGKVKSIDDFMADSRLYNYAM 61

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ-SDIQ 118
           KAFGL DM+ A+ F++KIL   ++   ++ N+L   +Y+ FA  +DF+        S   
Sbjct: 62  KAFGLEDMAFAKAFVRKILTEGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTAA 121

Query: 119 HKTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
            + ++  Y +Q+ + +     E  +   YF +    I +  ++  D+ L+  +  +F   
Sbjct: 122 QQGVVDKYLRQTLETEAGSQNEGVRLALYFARKAPTITNAYEILGDKALVSMIQTTFGWP 181

Query: 175 PKYISLPFLKD 185
               +    K 
Sbjct: 182 SSISNADVDKQ 192



 Score =  103 bits (256), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/182 (19%), Positives = 74/182 (40%), Gaps = 7/182 (3%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI K+ S+D    D RL +Y +++F +     +  F++ +LT
Sbjct: 22  QRVSKEPMVERETAYYKENIGKVKSIDDFMADSRLYNYAMKAFGLEDMAFAKAFVRKILT 81

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKIL----TDMQIEKIVSNYFNNT 244
            G+ +      +  D R++  A  F F   G+ +           D  + + +     + 
Sbjct: 82  EGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTAAQQGVVDKYLRQTLETEAGSQ 141

Query: 245 IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND 304
            + V +     Y+     ++++  + L D  L  M+Q +    +    AD         D
Sbjct: 142 NEGVRLAL---YFARKAPTITNAYEILGDKALVSMIQTTFGWPSSISNADVDKQAKMIED 198

Query: 305 PI 306
            I
Sbjct: 199 KI 200



 Score = 91.8 bits (226), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 33/205 (16%), Positives = 72/205 (35%), Gaps = 33/205 (16%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +GK+KSID+ ++                   +A+ A+ L  
Sbjct: 22  QRVSKEPMVERETAYYKENIGKVKSIDDFMADSR-------------LYNYAMKAFGLED 68

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +  D+ ANK  D R  +    F+F   G+         +  +  
Sbjct: 69  MAFAKAFVRKILTEGITSDDAMANKLTDKRYKEFATVFDFAGKGAEATESTAAQQGVVDK 128

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            ++                    + + T+     E      Y+     TI +  E+L +K
Sbjct: 129 YLR--------------------QTLETEAGSQNEGVRLALYFARKAPTITNAYEILGDK 168

Query: 525 RILNFLLESKGIDSQKVREDFLCEI 549
            +++ +  + G  S     D   + 
Sbjct: 169 ALVSMIQTTFGWPSSISNADVDKQA 193


>gi|83269072|ref|YP_418363.1| flagellar basal-body rod protein FlgF [Brucella melitensis biovar
           Abortus 2308]
 gi|82939346|emb|CAJ12293.1| flagellar basal-body rod protein FlgF [Brucella melitensis biovar
           Abortus 2308]
          Length = 258

 Score =  250 bits (639), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 56/257 (21%), Positives = 102/257 (39%), Gaps = 12/257 (4%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++
Sbjct: 2   TSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLE 61

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                + F+ +I    + D  + AN   D RYKE  + F+F   G          Q    
Sbjct: 62  DMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQATQSTAA 115

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLS 657
                D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  ++       
Sbjct: 116 QQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWP 175

Query: 658 PYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKD 717
              +     K+ +++   I  +   D   V  F+    AM     +      SSP     
Sbjct: 176 STMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH----EMNNPTASSPASIAS 231

Query: 718 PWNNSFDDPQNNVSLQL 734
                       +S+ +
Sbjct: 232 FLLG--GTSSIGISMNI 246



 Score =  198 bits (502), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 51/175 (29%), Positives = 94/175 (53%), Gaps = 5/175 (2%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++
Sbjct: 12  TRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVR 71

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQHKTIIQDY-KQSHQHK 133
           KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    + +I  Y +Q+ + +
Sbjct: 72  KILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKE 131

Query: 134 EEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
                E  +   YF +    + +  ++  D+ LL  +  +F       +    K 
Sbjct: 132 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNADIDKQ 186



 Score =  106 bits (263), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 72/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 16  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 75

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 76  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 135

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  MLQ +    +    AD         D I
Sbjct: 136 NEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNADIDKQAKMIADKI 194



 Score = 91.1 bits (224), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 82/237 (34%), Gaps = 42/237 (17%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 16  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 62

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 63  MAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 122

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 123 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 162

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
            +L  L  + G        D  K  +    +I  S + DP  + + +  +R+  +  
Sbjct: 163 ALLTMLQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 217


>gi|62317079|ref|YP_222932.1| hypothetical protein BruAb2_0125 [Brucella abortus bv. 1 str.
           9-941]
 gi|189022346|ref|YP_001932087.1| Flagellar basal-body rod protein FLGF [Brucella abortus S19]
 gi|237816641|ref|ZP_04595633.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254691432|ref|ZP_05154686.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 6 str.
           870]
 gi|254695269|ref|ZP_05157097.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698368|ref|ZP_05160196.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254731813|ref|ZP_05190391.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 4 str.
           292]
 gi|256256618|ref|ZP_05462154.1| Flagellar basal-body rod protein FLGF [Brucella abortus bv. 9 str.
           C68]
 gi|260544320|ref|ZP_05820141.1| flagellar basal-body rod protein FLGF [Brucella abortus NCTC 8038]
 gi|260757050|ref|ZP_05869398.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759579|ref|ZP_05871927.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762823|ref|ZP_05875155.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882860|ref|ZP_05894474.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261215635|ref|ZP_05929916.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297249975|ref|ZP_06933676.1| hypothetical protein BAYG_02750 [Brucella abortus bv. 5 str. B3196]
 gi|62197272|gb|AAX75571.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|189020920|gb|ACD73641.1| Flagellar basal-body rod protein FLGF [Brucella abortus S19]
 gi|237787454|gb|EEP61670.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260097591|gb|EEW81465.1| flagellar basal-body rod protein FLGF [Brucella abortus NCTC 8038]
 gi|260669897|gb|EEX56837.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673244|gb|EEX60065.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260677158|gb|EEX63979.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260872388|gb|EEX79457.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260917242|gb|EEX84103.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297173844|gb|EFH33208.1| hypothetical protein BAYG_02750 [Brucella abortus bv. 5 str. B3196]
          Length = 262

 Score =  250 bits (638), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 56/262 (21%), Positives = 102/262 (38%), Gaps = 12/262 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ +I    + D  + AN   D RYKE  + F+F   G          
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQAT 114

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q         D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  ++  
Sbjct: 115 QSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
                   +     K+ +++   I  +   D   V  F+    AM     +      SSP
Sbjct: 175 TFGWPSTMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH----EMNNPTASSP 230

Query: 713 NQNKDPWNNSFDDPQNNVSLQL 734
                            +S+ +
Sbjct: 231 ASIASFLLG--GTSSIGISMNI 250



 Score =  200 bits (507), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 52/190 (27%), Positives = 98/190 (51%), Gaps = 5/190 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +Q+ + +     E  +   YF +    + +  ++  D+ LL  +  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPS 180

Query: 176 KYISLPFLKD 185
              +    K 
Sbjct: 181 TMSNADIDKQ 190



 Score =  105 bits (262), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 72/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  MLQ +    +    AD         D I
Sbjct: 140 NEGVRLALYFERKAPSLTNAYEILGDKALLTMLQTTFGWPSTMSNADIDKQAKMIADKI 198



 Score = 90.7 bits (223), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 37/237 (15%), Positives = 82/237 (34%), Gaps = 42/237 (17%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 67  MAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 126

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 127 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 166

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
            +L  L  + G        D  K  +    +I  S + DP  + + +  +R+  +  
Sbjct: 167 ALLTMLQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 221


>gi|218461856|ref|ZP_03501947.1| hypothetical protein RetlK5_21288 [Rhizobium etli Kim 5]
          Length = 256

 Score =  249 bits (635), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 87/237 (36%), Positives = 143/237 (60%), Gaps = 4/237 (1%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  ++++D+F+ D +L+SYA+
Sbjct: 23  MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAM 81

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 82  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNAPEKDVQTDAQE 141

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             +I  YKQS    ++ +  ES Y+  NI  + +VD L  + RL  YVL++F I P Y S
Sbjct: 142 DELIGLYKQSFVDADKASAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLKTFKIDPTYAS 201

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKI 236
             FL+ VLT  L++P         ++++A+A  F F  DG+++      T  Q   +
Sbjct: 202 KDFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASV 256



 Score =  147 bits (370), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 58/252 (23%), Positives = 107/252 (42%), Gaps = 38/252 (15%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++     ++   + Y   + K+ S+D+ L                    +A+ AY L  
Sbjct: 42  NKVASQATVKKDAQYYADHINKVTSVDDFLGDY-------------KLYSYAMKAYGLED 88

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  ++ VL S+ +DP+SYANK  D R  +   AFNFNA     P   +Q+     +
Sbjct: 89  MTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNA-----PEKDVQTDAQEDE 143

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            +  Y                      +    +    +E  YY+ NI+++ + ++L+ N 
Sbjct: 144 LIGLYK--------------------QSFVDADKASAAESTYYSNNIDSVQTVDDLVNNT 183

Query: 525 RILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGEL 584
           R+  ++L++  ID     +DFL ++  SDL DP S  NT   ++YK + + F+F+  G +
Sbjct: 184 RLRTYVLKTFKIDPTYASKDFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTV 243

Query: 585 SHKKIGKVQDNF 596
           +       Q   
Sbjct: 244 TGTAQTAAQKAS 255



 Score =  111 bits (278), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 48/245 (19%), Positives = 97/245 (39%), Gaps = 19/245 (7%)

Query: 106 FSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALE---ESKYFRKNIHKINSVDQLFKDRR 162
           F+    ++ +     +I+     S  +K         +++Y+  +I+K+ SVD    D +
Sbjct: 16  FAKRALLMITASLAYSILSKDMTSSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYK 75

Query: 163 LLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLS 222
           L  Y ++++ +     +  F+K VL   L +P  Y  +  D R+R  A  F F       
Sbjct: 76  LYSYAMKAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNAPEK-- 133

Query: 223 KRDKILTDMQIEKIVSNYFNNTIDCV-PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQ 281
               + TD Q ++++  Y  + +D      ++  YY   I+SV +  D + + +L   + 
Sbjct: 134 ---DVQTDAQEDELIGLYKQSFVDADKASAAESTYYSNNIDSVQTVDDLVNNTRLRTYVL 190

Query: 282 LSL---------FPLNPEITADKFLTLMQENDPIVSQVK-YFFQINFHRDNSSSTKIQQD 331
            +            L   +T+D        N     + K    Q +F+ D + +   Q  
Sbjct: 191 KTFKIDPTYASKDFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTVTGTAQTA 250

Query: 332 SQIQK 336
           +Q   
Sbjct: 251 AQKAS 255



 Score =  108 bits (268), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 44/215 (20%), Positives = 94/215 (43%), Gaps = 18/215 (8%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             +   A +     M     +      +  +  YY  +IN + S ++ L + ++ ++ ++
Sbjct: 23  MITASLAYSILSKDMTSSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMK 82

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +SDL DP S+AN   D RY+E  ++FNF+            V
Sbjct: 83  AYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNA-------PEKDV 135

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q +   D+   LYK Q      +    + A + Y+   I +++   +++ +++L   V K
Sbjct: 136 QTDAQEDELIGLYK-QSF---VDADKASAAESTYYSNNIDSVQTVDDLVNNTRLRTYVLK 191

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKV 687
             K+ P +A     +++         +D  D   V
Sbjct: 192 TFKIDPTYASKDFLRQVLT-------SDLSDPASV 219



 Score = 91.4 bits (225), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 46/231 (19%), Positives = 83/231 (35%), Gaps = 27/231 (11%)

Query: 239 NYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEI------- 291
           +  N       +  D  YY   IN V+S  DFL D KL+     +    +          
Sbjct: 39  SSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMKAYGLEDMTYAKAFMKK 98

Query: 292 ---TADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQIL 348
              +                  ++    NF+        +Q D+Q  +++ LYK++    
Sbjct: 99  VLESDLTDPNSYANKLSDARYREFAAAFNFNAPEKD---VQTDAQEDELIGLYKQSFVDA 155

Query: 349 HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
                      Y   +  ++++D+L++                   + L  + ++     
Sbjct: 156 DKASAAEST-YYSNNIDSVQTVDDLVNNTR-------------LRTYVLKTFKIDPTYAS 201

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           +D LR VLTS+ SDP S  N    D+   L   F+FNADG++       ++
Sbjct: 202 KDFLRQVLTSDLSDPASVVNTQGGDKYKALAAQFSFNADGTVTGTAQTAAQ 252


>gi|254711992|ref|ZP_05173803.1| hypothetical protein BcetM6_01082 [Brucella ceti M644/93/1]
 gi|254715062|ref|ZP_05176873.1| hypothetical protein BcetM_01092 [Brucella ceti M13/05/1]
 gi|261216769|ref|ZP_05931050.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261319636|ref|ZP_05958833.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260921858|gb|EEX88426.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292326|gb|EEX95822.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 262

 Score =  248 bits (634), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 102/262 (38%), Gaps = 12/262 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ +I    + D  + AN   D RYKE  + F+F   G          
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQAT 114

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q         D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V  
Sbjct: 115 QSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
                   +     K+ +++   I  +   D   V  F+    AM     +      SSP
Sbjct: 175 TFGWPSTMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRITAMH----EMNNPTASSP 230

Query: 713 NQNKDPWNNSFDDPQNNVSLQL 734
                            +S+ +
Sbjct: 231 ASIASFLLG--GTSSIGISMNI 250



 Score =  202 bits (513), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 53/190 (27%), Positives = 98/190 (51%), Gaps = 5/190 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +Q+ + +     E  +   YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPS 180

Query: 176 KYISLPFLKD 185
              +    K 
Sbjct: 181 TMSNADIDKQ 190



 Score =  106 bits (263), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/179 (21%), Positives = 72/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  M+Q +    +    AD         D I
Sbjct: 140 NEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWPSTMSNADIDKQAKMIADKI 198



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 75/221 (33%), Gaps = 40/221 (18%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 67  MAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 126

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 127 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 166

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPK 558
            +L  +  + G        D  K  +    +I  S + DP 
Sbjct: 167 ALLTMVQTTFGWPSTMSNADIDKQAKMIADKIDFSKMSDPD 207


>gi|126730141|ref|ZP_01745953.1| flagellar protein, putative [Sagittula stellata E-37]
 gi|126709521|gb|EBA08575.1| flagellar protein, putative [Sagittula stellata E-37]
          Length = 397

 Score =  247 bits (631), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 68/390 (17%), Positives = 142/390 (36%), Gaps = 34/390 (8%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
                +    + ++  +G + S D+L++ +               L  AL A+ L+ Q  
Sbjct: 25  NASAYLARDTEYFKEKIGGVTSGDDLVNDRR-------------LLSVALAAFGLSDQID 71

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
               ++ VL     + D+ ANK KD R + L  AF+F    +        +   +    K
Sbjct: 72  SAYLIKRVLNEGAENDDALANKLKDGRYVALARAFSFEETTNFPFQEEGFAGDILASYDK 131

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
              +    + +    + N +   + +  +   + +   Y+   I ++ S ++L+ +  +L
Sbjct: 132 RIRSDLADLLEEPEYANNPIAAETLEATVLDGLETTKTYFRETIGSVTSVDDLMKDNDLL 191

Query: 528 NFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK 587
              L + G++ +   +  L  +F+    +P + AN   D     +  +F FD       +
Sbjct: 192 KVALTAFGVEERTNSKTLLKRVFEEGATNPGALANVLGDKGLIAMTKAFGFD------TE 245

Query: 588 KIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNHYE 639
               ++     D   D Y+ Q  E    E +P I  AL F+R  P +           + 
Sbjct: 246 PTTAIRTEEFADKIIDNYQWQAFEDAVNEVNPTIGTALSFQRGAPALAGLSGSENTKWFN 305

Query: 640 ILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLY 692
           +LGDS + +V    L L   F+ +   K++ ++K+         +  D +D       +Y
Sbjct: 306 VLGDSTMREVFQTALGLPSSFSQIDIDKQVEMMKEKAASRFGITQFKDLEDEAIRNKVIY 365

Query: 693 AAKAMDHQSIDYKKALFSSPNQNKDPWNNS 722
           +       + +                 N 
Sbjct: 366 SYLLQSDVAANAGFGSQQIALTLLSSIQNQ 395



 Score =  189 bits (480), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 69/315 (21%), Positives = 123/315 (39%), Gaps = 34/315 (10%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           SK  +  +    ++ +  Y++E+I  +++ D+ + D+RL S AL AFGLSD   +   IK
Sbjct: 18  SKQRTAFNASAYLARDTEYFKEKIGGVTSGDDLVNDRRLLSVALAAFGLSDQIDSAYLIK 77

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQHKTIIQDYKQSHQHKE 134
           ++L     +  +L N+L   +Y   AR++ F        Q +     I+  Y +  +   
Sbjct: 78  RVLNEGAENDDALANKLKDGRYVALARAFSFEETTNFPFQEEGFAGDILASYDKRIRSDL 137

Query: 135 EVALEE------------------------SKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
              LEE                          YFR+ I  + SVD L KD  LL   L +
Sbjct: 138 ADLLEEPEYANNPIAAETLEATVLDGLETTKTYFRETIGSVTSVDDLMKDNDLLKVALTA 197

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           F +  +  S   LK V   G  NP        D    AM + F F  + + + R +   D
Sbjct: 198 FGVEERTNSKTLLKRVFEEGATNPGALANVLGDKGLIAMTKAFGFDTEPTTAIRTEEFAD 257

Query: 231 MQIEKIV-SNYFNNTIDCVPIVSDQNYYKLAINSV--------SSFSDFLKDPKLFKMLQ 281
             I+      + +   +  P +     ++    ++        + + + L D  + ++ Q
Sbjct: 258 KIIDNYQWQAFEDAVNEVNPTIGTALSFQRGAPALAGLSGSENTKWFNVLGDSTMREVFQ 317

Query: 282 LSLFPLNPEITADKF 296
            +L   +     D  
Sbjct: 318 TALGLPSSFSQIDID 332



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/326 (14%), Positives = 100/326 (30%), Gaps = 44/326 (13%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +++  +       +++YF++ I  + S D L  DRRLL   L +F ++ +  S   +K V
Sbjct: 20  QRTAFNASAYLARDTEYFKEKIGGVTSGDDLVNDRRLLSVALAAFGLSDQIDSAYLIKRV 79

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM--------------- 231
           L  G  N      + +D R+ A+A  F F+   +   +++                    
Sbjct: 80  LNEGAENDDALANKLKDGRYVALARAFSFEETTNFPFQEEGFAGDILASYDKRIRSDLAD 139

Query: 232 ------QIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
                      ++           + + + Y++  I SV+S  D +KD  L K+   +  
Sbjct: 140 LLEEPEYANNPIAAETLEATVLDGLETTKTYFRETIGSVTSVDDLMKDNDLLKVALTAFG 199

Query: 286 PLNPEITADKFLTLMQENDPIVSQVKY----------FFQINFHRDNSSSTKIQQDSQIQ 335
                 +      + +E       +                 F  + +  T I+ +    
Sbjct: 200 VEERTNSKTLLKRVFEEGATNPGALANVLGDKGLIAMTKAFGFDTEPT--TAIRTEEFAD 257

Query: 336 KMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSID----NLLSGKCQLEGPNSAEEPII 391
           K++D Y            +  + +    +G   S       L                  
Sbjct: 258 KIIDNY-------QWQAFEDAVNEVNPTIGTALSFQRGAPALAGLSGSENTKWFNVLGDS 310

Query: 392 TLQFALDAYNLNMQDLDRDQLRNVLT 417
           T++              +  +   + 
Sbjct: 311 TMREVFQTALGLPSSFSQIDIDKQVE 336


>gi|163844322|ref|YP_001621977.1| hypothetical protein BSUIS_B0133 [Brucella suis ATCC 23445]
 gi|163675045|gb|ABY39155.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 262

 Score =  246 bits (628), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 102/262 (38%), Gaps = 12/262 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ +I    + D  + AN   D RYKE  + F+F   G          
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQAT 114

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q         D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V  
Sbjct: 115 QSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
                   +     K+ +++   I  +   D   V  F+    AM     +      SSP
Sbjct: 175 TFGWLSTMSNADIDKQAKMIADKIDFSKMSDPDYVSKFISRFTAMH----EMNNPTASSP 230

Query: 713 NQNKDPWNNSFDDPQNNVSLQL 734
                            +S+ +
Sbjct: 231 ASIASFLLG--GTSSIGISMNI 250



 Score =  199 bits (505), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/190 (27%), Positives = 98/190 (51%), Gaps = 5/190 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +Q+ + +     E  +   YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLS 180

Query: 176 KYISLPFLKD 185
              +    K 
Sbjct: 181 TMSNADIDKQ 190



 Score =  105 bits (261), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 73/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  M+Q +   L+    AD         D I
Sbjct: 140 NEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNADIDKQAKMIADKI 198



 Score = 91.8 bits (226), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 36/237 (15%), Positives = 82/237 (34%), Gaps = 42/237 (17%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 67  MAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 126

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 127 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 166

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIIS 574
            +L  +  + G        D  K  +    +I  S + DP  + + +  +R+  +  
Sbjct: 167 ALLTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPD-YVSKFI-SRFTAMHE 221


>gi|23499890|ref|NP_699330.1| hypothetical protein BRA0127 [Brucella suis 1330]
 gi|23463465|gb|AAN33335.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 258

 Score =  246 bits (627), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 102/257 (39%), Gaps = 12/257 (4%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ +++ G++
Sbjct: 2   TSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLE 61

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                + F+ +I    + D  + AN   D RYKE  + F+F   G          Q    
Sbjct: 62  DMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQATQSTAA 115

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLS 657
                D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V       
Sbjct: 116 QQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWL 175

Query: 658 PYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKD 717
              +     K+ +++   I  +   D   V  F+    AM     +      SSP     
Sbjct: 176 STMSNADIDKQAKMIADKIDFSKMSDPDYVLKFISRFTAMH----EMNNPTASSPASIAS 231

Query: 718 PWNNSFDDPQNNVSLQL 734
                       +S+ +
Sbjct: 232 FLLG--GTSSIGISMNI 246



 Score =  198 bits (503), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 55/221 (24%), Positives = 104/221 (47%), Gaps = 7/221 (3%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
           ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+KAFGL DM++A+ F++
Sbjct: 12  TRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVR 71

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQHKTIIQDY-KQSHQHK 133
           KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    + +I  Y +Q+ + +
Sbjct: 72  KILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKE 131

Query: 134 EEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
                E  +   YF +    + +  ++  D+ LL  V  +F       +    K      
Sbjct: 132 AGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNADIDKQAKM-- 189

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
           +A+   +   S  +        F    + +        +  
Sbjct: 190 IADKIDFSKMSDPDYVLKFISRFTAMHEMNNPTASSPASIA 230



 Score =  105 bits (262), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 73/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 16  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 75

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 76  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 135

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  M+Q +   L+    AD         D I
Sbjct: 136 NEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNADIDKQAKMIADKI 194



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 75/221 (33%), Gaps = 40/221 (18%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 16  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 62

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 63  MAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 122

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 123 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 162

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPK 558
            +L  +  + G        D  K  +    +I  S + DP 
Sbjct: 163 ALLTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPD 203


>gi|161620213|ref|YP_001594099.1| hypothetical protein BCAN_B0131 [Brucella canis ATCC 23365]
 gi|254702555|ref|ZP_05164383.1| hypothetical protein Bsuib36_01112 [Brucella suis bv. 3 str. 686]
 gi|261753133|ref|ZP_05996842.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161337024|gb|ABX63328.1| protein of unknown function DUF1217 [Brucella canis ATCC 23365]
 gi|261742886|gb|EEY30812.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 262

 Score =  245 bits (626), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 102/262 (38%), Gaps = 12/262 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ +I    + D  + AN   D RYKE  + F+F   G          
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQAT 114

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q         D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V  
Sbjct: 115 QSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
                   +     K+ +++   I  +   D   V  F+    AM     +      SSP
Sbjct: 175 TFGWLSTMSNADIDKQAKMIADKIDFSKMSDPDYVLKFISRFTAMH----EMNNPTASSP 230

Query: 713 NQNKDPWNNSFDDPQNNVSLQL 734
                            +S+ +
Sbjct: 231 ASIASFLLG--GTSSIGISMNI 250



 Score =  200 bits (508), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 108/236 (45%), Gaps = 7/236 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQH 119
           AFGL DM++A+ F++KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    
Sbjct: 61  AFGLEDMAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +Q+ + +     E  +   YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLS 180

Query: 176 KYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
              +    K      +A+   +   S  +        F    + +        +  
Sbjct: 181 TMSNADIDKQAKM--IADKIDFSKMSDPDYVLKFISRFTAMHEMNNPTASSPASIA 234



 Score =  105 bits (262), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 73/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F++ +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFVRKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  M+Q +   L+    AD         D I
Sbjct: 140 NEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNADIDKQAKMIADKI 198



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 75/221 (33%), Gaps = 40/221 (18%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  +R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 67  MAYAKAFVRKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 126

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 127 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 166

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPK 558
            +L  +  + G        D  K  +    +I  S + DP 
Sbjct: 167 ALLTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPD 207


>gi|110632663|ref|YP_672871.1| hypothetical protein Meso_0302 [Mesorhizobium sp. BNC1]
 gi|110283647|gb|ABG61706.1| protein of unknown function DUF1217 [Chelativorans sp. BNC1]
          Length = 258

 Score =  245 bits (624), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 56/251 (22%), Positives = 109/251 (43%), Gaps = 14/251 (5%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +       +E+   +      ++ E  YY  NI  + S EE +A+ R+  + +++ G++
Sbjct: 6   TSYQLIVRDIERSIDRVEQQPMVSRETAYYQENIGKVKSIEEFVADDRLFRYAMKAHGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                +  + +  +  + D  SF N   D RYK+ + +FNF  +GE +         +  
Sbjct: 66  DMAYAKALMVKALEGGIDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTT------FHSS 119

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLS 657
              T + Y  Q +E+    ++  + LALYF+R   +++++YEIL D  L +VV   L   
Sbjct: 120 TTGTVEKYLRQTLEEDAGNQNEGVRLALYFQRKAGSLKSYYEILADPALSQVVRTALGFP 179

Query: 658 PYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKD 717
              A     K+  ++K+ + + +  D +K+E+FL     +     +     FS     + 
Sbjct: 180 DALAQADIDKQAEMIKERLDLEELNDPEKLEEFLQRFTTL----WEIDNPSFSP----QS 231

Query: 718 PWNNSFDDPQN 728
                F  P  
Sbjct: 232 SIAALFSQPAE 242



 Score =  196 bits (498), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 50/191 (26%), Positives = 90/191 (47%), Gaps = 7/191 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI ++ +     +DI+  +   V + P+VS E  YY+E I  + +I+EF+ D RLF YA+
Sbjct: 1   MINTYTSYQLIVRDIERSI-DRVEQQPMVSRETAYYQENIGKVKSIEEFVADDRLFRYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS--DI 117
           KA GL DM++A+  + K LE  + D  S VN+L   +Y+ F  +++F+   +   +    
Sbjct: 60  KAHGLEDMAYAKALMVKALEGGIDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTTFHSS 119

Query: 118 QHKTIIQDYKQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
              T+ +  +Q+ +       E  +   YF++    + S  ++  D  L   V  +    
Sbjct: 120 TTGTVEKYLRQTLEEDAGNQNEGVRLALYFQRKAGSLKSYYEILADPALSQVVRTALGFP 179

Query: 175 PKYISLPFLKD 185
                    K 
Sbjct: 180 DALAQADIDKQ 190



 Score =  101 bits (250), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/173 (16%), Positives = 71/173 (41%), Gaps = 7/173 (4%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
             ++ +   E+ Y+++NI K+ S+++   D RL  Y +++  +     +   +   L  G
Sbjct: 22  VEQQPMVSRETAYYQENIGKVKSIEEFVADDRLFRYAMKAHGLEDMAYAKALMVKALEGG 81

Query: 191 LANPKKYFIESRDNRFRAMAENFRF----QPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
           + +   +  +  D R++   + F F    +   +         +  + + +     N  +
Sbjct: 82  IDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTTFHSSTTGTVEKYLRQTLEEDAGNQNE 141

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
            V +     Y++    S+ S+ + L DP L ++++ +L   +    AD     
Sbjct: 142 GVRLAL---YFQRKAGSLKSYYEILADPALSQVVRTALGFPDALAQADIDKQA 191



 Score = 84.5 bits (207), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/204 (15%), Positives = 63/204 (30%), Gaps = 33/204 (16%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
           ++     +      YQ  +GK+KSI+  ++                  ++A+ A+ L   
Sbjct: 21  RVEQQPMVSRETAYYQENIGKVKSIEEFVADDR-------------LFRYAMKAHGLEDM 67

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +   L     D DS+ NK  D R       FNF   G         +  T+   
Sbjct: 68  AYAKALMVKALEGGIDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTTFHSSTTGTVEKY 127

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
           ++                    + +        E      Y+     ++ S+ E+LA+  
Sbjct: 128 LR--------------------QTLEEDAGNQNEGVRLALYFQRKAGSLKSYYEILADPA 167

Query: 526 ILNFLLESKGIDSQKVREDFLCEI 549
           +   +  + G      + D   + 
Sbjct: 168 LSQVVRTALGFPDALAQADIDKQA 191



 Score = 41.4 bits (95), Expect = 0.65,   Method: Composition-based stats.
 Identities = 34/255 (13%), Positives = 76/255 (29%), Gaps = 27/255 (10%)

Query: 237 VSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
           +    +       +  +  YY+  I  V S  +F+ D +LF+    +    +        
Sbjct: 15  IERSIDRVEQQPMVSRETAYYQENIGKVKSIEEFVADDRLFRYAMKAHGLEDMAYAKALM 74

Query: 297 LTLMQENDPIVS----------QVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQ 346
           +  ++                    +    NF R    +T     +     ++ Y +   
Sbjct: 75  VKALEGGIDDEDSFVNKLTDKRYKDFVDTFNFARYGEKTTTFHSST--TGTVEKYLRQTL 132

Query: 347 ILHDDKMQSLIK---DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
                     ++    +Q   G +KS   +L+     +   +A         AL   +++
Sbjct: 133 EEDAGNQNEGVRLALYFQRKAGSLKSYYEILADPALSQVVRTALGFPD----ALAQADID 188

Query: 404 MQDLDRDQLRNVLT-SNPSDPDSYANKSKDDRLIKLNHAFN--FNADGSIGPIPMMQSRL 460
            Q    + ++  L     +DP+         R   L    N  F+   SI  +    +  
Sbjct: 189 KQA---EMIKERLDLEELNDPEKLEEFL--QRFTTLWEIDNPSFSPQSSIAALFSQPAEF 243

Query: 461 TIRDNVKHYANRKRS 475
            I  ++     + R 
Sbjct: 244 GISTDILLTIAQMRK 258


>gi|260568537|ref|ZP_05839006.1| flagellar basal-body rod protein FlgF [Brucella suis bv. 4 str. 40]
 gi|260155202|gb|EEW90283.1| flagellar basal-body rod protein FlgF [Brucella suis bv. 4 str. 40]
          Length = 262

 Score =  244 bits (622), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 101/262 (38%), Gaps = 12/262 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +     ++M +   +      +  E  YY  NI  + S ++ +A+ R+ N+ ++
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F  +I    + D  + AN   D RYKE  + F+F   G          
Sbjct: 61  AFGLEDMAYAKAFARKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKG------AQAT 114

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q         D Y  Q +EK+   ++  + LALYF+R  P++ N YEILGD  L  +V  
Sbjct: 115 QSTAAQQGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
                   +     K+ +++   I  +   D   V  F+    AM     +      SSP
Sbjct: 175 TFGWLSTMSNADIDKQAKMIADKIDFSKMSDPDYVLKFISRFTAMH----EMNNPTASSP 230

Query: 713 NQNKDPWNNSFDDPQNNVSLQL 734
                            +S+ +
Sbjct: 231 ASIASFLLG--GTSSIGISMNI 250



 Score =  198 bits (503), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 56/236 (23%), Positives = 107/236 (45%), Gaps = 7/236 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++    VSK+P+V  E  YY+E I ++ ++D+F+ D RLF+YA+K
Sbjct: 1   MVDTMTSYRLIASNMTRSLQRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQH 119
           AFGL DM++A+ F +KIL   ++D  ++ N+L   +Y+ FA  +DF+       QS    
Sbjct: 61  AFGLEDMAYAKAFARKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQ 120

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + +I  Y +Q+ + +     E  +   YF +    + +  ++  D+ LL  V  +F    
Sbjct: 121 QGVIDKYVRQTLEKEAGSQNEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLS 180

Query: 176 KYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
              +    K      +A+   +   S  +        F    + +        +  
Sbjct: 181 TMSNADIDKQAKM--IADKIDFSKMSDPDYVLKFISRFTAMHEMNNPTASSPASIA 234



 Score =  104 bits (259), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 40/179 (22%), Positives = 72/179 (40%), Gaps = 1/179 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
               KE +   E+ Y+++NI  + SVD    D RL +Y +++F +     +  F + +LT
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTRLFNYAMKAFGLEDMAYAKAFARKILT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN-NTIDC 247
            G+ +      +  D R++  A  F F   G+ + +        I+K V           
Sbjct: 80  EGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDKYVRQTLEKEAGSQ 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              V    Y++    S+++  + L D  L  M+Q +   L+    AD         D I
Sbjct: 140 NEGVRLALYFERKAPSLTNAYEILGDKALLTMVQTTFGWLSTMSNADIDKQAKMIADKI 198



 Score = 90.7 bits (223), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 74/221 (33%), Gaps = 40/221 (18%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++  +  ++     Y+  +G +KS+D+ ++                   +A+ A+ L  
Sbjct: 20  QRVSKEPLVERETAYYKENIGNVKSVDDFMADTR-------------LFNYAMKAFGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +   R +LT   +D D+ ANK  D R  +    F+F   G+         +  I  
Sbjct: 67  MAYAKAFARKILTEGVTDEDAMANKLTDKRYKEFATVFDFAGKGAQATQSTAAQQGVIDK 126

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            V+    ++    +                           Y+     ++ +  E+L +K
Sbjct: 127 YVRQTLEKEAGSQNEGV--------------------RLALYFERKAPSLTNAYEILGDK 166

Query: 525 RILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPK 558
            +L  +  + G        D  K  +    +I  S + DP 
Sbjct: 167 ALLTMVQTTFGWLSTMSNADIDKQAKMIADKIDFSKMSDPD 207


>gi|118589944|ref|ZP_01547348.1| flagellar basal-body rod protein flgf [Stappia aggregata IAM 12614]
 gi|118437441|gb|EAV44078.1| flagellar basal-body rod protein flgf [Stappia aggregata IAM 12614]
          Length = 262

 Score =  238 bits (607), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 60/260 (23%), Positives = 109/260 (41%), Gaps = 14/260 (5%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             +          +ME+       +  +  + +YY  NI  I + +E L + RI N+ + 
Sbjct: 1   MINTLSQVQLVRTNMERSLKTVAADPMVERQTEYYRENIRDIKTIDEFLGDDRIFNYAMT 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +    D  +FAN   D +YK    +FNF  +GE +       
Sbjct: 61  AMGLEDMIYAKAFIRKVLEEGTDDRGAFANQLADTKYKNFAETFNFKRYGETTTSFA--- 117

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
                 +     Y  Q +E +E E++  + LALYF+R  P+I N Y++L D  L + V  
Sbjct: 118 ---RTQEAIVQKYHRQTLEVREGEQNQGVRLALYFERRAPDITNAYDVLADRALAEAVYT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            L L   FA+    K+   L++ +  + F D+  +  FL    A+     D        P
Sbjct: 175 SLGLPQEFAMTDIDKQAAYLEERLDFSKFGDADYLAKFLNRFSAL----YDLSNG----P 226

Query: 713 NQNKDPWNNSFDDPQNNVSL 732
             +  P    F +    + +
Sbjct: 227 TGSMSPTLALFGNGPGVIQM 246



 Score =  189 bits (479), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 54/174 (31%), Positives = 90/174 (51%), Gaps = 5/174 (2%)

Query: 17  KLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKK 76
           +   TV+ DP+V  +  YYRE I+ I TIDEF+ D R+F+YA+ A GL DM +A+ FI+K
Sbjct: 17  RSLKTVAADPMVERQTEYYRENIRDIKTIDEFLGDDRIFNYAMTAMGLEDMIYAKAFIRK 76

Query: 77  ILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTII--QDYKQSHQHKE 134
           +LE    D  +  NQL   KY+ FA +++F    +   S  + +  I  + ++Q+ + +E
Sbjct: 77  VLEEGTDDRGAFANQLADTKYKNFAETFNFKRYGETTTSFARTQEAIVQKYHRQTLEVRE 136

Query: 135 EVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
               +  +   YF +    I +   +  DR L + V  S  +  ++      K 
Sbjct: 137 GEQNQGVRLALYFERRAPDITNAYDVLADRALAEAVYTSLGLPQEFAMTDIDKQ 190



 Score = 99.1 bits (245), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/189 (16%), Positives = 74/189 (39%), Gaps = 3/189 (1%)

Query: 115 SDIQHKTIIQDYKQSHQHKEEVALEE--SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFS 172
           +  Q + +  + ++S +      + E  ++Y+R+NI  I ++D+   D R+ +Y + +  
Sbjct: 4   TLSQVQLVRTNMERSLKTVAADPMVERQTEYYRENIRDIKTIDEFLGDDRIFNYAMTAMG 63

Query: 173 ITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQ 232
           +     +  F++ VL  G  +   +  +  D +++  AE F F+  G  +       +  
Sbjct: 64  LEDMIYAKAFIRKVLEEGTDDRGAFANQLADTKYKNFAETFNFKRYGETTTSFARTQEAI 123

Query: 233 IEKIVSNYFN-NTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEI 291
           ++K           +    V    Y++     +++  D L D  L + +  SL       
Sbjct: 124 VQKYHRQTLEVREGEQNQGVRLALYFERRAPDITNAYDVLADRALAEAVYTSLGLPQEFA 183

Query: 292 TADKFLTLM 300
             D      
Sbjct: 184 MTDIDKQAA 192



 Score = 84.9 bits (208), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 31/228 (13%), Positives = 66/228 (28%), Gaps = 40/228 (17%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
            +  D  ++   + Y+  +  IK+ID  L                    +A+ A  L   
Sbjct: 21  TVAADPMVERQTEYYRENIRDIKTIDEFLGDDR-------------IFNYAMTAMGLEDM 67

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +R VL     D  ++AN+  D +       FNF   G             ++  
Sbjct: 68  IYAKAFIRKVLEEGTDDRGAFANQLADTKYKNFAETFNFKRYGETTTSFARTQEAIVQKY 127

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
                                 + +  ++    +      Y+      I +  ++LA++ 
Sbjct: 128 --------------------HRQTLEVREGEQNQGVRLALYFERRAPDITNAYDVLADRA 167

Query: 526 ILNFLLESKGIDSQKVREDFLCEI--FKSDLKDPKSFANTYKDNRYKE 571
           +   +  S G+  +    D   +    +  L         + D  Y  
Sbjct: 168 LAEAVYTSLGLPQEFAMTDIDKQAAYLEERLDFS-----KFGDADYLA 210


>gi|170744539|ref|YP_001773194.1| hypothetical protein M446_6502 [Methylobacterium sp. 4-46]
 gi|168198813|gb|ACA20760.1| protein of unknown function DUF1217 [Methylobacterium sp. 4-46]
          Length = 429

 Score =  237 bits (603), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 80/448 (17%), Positives = 145/448 (32%), Gaps = 70/448 (15%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             D+ K   +  ++  ++     +   +GK+KS+D+ +                    +A
Sbjct: 12  TRDITKTLTRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDR-------------LYAYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + A+ L      +  +R VLT   + P S+AN+  D R ++    F F  D       + 
Sbjct: 59  MRAHGLEEMIYAKAFMRRVLTEGVASPSSFANRLADQRYVEFARQFQFATD-------VT 111

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
                     K YA+ +         S       +      +E    +        T  S
Sbjct: 112 AQGADPVMTGKTYADYRLGPAIPARLSGAFPLGQAMDFSDKVEARFTISSRVDATTT-KS 170

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSD---LKDPKSFANTYKDNRYKEII 573
              +L    + + + +   +   ++      +I  S    L    S +   K   + E  
Sbjct: 171 ATIVLNKSTLRDAVSDLARVTPAELVAAINSQIAASGEANLAGKVSASLGAKGELFLETT 230

Query: 574 SSFNFDIHGELSHKKI----------------------------------GKVQDNFHID 599
           +  +    G+                                          +  +    
Sbjct: 231 AFASLGPDGKPGGTGAYADVLYEGGGQVRTITIQNLAPAEGRQLADVGFGSALPMSARAQ 290

Query: 600 DTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPY 659
                Y +Q IE+ E EKD  + LALYF R  P + + Y+IL D  L KV +  L L   
Sbjct: 291 RVTLAYLNQAIERDEGEKDTGVRLALYFTRMAPTLSSPYDILSDPALTKVANVVLGLPAT 350

Query: 660 FAVLPER---KKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNK 716
                     ++  ++K+ I I  F+D  KV+ F+    A+     D   A   S     
Sbjct: 351 SGAATSDALVRRAALIKQKIDIASFQDPAKVQAFVKRFAAI----WDATNADAES----- 401

Query: 717 DPWNNSFDDPQNNVSLQLSPQKKSNGRF 744
            P    F    N+ +  L   ++S  +F
Sbjct: 402 SPVLGLFPTSPNSQAENLGRLQRSRAKF 429



 Score =  156 bits (394), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 63/360 (17%), Positives = 120/360 (33%), Gaps = 63/360 (17%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +  +    ++DI +K  +  + +  V  +  Y+   I  + ++D+F+KD RL++YA+
Sbjct: 1   MTSTFTSYQLLTRDI-TKTLTRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDRLYAYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD--- 116
           +A GL +M +A+ F++++L   ++ P S  N+L   +Y  FAR + F+       +D   
Sbjct: 60  RAHGLEEMIYAKAFMRRVLTEGVASPSSFANRLADQRYVEFARQFQFATDVTAQGADPVM 119

Query: 117 ------------IQHKTIIQDYK--QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRR 162
                            +   +   Q+    ++V    +   R +     S   +     
Sbjct: 120 TGKTYADYRLGPAIPARLSGAFPLGQAMDFSDKVEARFTISSRVDATTTKSATIVLNKST 179

Query: 163 LLDYVLQSFSITPKYISLPFLKDVLTLGLAN---PKKYFIESRDNRFRAMAENFRFQPDG 219
           L D V     +TP  +       +   G AN        + ++   F          PDG
Sbjct: 180 LRDAVSDLARVTPAELVAAINSQIAASGEANLAGKVSASLGAKGELFLETTAFASLGPDG 239

Query: 220 SLSKRDKIL------------------------------------TDMQIEKIVSNYFNN 243
                                                           + +++   Y N 
Sbjct: 240 KPGGTGAYADVLYEGGGQVRTITIQNLAPAEGRQLADVGFGSALPMSARAQRVTLAYLNQ 299

Query: 244 TIDCVPIVSDQ-----NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLT 298
            I+      D       Y+     ++SS  D L DP L K+  + L        A     
Sbjct: 300 AIERDEGEKDTGVRLALYFTRMAPTLSSPYDILSDPALTKVANVVLGLPATSGAATSDAL 359



 Score = 98.0 bits (242), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 45/117 (38%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             S   +       + +  T+K     +  + DY+T NI  + S ++ + + R+  + + 
Sbjct: 1   MTSTFTSYQLLTRDITKTLTRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDRLYAYAMR 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKI 589
           + G++     + F+  +    +  P SFAN   D RY E    F F           
Sbjct: 61  AHGLEEMIYAKAFMRRVLTEGVASPSSFANRLADQRYVEFARQFQFATDVTAQGADP 117



 Score = 79.1 bits (193), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 39/212 (18%), Positives = 82/212 (38%), Gaps = 2/212 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           + +  E+    ++ YF  NI K+ SVD   KD RL  Y +++  +     +  F++ VLT
Sbjct: 20  TRKANEKTVRRDTDYFTANIGKVKSVDDFMKDDRLYAYAMRAHGLEEMIYAKAFMRRVLT 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILT-DMQIEKIVSNYFNNTIDC 247
            G+A+P  +     D R+   A  F+F  D +    D ++T     +  +       +  
Sbjct: 80  EGVASPSSFANRLADQRYVEFARQFQFATDVTAQGADPVMTGKTYADYRLGPAIPARLSG 139

Query: 248 VPIVSDQNYYKLAINSVSSFSDFL-KDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
              +     +   + +  + S  +         + L+   L   ++    +T  +    I
Sbjct: 140 AFPLGQAMDFSDKVEARFTISSRVDATTTKSATIVLNKSTLRDAVSDLARVTPAELVAAI 199

Query: 307 VSQVKYFFQINFHRDNSSSTKIQQDSQIQKML 338
            SQ+    + N     S+S   + +  ++   
Sbjct: 200 NSQIAASGEANLAGKVSASLGAKGELFLETTA 231


>gi|227820851|ref|YP_002824821.1| hypothetical protein NGR_c02700 [Sinorhizobium fredii NGR234]
 gi|227339850|gb|ACP24068.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 301

 Score =  234 bits (596), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 60/277 (21%), Positives = 112/277 (40%), Gaps = 11/277 (3%)

Query: 451 GPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLN 510
               + +S       ++       + + +       +     +      +  E +YY   
Sbjct: 21  YGQDLSRSGHRAGPLLRTGRPIVTTTYTSYKLITADITGSLERVSEQPVVARETEYYLSR 80

Query: 511 INTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYK 570
           I +I S +E  A+ R+ ++ +++ G++     + F+ ++    +    +FAN   D+RYK
Sbjct: 81  IGSIKSLDEFFADSRLYDYAMKAHGLEDMAYAKAFMRKVLTEGIDSEDAFANKLADSRYK 140

Query: 571 EIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRT 630
            ++ S NF  HG+ +                 D Y  Q +E+   E++  + LALYF+R 
Sbjct: 141 ALVESLNFARHGDTATS------FERAQKGVVDKYARQTLEQNAGEENGGVRLALYFERM 194

Query: 631 IPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDF 690
            P I + YEI+ D  L +VV   L+L   FA     ++    ++ I + DF+D  K+  F
Sbjct: 195 APLITSGYEIIADEALAQVVRAALQLPEEFAAADVDRQAEAYEEAIDLKDFQDPVKLAAF 254

Query: 691 LYAAKAM-----DHQSIDYKKALFSSPNQNKDPWNNS 722
           +    A+        S D      SS      P    
Sbjct: 255 IDRFTALWEIENSSDSYDPLAVFGSSSGYGISPDLLL 291



 Score =  180 bits (456), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 46/189 (24%), Positives = 87/189 (46%), Gaps = 7/189 (3%)

Query: 3   PSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
            ++ +    + DI   L   VS+ P+V+ E  YY  RI  I ++DEF  D RL+ YA+KA
Sbjct: 45  TTYTSYKLITADITGSL-ERVSEQPVVARETEYYLSRIGSIKSLDEFFADSRLYDYAMKA 103

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKT 121
            GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+       S  + + 
Sbjct: 104 HGLEDMAYAKAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGDTATSFERAQK 163

Query: 122 -IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            ++  Y +Q+ +          +   YF +    I S  ++  D  L   V  +  +  +
Sbjct: 164 GVVDKYARQTLEQNAGEENGGVRLALYFERMAPLITSGYEIIADEALAQVVRAALQLPEE 223

Query: 177 YISLPFLKD 185
           + +    + 
Sbjct: 224 FAAADVDRQ 232



 Score = 97.6 bits (241), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 43/251 (17%), Positives = 95/251 (37%), Gaps = 24/251 (9%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
             ++ V   E++Y+   I  I S+D+ F D RL DY +++  +     +  F++ VLT G
Sbjct: 64  VSEQPVVARETEYYLSRIGSIKSLDEFFADSRLYDYAMKAHGLEDMAYAKAFMRKVLTEG 123

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR----DKILTDMQIEKIVSNYFNNTID 246
           + +   +  +  D+R++A+ E+  F   G  +       K + D    + +         
Sbjct: 124 IDSEDAFANKLADSRYKALVESLNFARHGDTATSFERAQKGVVDKYARQTLEQNAGEENG 183

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
            V +     Y++     ++S  + + D  L ++++ +L        AD    + ++ +  
Sbjct: 184 GVRLAL---YFERMAPLITSGYEIIADEALAQVVRAALQLPEEFAAAD----VDRQAEAY 236

Query: 307 VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
              +                  Q   ++   +D +    +I +       +  +    G 
Sbjct: 237 EEAIDLKD-------------FQDPVKLAAFIDRFTALWEIENSSDSYDPLAVFGSSSGY 283

Query: 367 IKSIDNLLSGK 377
             S D LLS  
Sbjct: 284 GISPDLLLSIN 294



 Score = 83.0 bits (203), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 60/204 (29%), Gaps = 33/204 (16%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
           ++     +    + Y   +G IKS+D   +                   +A+ A+ L   
Sbjct: 63  RVSEQPVVARETEYYLSRIGSIKSLDEFFADSR-------------LYDYAMKAHGLEDM 109

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +R VLT      D++ANK  D R   L  + NF   G          +  +   
Sbjct: 110 AYAKAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGDTATSFERAQKGVVDKY 169

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
            +    +     +                           Y+      I S  E++A++ 
Sbjct: 170 ARQTLEQNAGEENGGV--------------------RLALYFERMAPLITSGYEIIADEA 209

Query: 526 ILNFLLESKGIDSQKVREDFLCEI 549
           +   +  +  +  +    D   + 
Sbjct: 210 LAQVVRAALQLPEEFAAADVDRQA 233


>gi|163758008|ref|ZP_02165096.1| hypothetical protein HPDFL43_00245 [Hoeflea phototrophica DFL-43]
 gi|162284297|gb|EDQ34580.1| hypothetical protein HPDFL43_00245 [Hoeflea phototrophica DFL-43]
          Length = 260

 Score =  231 bits (588), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 57/229 (24%), Positives = 103/229 (44%), Gaps = 10/229 (4%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +       + +   +     ++  E + Y   I+ I S +E +A+ R+ N+ +++ G++
Sbjct: 6   TSYRLIAQDIPKSIERIASQPQVARESENYLSRISEIKSIDEFMADTRVFNYAMKAHGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                + F+ ++      D  +FAN   D RY++   +FNF  HGE +       Q    
Sbjct: 66  DMSYAKAFMRKVLTEGTDDDNAFANQLADTRYRDFAEAFNFARHGETATIFTSAQQ---- 121

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLS 657
              T D Y    +E++    +  + LALYF+R  P + + YEIL D+ L  VV   L L 
Sbjct: 122 --GTVDKYHRLTLEEEAGADNTGVRLALYFERNAPELTSAYEILADNALADVVRTALGLP 179

Query: 658 PYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKK 706
              A     K+  ++   I + DFKD +K++ FL    A+     + + 
Sbjct: 180 SELAATDIDKQADLINSRIDLEDFKDPEKLDKFLNRFTAL----WELQN 224



 Score =  196 bits (497), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 51/191 (26%), Positives = 95/191 (49%), Gaps = 7/191 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI ++ +    ++DI   +   ++  P V+ E   Y  RI  I +IDEF+ D R+F+YA+
Sbjct: 1   MISTYTSYRLIAQDIPKSI-ERIASQPQVARESENYLSRISEIKSIDEFMADTRVFNYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDI 117
           KA GL DMS+A+ F++K+L     D  +  NQL   +Y+ FA +++F+       I +  
Sbjct: 60  KAHGLEDMSYAKAFMRKVLTEGTDDDNAFANQLADTRYRDFAEAFNFARHGETATIFTSA 119

Query: 118 QHKTIIQDYKQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           Q  T+ + ++ + + +        +   YF +N  ++ S  ++  D  L D V  +  + 
Sbjct: 120 QQGTVDKYHRLTLEEEAGADNTGVRLALYFERNAPELTSAYEILADNALADVVRTALGLP 179

Query: 175 PKYISLPFLKD 185
            +  +    K 
Sbjct: 180 SELAATDIDKQ 190



 Score = 97.2 bits (240), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 66/177 (37%), Gaps = 7/177 (3%)

Query: 134 EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLAN 193
           +     ES+ +   I +I S+D+   D R+ +Y +++  +     +  F++ VLT G  +
Sbjct: 25  QPQVARESENYLSRISEIKSIDEFMADTRVFNYAMKAHGLEDMSYAKAFMRKVLTEGTDD 84

Query: 194 PKKYFIESRDNRFRAMAENFRFQPDGSLS----KRDKILTDMQIEKIVSNYFNNTIDCVP 249
              +  +  D R+R  AE F F   G  +       +   D      +          V 
Sbjct: 85  DNAFANQLADTRYRDFAEAFNFARHGETATIFTSAQQGTVDKYHRLTLEEEAGADNTGVR 144

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
           +     Y++     ++S  + L D  L  +++ +L   +     D        N  I
Sbjct: 145 LAL---YFERNAPELTSAYEILADNALADVVRTALGLPSELAATDIDKQADLINSRI 198



 Score = 93.7 bits (231), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 35/204 (17%), Positives = 69/204 (33%), Gaps = 33/204 (16%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
           +I    ++    ++Y   + +IKSID  ++                   +A+ A+ L   
Sbjct: 21  RIASQPQVARESENYLSRISEIKSIDEFMADTR-------------VFNYAMKAHGLEDM 67

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +R VLT    D +++AN+  D R      AFNF   G    I     + T+   
Sbjct: 68  SYAKAFMRKVLTEGTDDDNAFANQLADTRYRDFAEAFNFARHGETATIFTSAQQGTVDKY 127

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
                                   +  +   +        Y+  N   + S  E+LA+  
Sbjct: 128 --------------------HRLTLEEEAGADNTGVRLALYFERNAPELTSAYEILADNA 167

Query: 526 ILNFLLESKGIDSQKVREDFLCEI 549
           + + +  + G+ S+    D   + 
Sbjct: 168 LADVVRTALGLPSELAATDIDKQA 191


>gi|254471377|ref|ZP_05084779.1| flagellar basal-body rod protein flgf [Pseudovibrio sp. JE062]
 gi|211959523|gb|EEA94721.1| flagellar basal-body rod protein flgf [Pseudovibrio sp. JE062]
          Length = 365

 Score =  230 bits (587), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 71/399 (17%), Positives = 143/399 (35%), Gaps = 74/399 (18%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
           +   D ++   IK Y+    K++++D+LL+                   F +    L   
Sbjct: 20  RTAKDPEIAREIKYYEENFSKVETVDDLLNDYR-------------LYNFMMKTMGLEDM 66

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +R VL     D  + AN  KD R  +L  AF FN DG+I               
Sbjct: 67  AYAKGMVRKVLVEGTDDSGALANTLKDKRFKELAEAFPFNKDGTIKG------------- 113

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNIN-TIHSFEELLANK 524
                   +   ++E      +   +T      +++   +Y+TL +   +    ++LA+ 
Sbjct: 114 --------KFDWESEGLDPRMVLWSNTPGEEVDDVDRLAEYFTLKMPRDVIFTTQILADP 165

Query: 525 RILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGEL 584
            +   +  +  +                    P+   N  K  R      + + +   + 
Sbjct: 166 ALYEVITVAFDV--------------------PEEIINGPKSERIDWFDENIDIEALKKP 205

Query: 585 SHKKIGKVQDNFHID--------DTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN 636
           S  K    +   +++           + Y     E+ E E++  + LAL F+RT  NI +
Sbjct: 206 SELKDTIAKYRDNLEIREADRTKGIVEQYIQVSFEEGEGEQNEGVRLALNFQRTGGNITS 265

Query: 637 HYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKA 696
            YEILG   L++VV   L +S          +  ++ +   I  F+D ++V+ F+     
Sbjct: 266 AYEILGSPALYQVVRTVLGMSESMVGSDIDNQAAVINEKFDIKKFQDPEEVDKFVKKFVI 325

Query: 697 MDHQSIDYKKALFSSPNQNKDPWNNSF-DDPQNNVSLQL 734
           +     D +  + ++P+         F  +P   +   +
Sbjct: 326 L----YDAQNGIGTAPS------VQLFASNPGVGIPENV 354



 Score =  220 bits (559), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 48/299 (16%), Positives = 119/299 (39%), Gaps = 11/299 (3%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++D+        +KDP ++ E +YY E    + T+D+ + D RL+++ +K  GL DM++A
Sbjct: 11  NRDLPG-AKERTAKDPEIAREIKYYEENFSKVETVDDLLNDYRLYNFMMKTMGLEDMAYA 69

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQ----DY 126
           +  ++K+L     D  +L N L   +++  A ++ F+    +          +      +
Sbjct: 70  KGMVRKVLVEGTDDSGALANTLKDKRFKELAEAFPFNKDGTIKGKFDWESEGLDPRMVLW 129

Query: 127 KQSHQHKEEVALEESKYFRKNIH-KINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
             +   + +     ++YF   +   +    Q+  D  L + +  +F +  + I+ P  K 
Sbjct: 130 SNTPGEEVDDVDRLAEYFTLKMPRDVIFTTQILADPALYEVITVAFDVPEEIINGP--KS 187

Query: 186 VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI 245
                           + +  +     +R   +   + R K + +  I+           
Sbjct: 188 ERIDWFDENIDIEALKKPSELKDTIAKYRDNLEIREADRTKGIVEQYIQVSFEEGEGEQN 247

Query: 246 DCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND 304
           + V +  +   ++    +++S  + L  P L+++++  L      + +D        N+
Sbjct: 248 EGVRLALN---FQRTGGNITSAYEILGSPALYQVVRTVLGMSESMVGSDIDNQAAVINE 303



 Score =  141 bits (354), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 94/211 (44%), Gaps = 8/211 (3%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
             +     +   + EI  E+ YY  N + + + ++LL + R+ NF++++ G++     + 
Sbjct: 12  RDLPGAKERTAKDPEIAREIKYYEENFSKVETVDDLLNDYRLYNFMMKTMGLEDMAYAKG 71

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            + ++      D  + ANT KD R+KE+  +F F+  G +     GK        D   +
Sbjct: 72  MVRKVLVEGTDDSGALANTLKDKRFKELAEAFPFNKDGTIK----GKFDWESEGLDPRMV 127

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIP-NIRNHYEILGDSKLFKVVSKKLKLSPYFAVL 663
                  ++ ++ D    LA YF   +P ++    +IL D  L++V++    +       
Sbjct: 128 LWSNTPGEEVDDVD---RLAEYFTLKMPRDVIFTTQILADPALYEVITVAFDVPEEIING 184

Query: 664 PERKKIRILKKHIKINDFKDSKKVEDFLYAA 694
           P+ ++I    ++I I   K   +++D +   
Sbjct: 185 PKSERIDWFDENIDIEALKKPSELKDTIAKY 215



 Score = 45.6 bits (106), Expect = 0.031,   Method: Composition-based stats.
 Identities = 38/317 (11%), Positives = 81/317 (25%), Gaps = 54/317 (17%)

Query: 242 NNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQ 301
             T     I  +  YY+   + V +  D L D +L+  +  ++   +          ++ 
Sbjct: 19  ERTAKDPEIAREIKYYEENFSKVETVDDLLNDYRLYNFMMKTMGLEDMAYAKGMVRKVLV 78

Query: 302 ENDPIVS----------QVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDD 351
           E                  +      F++D +   K                      + 
Sbjct: 79  EGTDDSGALANTLKDKRFKELAEAFPFNKDGTIKGKF-----------------DWESEG 121

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
               ++     P  ++  +D  L+    L+ P         L         +        
Sbjct: 122 LDPRMVLWSNTPGEEVDDVDR-LAEYFTLKMPRDVIFTTQILA--------DPALY---- 168

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
              V+T     P+   N  K +R+        F+ +  I  +        ++D +  Y +
Sbjct: 169 --EVITVAFDVPEEIINGPKSERIDW------FDENIDIEALKKP---SELKDTIAKYRD 217

Query: 472 RKRSIHDAENKSFNSME---QISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN 528
                     K              +    E       +      I S  E+L +  +  
Sbjct: 218 NLEIREADRTKGIVEQYIQVSFEEGEGEQNEGVRLALNFQRTGGNITSAYEILGSPALYQ 277

Query: 529 FLLESKGIDSQKVREDF 545
            +    G+    V  D 
Sbjct: 278 VVRTVLGMSESMVGSDI 294


>gi|218680748|ref|ZP_03528645.1| hypothetical protein RetlC8_18559 [Rhizobium etli CIAT 894]
          Length = 262

 Score =  230 bits (587), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 89/265 (33%), Positives = 148/265 (55%), Gaps = 4/265 (1%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ ++V+    ++++ + L S V+    VS +  YY+E I  ++T+DEF+ D +L+SYA+
Sbjct: 1   MVSTYVSYLAVARNLNTSL-SNVASQATVSRDSAYYKENIDKVTTVDEFMGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDLSD  S  N L+  +Y  FA ++ FS   K  QSD+Q 
Sbjct: 60  KAYGLDDMTYAKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGETKTAQSDVQR 119

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
             ++  Y+ S   + E   +E+ YF +NI  I SVD      RL +Y L +F ++ +Y S
Sbjct: 120 DNLLDAYETSFDTEAENIADETDYFEENISSITSVDDFLSSSRLKNYALTAFGLSTEYTS 179

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             FLK VLT  L +P  +  +  D+ + ++A+ F F  DGS      ++++ QI  + S 
Sbjct: 180 SSFLKQVLTSDLDDPDSFVNQLGDDVYVSLAKAFNFNEDGSTD--GDVMSEDQISLVTSG 237

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSV 264
           Y   +       + + Y       +
Sbjct: 238 YAVASSTIASSDTGEAYDTYFAAQI 262



 Score =  128 bits (322), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 60/284 (21%), Positives = 103/284 (36%), Gaps = 44/284 (15%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
             +     +      Y+  + K+ ++D  +                    +A+ AY L+ 
Sbjct: 20  SNVASQATVSRDSAYYKENIDKVTTVDEFMGDY-------------KLYSYAMKAYGLDD 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  ++ VL S+ SD  S+AN   D R  +   AF F+ +         QS +   +
Sbjct: 67  MTYAKAFMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGETK-----TAQSDVQRDN 121

Query: 465 NVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANK 524
            +  Y                     ++       I  E DY+  NI++I S ++ L++ 
Sbjct: 122 LLDAY--------------------ETSFDTEAENIADETDYFEENISSITSVDDFLSSS 161

Query: 525 RILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGEL 584
           R+ N+ L + G+ ++     FL ++  SDL DP SF N   D+ Y  +  +FNF+  G  
Sbjct: 162 RLKNYALTAFGLSTEYTSSSFLKQVLTSDLDDPDSFVNQLGDDVYVSLAKAFNFNEDGS- 220

Query: 585 SHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFK 628
                G V     I      Y            D   A   YF 
Sbjct: 221 ---TDGDVMSEDQISLVTSGYAVAS--STIASSDTGEAYDTYFA 259



 Score = 99.1 bits (245), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 47/247 (19%), Positives = 95/247 (38%), Gaps = 18/247 (7%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           S+   +     +S Y+++NI K+ +VD+   D +L  Y ++++ +     +  F+K VL 
Sbjct: 20  SNVASQATVSRDSAYYKENIDKVTTVDEFMGDYKLYSYAMKAYGLDDMTYAKAFMKKVLE 79

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
             L++   +     D+R+   A  F+F  +          +D+Q + ++  Y  +     
Sbjct: 80  SDLSDSSSFANSLSDSRYAEFAAAFKFSGETK-----TAQSDVQRDNLLDAYETSFDTEA 134

Query: 249 P-IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND--- 304
             I  + +Y++  I+S++S  DFL   +L      +      E T+  FL  +  +D   
Sbjct: 135 ENIADETDYFEENISSITSVDDFLSSSRLKNYALTAFGLST-EYTSSSFLKQVLTSDLDD 193

Query: 305 --------PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSL 356
                        V      NF+ D S+   +  + QI  +   Y      +        
Sbjct: 194 PDSFVNQLGDDVYVSLAKAFNFNEDGSTDGDVMSEDQISLVTSGYAVASSTIASSDTGEA 253

Query: 357 IKDYQLP 363
              Y   
Sbjct: 254 YDTYFAA 260



 Score = 96.8 bits (239), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 40/201 (19%), Positives = 83/201 (41%), Gaps = 18/201 (8%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            ++    +       ++ +  YY  NI+ + + +E + + ++ ++ +++ G+D     + 
Sbjct: 13  RNLNTSLSNVASQATVSRDSAYYKENIDKVTTVDEFMGDYKLYSYAMKAYGLDDMTYAKA 72

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ ++ +SDL D  SFAN+  D+RY E  ++F F         +    Q +   D+  D 
Sbjct: 73  FMKKVLESDLSDSSSFANSLSDSRYAEFAAAFKF-------SGETKTAQSDVQRDNLLDA 125

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           Y+     + E   D       YF+  I +I +  + L  S+L         LS  +    
Sbjct: 126 YETSFDTEAENIADET----DYFEENISSITSVDDFLSSSRLKNYALTAFGLSTEYTSSS 181

Query: 665 ERKKIRILKKHIKINDFKDSK 685
             K++         +D  D  
Sbjct: 182 FLKQVLT-------SDLDDPD 195



 Score = 91.1 bits (224), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 55/264 (20%), Positives = 93/264 (35%), Gaps = 25/264 (9%)

Query: 237 VSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT---- 292
           ++   +N      +  D  YYK  I+ V++  +F+ D KL+     +    +        
Sbjct: 15  LNTSLSNVASQATVSRDSAYYKENIDKVTTVDEFMGDYKLYSYAMKAYGLDDMTYAKAFM 74

Query: 293 ----ADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQIL 348
                          + +       F   F     +    Q D Q   +LD Y+ +    
Sbjct: 75  KKVLESDLSDSSSFANSLSDSRYAEFAAAFKFSGET-KTAQSDVQRDNLLDAYETSFDTE 133

Query: 349 HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
             + +      ++  +  I S+D+ LS                   +AL A+ L+ +   
Sbjct: 134 A-ENIADETDYFEENISSITSVDDFLSSSR-------------LKNYALTAFGLSTEYTS 179

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKH 468
              L+ VLTS+  DPDS+ N+  DD  + L  AFNFN DGS     M  S   I      
Sbjct: 180 SSFLKQVLTSDLDDPDSFVNQLGDDVYVSLAKAFNFNEDGSTDGDVM--SEDQISLVTSG 237

Query: 469 YANRKRSIHDAENKSFNSMEQIST 492
           YA    +I  ++          + 
Sbjct: 238 YAVASSTIASSDTGEAYDTYFAAQ 261


>gi|12214188|emb|CAC21603.1| unnamed protein product [Sinorhizobium meliloti]
          Length = 315

 Score =  230 bits (586), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 59/268 (22%), Positives = 109/268 (40%), Gaps = 11/268 (4%)

Query: 461 TIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEEL 520
           +    +        + + +       + +   +     ++  E +YY   I +I + ++ 
Sbjct: 45  SSSRFIATGEPIVTTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDF 104

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
            A+ R+ N+ +++ G++     + F+ ++    +    +FAN   D RYK ++ S NF  
Sbjct: 105 FADSRLYNYAMKAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFAR 164

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
           HGE +                 + Y  Q +E+K  E++  + LALYF+R  P I N YEI
Sbjct: 165 HGEAATA------FERAQKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEI 218

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM--- 697
           + D  L  VV   L+L   FA     ++    +  I   DF+D +K+ +FL    A+   
Sbjct: 219 IADEALSHVVRTVLQLPAEFAAADVDRQAEAYEAAIDFKDFQDPQKIAEFLDRFTALWEI 278

Query: 698 --DHQSIDYKKALFSSPNQNKDPWNNSF 723
                  D      +S      P     
Sbjct: 279 DNSSDGYDPLAVFGASSGYGISPDLLLT 306



 Score =  174 bits (440), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 43/189 (22%), Positives = 88/189 (46%), Gaps = 7/189 (3%)

Query: 3   PSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
            ++ +    + D+   L   VS  P V+ E  YY  +I  I T+D+F  D RL++YA+KA
Sbjct: 59  TTYTSYRLITADLTKSL-ERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKA 117

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKT 121
            GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+   +   +  + + 
Sbjct: 118 HGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQK 177

Query: 122 -IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            + + Y +Q+ + K        +   YF++    I +  ++  D  L   V     +  +
Sbjct: 178 GVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLPAE 237

Query: 177 YISLPFLKD 185
           + +    + 
Sbjct: 238 FAAADVDRQ 246



 Score = 93.7 bits (231), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 67/177 (37%), Gaps = 1/177 (0%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
              +     E++Y+   I  I ++D  F D RL +Y +++  +     +  F++ VL  G
Sbjct: 78  VSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAFMRKVLAEG 137

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR-DKILTDMQIEKIVSNYFNNTIDCVP 249
           + +   +  +  D R++A+ E+  F   G  +   ++    +  +           +   
Sbjct: 138 IDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQKGVAEKYTRQTLEQKAGEENT 197

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
            V    Y++    ++++  + + D  L  +++  L        AD           I
Sbjct: 198 GVRLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLPAEFAAADVDRQAEAYEAAI 254



 Score = 78.3 bits (191), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 34/232 (14%), Positives = 68/232 (29%), Gaps = 33/232 (14%)

Query: 318 FHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGK 377
           F             S      DL K   ++     +    + Y   +G IK++D+  +  
Sbjct: 49  FIATGEPIVTTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADS 108

Query: 378 CQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIK 437
                            +A+ A+ L      +  +R VL       D++ANK  D R   
Sbjct: 109 R-------------LYNYAMKAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKA 155

Query: 438 LNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRIN 497
           L  + NF   G              +   + Y  +       E  +              
Sbjct: 156 LVESLNFARHGE----AATAFERAQKGVAEKYTRQTLEQKAGEENTGV------------ 199

Query: 498 LEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
                   Y+     TI +  E++A++ + + +     + ++    D   + 
Sbjct: 200 ----RLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLPAEFAAADVDRQA 247


>gi|126031430|pdb|2O8S|A Chain A, X-Ray Crystal Structure Of Protein Agr_c_984 From
           Agrobacterium Tumefaciens. Northeast Structural Genomics
           Consortium Target Atr120.
 gi|126031431|pdb|2O8S|B Chain B, X-Ray Crystal Structure Of Protein Agr_c_984 From
           Agrobacterium Tumefaciens. Northeast Structural Genomics
           Consortium Target Atr120
          Length = 323

 Score =  229 bits (584), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 55/274 (20%), Positives = 105/274 (38%), Gaps = 15/274 (5%)

Query: 461 TIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEEL 520
            ++           S + +       + +   +     ++  E +YY   I ++ S ++ 
Sbjct: 42  ALKSGSNESGGSVTSTYTSYRLISQDIGKSLERVSKQPDVARETEYYREKIGSVKSIDDF 101

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
            A+ R+ N+ L++ G++     + F+ ++      D  +FAN   DNRY E+  S +F  
Sbjct: 102 XADTRLYNYALKAHGLEDXAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDF-- 159

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
               +                   Y  Q +E++  + +  + LALYF+R  P I++  + 
Sbjct: 160 ----AGLGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDF 215

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQ 700
           L D  L +V      L   FA     K+  +++K I I D +D +KV   L         
Sbjct: 216 LADDALAQVFRTTFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLLERFTI---- 271

Query: 701 SIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQL 734
             + +      P+   DP           +S  L
Sbjct: 272 XWEXQN-----PSTTYDPLAVFGSSSGYGISPDL 300



 Score =  187 bits (475), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 55/189 (29%), Positives = 92/189 (48%), Gaps = 7/189 (3%)

Query: 3   PSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
            ++ +    S+DI   L   VSK P V+ E  YYRE+I  + +ID+F  D RL++YALKA
Sbjct: 56  STYTSYRLISQDIGKSL-ERVSKQPDVARETEYYREKIGSVKSIDDFXADTRLYNYALKA 114

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKT 121
            GL D ++A+ FI+K+L    SD  +  N+L+  +Y   A+S DF+       +    K+
Sbjct: 115 HGLEDXAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAAATATEAAKS 174

Query: 122 -IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            +I +Y +Q+ + +        +   YF +    I S      D  L      +F++   
Sbjct: 175 GVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTFNLPDA 234

Query: 177 YISLPFLKD 185
           + +    K 
Sbjct: 235 FAAADVDKQ 243



 Score =  102 bits (254), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/176 (19%), Positives = 73/176 (41%), Gaps = 9/176 (5%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
             K+     E++Y+R+ I  + S+D    D RL +Y L++  +     +  F++ VLT G
Sbjct: 75  VSKQPDVARETEYYREKIGSVKSIDDFXADTRLYNYALKAHGLEDXAYAKAFIRKVLTEG 134

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPI 250
            ++   +  +  DNR+  +A++  F    +        T+     ++ NY   T++    
Sbjct: 135 ASDKNAFANKLSDNRYAELAKSLDF----AGLGAAATATEAAKSGVIGNYARQTLEQEAG 190

Query: 251 VSD-----QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQ 301
             +       Y++    ++ S  DFL D  L ++ + +    +    AD       
Sbjct: 191 DDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTFNLPDAFAAADVDKQAAL 246



 Score = 89.9 bits (221), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 32/204 (15%), Positives = 65/204 (31%), Gaps = 33/204 (16%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
           ++     +    + Y+  +G +KSID+  +                   +AL A+ L   
Sbjct: 74  RVSKQPDVARETEYYREKIGSVKSIDDFXADTR-------------LYNYALKAHGLEDX 120

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +R VLT   SD +++ANK  D+R  +L  + +F   G+            I + 
Sbjct: 121 AYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAAATATEAAKSGVIGNY 180

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
            +    ++    +                           Y+     TI S  + LA+  
Sbjct: 181 ARQTLEQEAGDDN--------------------NGVRLALYFERKAPTIKSGLDFLADDA 220

Query: 526 ILNFLLESKGIDSQKVREDFLCEI 549
           +      +  +       D   + 
Sbjct: 221 LAQVFRTTFNLPDAFAAADVDKQA 244


>gi|150395478|ref|YP_001325945.1| hypothetical protein Smed_0251 [Sinorhizobium medicae WSM419]
 gi|150026993|gb|ABR59110.1| protein of unknown function DUF1217 [Sinorhizobium medicae WSM419]
          Length = 259

 Score =  229 bits (583), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 60/256 (23%), Positives = 107/256 (41%), Gaps = 11/256 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             + + +       + +   +     ++  E +YY   I +I + +E  A+ R+ ++ ++
Sbjct: 1   MTTTYTSYKLITADLTKSLERVSEQPDVARETEYYLSKIGSIKTLDEFFADSRLYDYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++    +    +FAN   D RYK ++ S NF  HGE +       
Sbjct: 61  AHGLEDMAYAKAFMRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGEAATS----- 115

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
                     + Y  Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV  
Sbjct: 116 -FERAQKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-----DHQSIDYKKA 707
            L+L   FA     ++    +  + + DF+D  KV +FL    A+          D    
Sbjct: 175 VLQLPEEFAATDVDRQAAAYESAVDLKDFQDPHKVAEFLDRFTALWEIDNSSDGYDPLAV 234

Query: 708 LFSSPNQNKDPWNNSF 723
             SS      P     
Sbjct: 235 FGSSSGYGISPDLLLT 250



 Score =  175 bits (442), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 46/191 (24%), Positives = 89/191 (46%), Gaps = 7/191 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  ++ +    + D+   L   VS+ P V+ E  YY  +I  I T+DEF  D RL+ YA+
Sbjct: 1   MTTTYTSYKLITADLTKSL-ERVSEQPDVARETEYYLSKIGSIKTLDEFFADSRLYDYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+   +   S  + 
Sbjct: 60  KAHGLEDMAYAKAFMRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGEAATSFERA 119

Query: 120 KT-IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           +  + + Y +Q+ + K        +   YF++    I +  ++  D  L   V     + 
Sbjct: 120 QKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLP 179

Query: 175 PKYISLPFLKD 185
            ++ +    + 
Sbjct: 180 EEFAATDVDRQ 190



 Score = 93.4 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 27/191 (14%), Positives = 71/191 (37%), Gaps = 3/191 (1%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
             ++     E++Y+   I  I ++D+ F D RL DY +++  +     +  F++ VL  G
Sbjct: 22  VSEQPDVARETEYYLSKIGSIKTLDEFFADSRLYDYAMKAHGLEDMAYAKAFMRKVLGEG 81

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR-DKILTDMQIEKIVSNYFNNTIDCVP 249
           + +   +  +  D R++++ E+  F   G  +   ++    +  +           +   
Sbjct: 82  IDSDDAFANKLADGRYKSLVESLNFARHGEAATSFERAQKGVAEKYTRQTLEQKAGEENT 141

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITA--DKFLTLMQENDPIV 307
            V    Y++    ++++  + + D  L  +++  L           D+     +    + 
Sbjct: 142 GVRLALYFQRMAPTIANGYEIIADEALSHVVRTVLQLPEEFAATDVDRQAAAYESAVDLK 201

Query: 308 SQVKYFFQINF 318
                     F
Sbjct: 202 DFQDPHKVAEF 212



 Score = 76.8 bits (187), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 33/224 (14%), Positives = 68/224 (30%), Gaps = 35/224 (15%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             DL K   ++     +    + Y   +G IK++D   +                   +A
Sbjct: 12  TADLTKSLERVSEQPDVARETEYYLSKIGSIKTLDEFFADSR-------------LYDYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + A+ L      +  +R VL       D++ANK  D R   L  + NF   G        
Sbjct: 59  MKAHGLEDMAYAKAFMRKVLGEGIDSDDAFANKLADGRYKSLVESLNFARHGEAATSF-- 116

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
                 +   + Y  +       E  +                      Y+     TI +
Sbjct: 117 --ERAQKGVAEKYTRQTLEQKAGEENTGV----------------RLALYFQRMAPTIAN 158

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCE--IFKSDLKDPK 558
             E++A++ + + +     +  +    D   +   ++S +    
Sbjct: 159 GYEIIADEALSHVVRTVLQLPEEFAATDVDRQAAAYESAVDLKD 202


>gi|328545468|ref|YP_004305577.1| flagellar basal-body rod protein flgf [polymorphum gilvum
           SL003B-26A1]
 gi|326415209|gb|ADZ72272.1| Flagellar basal-body rod protein flgf [Polymorphum gilvum
           SL003B-26A1]
          Length = 261

 Score =  228 bits (582), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 64/254 (25%), Positives = 103/254 (40%), Gaps = 14/254 (5%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             S          +M +          +  E +YY  NI    S ++ L + R+  + ++
Sbjct: 1   MISTLLQYQMVSTNMTRSLDTVASEPTVRRESEYYLANIGKAKSIDDFLGDDRLFKYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G+      + F+ ++ +    D  SFAN   D+RY++   +FNF  +G+ +       
Sbjct: 61  AFGLQDMDYAKAFMRKVLEEGTDDRNSFANKLADDRYRQFAETFNFTRYGDAATAFTRAQ 120

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q         D Y  Q +E +  E +  + LALYF R    I + Y+IL D  L +VV  
Sbjct: 121 Q------GVVDAYVRQSLEIQNGESNEGVRLALYFSRKAETIDSAYDILADRALAQVVYA 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            L L   FA+    K+   ++K + + DFKD + VE FL     M     D  K     P
Sbjct: 175 ALGLPDEFAMADVDKQAAFIEKRLDLEDFKDPQAVEAFLKRFTTM----WDLAKG----P 226

Query: 713 NQNKDPWNNSFDDP 726
            Q   P        
Sbjct: 227 PQASVPNLILSGSS 240



 Score =  184 bits (466), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 52/190 (27%), Positives = 88/190 (46%), Gaps = 5/190 (2%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI + +         ++   TV+ +P V  E  YY   I    +ID+F+ D RLF YA+K
Sbjct: 1   MISTLLQYQMVSTNMTRSLDTVASEPTVRRESEYYLANIGKAKSIDDFLGDDRLFKYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQ 118
           AFGL DM +A+ F++K+LE    D  S  N+L   +Y+ FA +++F+         +  Q
Sbjct: 61  AFGLQDMDYAKAFMRKVLEEGTDDRNSFANKLADDRYRQFAETFNFTRYGDAATAFTRAQ 120

Query: 119 HKTIIQDYKQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
              +    +QS + +   + E  +   YF +    I+S   +  DR L   V  +  +  
Sbjct: 121 QGVVDAYVRQSLEIQNGESNEGVRLALYFSRKAETIDSAYDILADRALAQVVYAALGLPD 180

Query: 176 KYISLPFLKD 185
           ++      K 
Sbjct: 181 EFAMADVDKQ 190



 Score = 97.6 bits (241), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 69/165 (41%), Gaps = 7/165 (4%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           ES+Y+  NI K  S+D    D RL  Y +++F +     +  F++ VL  G  +   +  
Sbjct: 31  ESEYYLANIGKAKSIDDFLGDDRLFKYAMKAFGLQDMDYAKAFMRKVLEEGTDDRNSFAN 90

Query: 200 ESRDNRFRAMAENFRF----QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN 255
           +  D+R+R  AE F F        + ++  + + D  + + +      + + V +     
Sbjct: 91  KLADDRYRQFAETFNFTRYGDAATAFTRAQQGVVDAYVRQSLEIQNGESNEGVRLAL--- 147

Query: 256 YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM 300
           Y+     ++ S  D L D  L +++  +L   +    AD      
Sbjct: 148 YFSRKAETIDSAYDILADRALAQVVYAALGLPDEFAMADVDKQAA 192



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 38/204 (18%), Positives = 70/204 (34%), Gaps = 33/204 (16%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
            +  +  ++   + Y   +GK KSID+ L                   ++A+ A+ L   
Sbjct: 21  TVASEPTVRRESEYYLANIGKAKSIDDFLGDDR-------------LFKYAMKAFGLQDM 67

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
           D  +  +R VL     D +S+ANK  DDR  +    FNF   G          +  +   
Sbjct: 68  DYAKAFMRKVLEEGTDDRNSFANKLADDRYRQFAETFNFTRYGDAATAFTRAQQGVVDAY 127

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
           V+                         Q   + E      Y++    TI S  ++LA++ 
Sbjct: 128 VRQSLEI--------------------QNGESNEGVRLALYFSRKAETIDSAYDILADRA 167

Query: 526 ILNFLLESKGIDSQKVREDFLCEI 549
           +   +  + G+  +    D   + 
Sbjct: 168 LAQVVYAALGLPDEFAMADVDKQA 191


>gi|114762157|ref|ZP_01441625.1| flagellar protein, putative [Pelagibaca bermudensis HTCC2601]
 gi|114545181|gb|EAU48184.1| flagellar protein, putative [Roseovarius sp. HTCC2601]
          Length = 405

 Score =  226 bits (576), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 57/382 (14%), Positives = 123/382 (32%), Gaps = 33/382 (8%)

Query: 353 MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQL 412
           +      +   +G I S + L+  +               L  AL A+ +  +   +  +
Sbjct: 35  ITREAAYFTETIGSIGSAEELVGNRR-------------LLSVALTAFGMEDELDSKYLV 81

Query: 413 RNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANR 472
           R ++     D ++ ANK  D R + L  AF+F    +        +   +    +     
Sbjct: 82  RRLIEEGTKDDEALANKLNDSRFVALADAFDFEPVITRKTQEEGFAETVLVRYEERIRAN 141

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                   +   +         ++   +     Y+T NI  I S EELL +  +      
Sbjct: 142 LAQTLTEPDYVADPDYAALFAAQVEENLEISRAYFTENIGRITSAEELLLDPELRQVATT 201

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           +  +  +      L    + D  +  + +N   D   +    +F F        +    +
Sbjct: 202 AFDLGDRARSTTLLRRALEEDPAEATALSNVLNDRNLRAFSMAFAF-----YETETSTVL 256

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDS 644
           Q      +  + ++ Q  E    + +  I  AL F+R++P +           Y +LG +
Sbjct: 257 QTEGFASNITEQFRWQRFEDAVSDVNEAIGAALKFQRSLPELAANDLSETAKWYNVLGST 316

Query: 645 KLFKVVSKKLKLSPYFAVLPERKKIRILKKHIK-------INDFKDSKKVEDFLYAAKAM 697
            + +V    L L   F+ +   K++ ++    +        +D +D K +   + +    
Sbjct: 317 MMREVFETALSLPDGFSQIDLDKQVEVISDRARQRFGIETFSDLQDPKTLNGIIQSYLLQ 376

Query: 698 DHQSIDYKKALFSSPNQNKDPW 719
           D  S                  
Sbjct: 377 DQISQSGAFGSQQIALTLLSTI 398



 Score =  175 bits (443), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 61/366 (16%), Positives = 132/366 (36%), Gaps = 41/366 (11%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
           P  V     ++      +  +K P ++ E  Y+ E I  I + +E + ++RL S AL AF
Sbjct: 10  PGLVGWQILQNTMDTQRTAFNKTPEITREAAYFTETIGSIGSAEELVGNRRLLSVALTAF 69

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP-PKVIQSDIQHKT 121
           G+ D   ++  +++++E    D ++L N+LN  ++   A ++DF P   +  Q +   +T
Sbjct: 70  GMEDELDSKYLVRRLIEEGTKDDEALANKLNDSRFVALADAFDFEPVITRKTQEEGFAET 129

Query: 122 IIQDYKQSHQHKEEVALEESK------------------------YFRKNIHKINSVDQL 157
           ++  Y++  +      L E                          YF +NI +I S ++L
Sbjct: 130 VLVRYEERIRANLAQTLTEPDYVADPDYAALFAAQVEENLEISRAYFTENIGRITSAEEL 189

Query: 158 FKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP 217
             D  L      +F +  +  S   L+  L    A          D   RA +  F F  
Sbjct: 190 LLDPELRQVATTAFDLGDRARSTTLLRRALEEDPAEATALSNVLNDRNLRAFSMAFAF-- 247

Query: 218 DGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNY-----YKLAINSVSS------ 266
                    + T+     I   +     +      ++       ++ ++  +++      
Sbjct: 248 -YETETSTVLQTEGFASNITEQFRWQRFEDAVSDVNEAIGAALKFQRSLPELAANDLSET 306

Query: 267 --FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSS 324
             + + L    + ++ + +L   +     D    +   +D    +       +     + 
Sbjct: 307 AKWYNVLGSTMMREVFETALSLPDGFSQIDLDKQVEVISDRARQRFGIETFSDLQDPKTL 366

Query: 325 STKIQQ 330
           +  IQ 
Sbjct: 367 NGIIQS 372



 Score =  114 bits (284), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 47/262 (17%), Positives = 96/262 (36%), Gaps = 33/262 (12%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           N+M+   T      EI  E  Y+T  I +I S EEL+ N+R+L+  L + G++ +   + 
Sbjct: 20  NTMDTQRTAFNKTPEITREAAYFTETIGSIGSAEELVGNRRLLSVALTAFGMEDELDSKY 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN-FHIDDTCD 603
            +  + +   KD ++ AN   D+R+  +  +F+F+       ++ G  +      ++   
Sbjct: 80  LVRRLIEEGTKDDEALANKLNDSRFVALADAFDFEPVITRKTQEEGFAETVLVRYEERIR 139

Query: 604 LYKHQMIEK--------------KEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKV 649
               Q + +               + E++  I+ A YF   I  I +  E+L D +L +V
Sbjct: 140 ANLAQTLTEPDYVADPDYAALFAAQVEENLEISRA-YFTENIGRITSAEELLLDPELRQV 198

Query: 650 VSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLY-------AAKAMDHQSI 702
            +    L          ++   L++        D  +              A +M     
Sbjct: 199 ATTAFDLGDRARSTTLLRRA--LEE--------DPAEATALSNVLNDRNLRAFSMAFAFY 248

Query: 703 DYKKALFSSPNQNKDPWNNSFD 724
           + + +               F 
Sbjct: 249 ETETSTVLQTEGFASNITEQFR 270


>gi|325291946|ref|YP_004277810.1| hypothetical protein AGROH133_03954 [Agrobacterium sp. H13-3]
 gi|325059799|gb|ADY63490.1| hypothetical protein AGROH133_03954 [Agrobacterium sp. H13-3]
          Length = 259

 Score =  226 bits (575), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 53/262 (20%), Positives = 104/262 (39%), Gaps = 15/262 (5%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             S + +       + +   +     ++  E +YY   I ++ S ++ +A+ R+ N+ L+
Sbjct: 1   MTSTYTSYRLISQDIGKSLERVSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYALK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++      D  +FAN   D+RY ++  S +F   G  +       
Sbjct: 61  ANGLEDMAYAKAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATA----- 115

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
                       Y  Q +E++    +  + LALYF+R  P I++  + L D  L +V   
Sbjct: 116 -TEAAQSGIISKYTRQTLEQEAGGDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
              L    A     K+  +++K I I D ++ +KV   L     M     + +      P
Sbjct: 175 AYNLPDEIAAGSVEKQAALIEKSINIKDLQNPEKVGKLLERFTIM----WEMQN-----P 225

Query: 713 NQNKDPWNNSFDDPQNNVSLQL 734
           +   DP           +S  L
Sbjct: 226 STTYDPLAVFGSSSGYGISPDL 247



 Score =  192 bits (487), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 56/215 (26%), Positives = 98/215 (45%), Gaps = 8/215 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  ++ +    S+DI   L   VSK P V+ E  YYR +I  + ++D+F+ D RL++YAL
Sbjct: 1   MTSTYTSYRLISQDIGKSL-ERVSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYAL 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA GL DM++A+ FI+K+L    +D  +  N+L+  +Y   A+S DF+       +    
Sbjct: 60  KANGLEDMAYAKAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATATEAA 119

Query: 120 KT-IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           ++ II  Y +Q+ + +        +   YF +    I S      D  L      ++++ 
Sbjct: 120 QSGIISKYTRQTLEQEAGGDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTAYNLP 179

Query: 175 PKYISLPFLKD-VLTLGLANPKKYFIESRDNRFRA 208
            +  +    K   L     N K      +  +   
Sbjct: 180 DEIAAGSVEKQAALIEKSINIKDLQNPEKVGKLLE 214



 Score =  102 bits (253), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/172 (18%), Positives = 66/172 (38%), Gaps = 1/172 (0%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
             K+     E++Y+R  I  + SVD    D RL +Y L++  +     +  F++ VLT G
Sbjct: 22  VSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYALKANGLEDMAYAKAFIRKVLTEG 81

Query: 191 LANPKKYFIESRDNRFRAMAENFRF-QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP 249
            A+   +  +  D+R+  +A++  F     + +  +   + +  +               
Sbjct: 82  TADKNAFANKLSDSRYSDLAKSLDFASLGAAATATEAAQSGIISKYTRQTLEQEAGGDNN 141

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQ 301
            V    Y++    ++ S  DFL D  L ++ + +    +             
Sbjct: 142 GVRLALYFERKAPTIKSGLDFLADDALAQVFRTAYNLPDEIAAGSVEKQAAL 193



 Score = 94.9 bits (234), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 63/204 (30%), Gaps = 33/204 (16%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
           ++     +    + Y+  +G +KS+D+ ++                   +AL A  L   
Sbjct: 21  RVSKQPDVARETEYYRSKIGSVKSVDDFMADTR-------------LYNYALKANGLEDM 67

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +R VLT   +D +++ANK  D R   L  + +F + G+            I   
Sbjct: 68  AYAKAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATATEAAQSGIISKY 127

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
            +    ++    +                           Y+     TI S  + LA+  
Sbjct: 128 TRQTLEQEAGGDN--------------------NGVRLALYFERKAPTIKSGLDFLADDA 167

Query: 526 ILNFLLESKGIDSQKVREDFLCEI 549
           +      +  +  +        + 
Sbjct: 168 LAQVFRTAYNLPDEIAAGSVEKQA 191



 Score = 39.8 bits (91), Expect = 1.9,   Method: Composition-based stats.
 Identities = 29/171 (16%), Positives = 54/171 (31%), Gaps = 13/171 (7%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN---- 288
           I + +            +  +  YY+  I SV S  DF+ D +L+     +    +    
Sbjct: 11  ISQDIGKSLERVSKQPDVARETEYYRSKIGSVKSVDDFMADTRLYNYALKANGLEDMAYA 70

Query: 289 --------PEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL 340
                    E TADK     + +D   S +            +++T+  Q   I K    
Sbjct: 71  KAFIRKVLTEGTADKNAFANKLSDSRYSDLAKSLDFASLGAAATATEAAQSGIISKYTRQ 130

Query: 341 YKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPII 391
                +   D+    L   ++     IKS  + L+     +   +A     
Sbjct: 131 -TLEQEAGGDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTAYNLPD 180


>gi|84502363|ref|ZP_01000499.1| hypothetical protein OB2597_20146 [Oceanicola batsensis HTCC2597]
 gi|84389175|gb|EAQ01972.1| hypothetical protein OB2597_20146 [Oceanicola batsensis HTCC2597]
          Length = 274

 Score =  225 bits (574), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 45/265 (16%), Positives = 112/265 (42%), Gaps = 17/265 (6%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           + +      R + +    ++++  NI  + + ++LL ++ +  F++ +  ++ Q   +  
Sbjct: 19  TRDTQLDLIRNSAQHKRAIEHFKANIKDVETVDQLLEDQELYAFVMRAFDLEDQIFGKAM 78

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++ KS++++  +  N   D R++E+ +   F   GE +   I     N       D Y
Sbjct: 79  IEKVLKSNIEENDALVNRLTDPRFREMYNELGFGTDGEGNLNTILNTWQNRM----VDRY 134

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
             +      EE++  + +AL F+  + +I + ++IL D+++ +     L L    + +  
Sbjct: 135 VERQFINFTEEQNETVGIALEFRNKVGDINSVFDILKDNQMTRFFQTALGLPSQMSGIDI 194

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDD 725
            K+  +L+  I ++   D + V+  +    A+         AL  +  Q+         +
Sbjct: 195 DKQAELLESKIDLDTLSDPEVVDKLVRKYVAI-------SDALSGTSTQSNGALQMLTGN 247

Query: 726 PQNN------VSLQLSPQKKSNGRF 744
             N       +++ + P   S  RF
Sbjct: 248 SGNAAASIIEITMNIDPVSYSASRF 272



 Score =  160 bits (404), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 40/259 (15%), Positives = 105/259 (40%), Gaps = 28/259 (10%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++D Q  L    ++         +++  IK + T+D+ ++D+ L+++ ++AF L D    
Sbjct: 19  TRDTQLDLIRNSAQH---KRAIEHFKANIKDVETVDQLLEDQELYAFVMRAFDLEDQIFG 75

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK---VIQSDIQHKTIIQDYK 127
           +  I+K+L+S++ +  +LVN+L   +++       F    +       +     ++  Y 
Sbjct: 76  KAMIEKVLKSNIEENDALVNRLTDPRFREMYNELGFGTDGEGNLNTILNTWQNRMVDRYV 135

Query: 128 QS----HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
           +        ++   +  +  FR  +  INSV  + KD ++  +   +  +  +   +   
Sbjct: 136 ERQFINFTEEQNETVGIALEFRNKVGDINSVFDILKDNQMTRFFQTALGLPSQMSGIDID 195

Query: 184 KD--VLTLG-----LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKI 236
           K   +L        L++P+      R  ++ A+++                 ++  ++ +
Sbjct: 196 KQAELLESKIDLDTLSDPEVVDKLVR--KYVAISDAL---------SGTSTQSNGALQML 244

Query: 237 VSNYFNNTIDCVPIVSDQN 255
             N  N     + I  + +
Sbjct: 245 TGNSGNAAASIIEITMNID 263



 Score = 74.1 bits (180), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 33/196 (16%), Positives = 71/196 (36%), Gaps = 31/196 (15%)

Query: 354 QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLR 413
           +  I+ ++  +  ++++D LL                    F + A++L  Q   +  + 
Sbjct: 34  KRAIEHFKANIKDVETVDQLLED-------------QELYAFVMRAFDLEDQIFGKAMIE 80

Query: 414 NVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRK 473
            VL SN  + D+  N+  D R  ++ +   F  DG               + + +    +
Sbjct: 81  KVLKSNIEENDALVNRLTDPRFREMYNELGFGTDGEGN-----------LNTILNTWQNR 129

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
                 E +  N  E+ +    I LE       +   +  I+S  ++L + ++  F   +
Sbjct: 130 MVDRYVERQFINFTEEQNETVGIALE-------FRNKVGDINSVFDILKDNQMTRFFQTA 182

Query: 534 KGIDSQKVREDFLCEI 549
            G+ SQ    D   + 
Sbjct: 183 LGLPSQMSGIDIDKQA 198



 Score = 43.3 bits (100), Expect = 0.16,   Method: Composition-based stats.
 Identities = 22/205 (10%), Positives = 65/205 (31%), Gaps = 19/205 (9%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           +E+      +   +         ++K  I  V +    L+D +L+  +  +    +    
Sbjct: 16  VEQTRDTQLDLIRNSAQHKRAIEHFKANIKDVETVDQLLEDQELYAFVMRAFDLEDQIFG 75

Query: 293 ADKFLTLMQENDP----------IVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYK 342
                 +++ N                 + + ++ F  D   +     ++   +M+D Y 
Sbjct: 76  KAMIEKVLKSNIEENDALVNRLTDPRFREMYNELGFGTDGEGNLNTILNTWQNRMVDRYV 135

Query: 343 KNCQILHDDKMQSLIK---DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
           +   I   ++    +    +++  +G I S+ ++L          +A      +      
Sbjct: 136 ERQFINFTEEQNETVGIALEFRNKVGDINSVFDILKDNQMTRFFQTALGLPSQMS----- 190

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPD 424
             +++          +     SDP+
Sbjct: 191 -GIDIDKQAELLESKIDLDTLSDPE 214


>gi|254500914|ref|ZP_05113065.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436985|gb|EEE43664.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 276

 Score =  225 bits (572), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 56/267 (20%), Positives = 105/267 (39%), Gaps = 15/267 (5%)

Query: 462 IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL 521
            +D  +       +         N+M++       +  ++ + +YY  NI  I S ++ +
Sbjct: 3   FQDTYRLKGADMINTLTQVQIVRNNMDRSLATVAADPVVDRQTEYYRENIRNIKSVDDFM 62

Query: 522 ANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
           A+ RI  + + + G++     + F+ ++         +FAN   D++Y+    +FNF  +
Sbjct: 63  ADDRIYRYAMTAMGLEDMIYAKAFMRKVLTEGTASRAAFANQLADSKYRNFAETFNFANY 122

Query: 582 GELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEIL 641
           GE +         +   +   D +  Q +E KE  ++  + LALYF+R    I   ++IL
Sbjct: 123 GETATS------FSRTQEGIVDKFHRQTLEVKEGAQNDGVRLALYFERKASEITGPFDIL 176

Query: 642 GDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDF-KDSKKVEDFLYAAKAMDHQ 700
            D  L + V   L L   FA+    K+     KH+       D + +  FL    AM   
Sbjct: 177 ADRALAETVRTALGLPDAFALTDIDKQAEYFDKHLDYEKLSSDPEYLSKFLERFSAM--- 233

Query: 701 SIDYKKALFSSPNQNKDPWNNSFDDPQ 727
             D      ++      P    F    
Sbjct: 234 -YDLSNGAQTAA----APTLAVFGPGP 255



 Score =  189 bits (480), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 54/236 (22%), Positives = 103/236 (43%), Gaps = 10/236 (4%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI +       ++   +  +TV+ DP+V  +  YYRE I++I ++D+F+ D R++ YA+ 
Sbjct: 14  MINTLTQVQIVRNNMDRSLATVAADPVVDRQTEYYRENIRNIKSVDDFMADDRIYRYAMT 73

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHK 120
           A GL DM +A+ F++K+L    +   +  NQL   KY+ FA +++F+   +   S  + +
Sbjct: 74  AMGLEDMIYAKAFMRKVLTEGTASRAAFANQLADSKYRNFAETFNFANYGETATSFSRTQ 133

Query: 121 T-IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             I+  + +Q+ + KE    +  +   YF +   +I     +  DR L + V  +  +  
Sbjct: 134 EGIVDKFHRQTLEVKEGAQNDGVRLALYFERKASEITGPFDILADRALAETVRTALGLPD 193

Query: 176 KYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
            +      K            Y   S D  +      F  +        +   T  
Sbjct: 194 AFALTDIDKQA--EYFDKHLDYEKLSSDPEYL---SKFLERFSAMYDLSNGAQTAA 244



 Score = 93.7 bits (231), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 35/173 (20%), Positives = 70/173 (40%), Gaps = 7/173 (4%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
              + V   +++Y+R+NI  I SVD    D R+  Y + +  +     +  F++ VLT G
Sbjct: 35  VAADPVVDRQTEYYRENIRNIKSVDDFMADDRIYRYAMTAMGLEDMIYAKAFMRKVLTEG 94

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR----DKILTDMQIEKIVSNYFNNTID 246
            A+   +  +  D+++R  AE F F   G  +       + + D    + +        D
Sbjct: 95  TASRAAFANQLADSKYRNFAETFNFANYGETATSFSRTQEGIVDKFHRQTLEVKEGAQND 154

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
            V +     Y++   + ++   D L D  L + ++ +L   +     D     
Sbjct: 155 GVRLAL---YFERKASEITGPFDILADRALAETVRTALGLPDAFALTDIDKQA 204



 Score = 84.5 bits (207), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 26/204 (12%), Positives = 63/204 (30%), Gaps = 33/204 (16%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
            +  D  +    + Y+  +  IKS+D+ ++                  ++A+ A  L   
Sbjct: 34  TVAADPVVDRQTEYYRENIRNIKSVDDFMADDR-------------IYRYAMTAMGLEDM 80

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +R VLT   +   ++AN+  D +       FNF   G         +  +    
Sbjct: 81  IYAKAFMRKVLTEGTASRAAFANQLADSKYRNFAETFNFANYGE--------TATSFSRT 132

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
            +   ++         +   +                   Y+    + I    ++LA++ 
Sbjct: 133 QEGIVDKFHRQTLEVKEGAQNDGV------------RLALYFERKASEITGPFDILADRA 180

Query: 526 ILNFLLESKGIDSQKVREDFLCEI 549
           +   +  + G+       D   + 
Sbjct: 181 LAETVRTALGLPDAFALTDIDKQA 204



 Score = 43.7 bits (101), Expect = 0.14,   Method: Composition-based stats.
 Identities = 16/176 (9%), Positives = 49/176 (27%), Gaps = 13/176 (7%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           +   +            +     YY+  I ++ S  DF+ D ++++    ++   +    
Sbjct: 24  VRNNMDRSLATVAADPVVDRQTEYYRENIRNIKSVDDFMADDRIYRYAMTAMGLEDMIYA 83

Query: 293 ----------ADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYK 342
                                        +    NF     ++T     +Q   +   ++
Sbjct: 84  KAFMRKVLTEGTASRAAFANQLADSKYRNFAETFNFANYGETATSF-SRTQEGIVDKFHR 142

Query: 343 KNCQILHDDKMQ--SLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
           +  ++    +     L   ++    +I    ++L+ +   E   +A          
Sbjct: 143 QTLEVKEGAQNDGVRLALYFERKASEITGPFDILADRALAETVRTALGLPDAFALT 198


>gi|158424043|ref|YP_001525335.1| hypothetical protein AZC_2419 [Azorhizobium caulinodans ORS 571]
 gi|158330932|dbj|BAF88417.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 325

 Score =  224 bits (571), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 54/250 (21%), Positives = 99/250 (39%), Gaps = 18/250 (7%)

Query: 479 AENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDS 538
             +    + ++   Q+        E   +  +I +I S ++ + N R+  + +++ G++ 
Sbjct: 78  TYSYLSKNYDKALEQEATTGSTKLETANFEKSIGSITSVDDFVNNYRVFTYAMKAYGLED 137

Query: 539 QKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHI 598
               + ++ ++ +SDL D  SFAN+  D R+K    +F    +GE              +
Sbjct: 138 MAYAKAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQSLTYGEAVSSDT--------V 189

Query: 599 DDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSP 658
                 Y  Q +E      D  + LALYFKR    + + Y IL D  L+KVV     +  
Sbjct: 190 STVETKYAQQTMEDNAGASDTGVQLALYFKRNASTVTSAYSILADEALYKVVKATYNIPD 249

Query: 659 YFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDP 718
             +      +  ++ KHI I + +D   V+  L           D +       N   DP
Sbjct: 250 EMSNAGIEAQAALISKHIDIEELQDPDYVDKLLKQFSI----KYDIEN------NSASDP 299

Query: 719 WNNSFDDPQN 728
               F+D  +
Sbjct: 300 VLQLFNDTSS 309



 Score =  168 bits (424), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 48/258 (18%), Positives = 110/258 (42%), Gaps = 13/258 (5%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
            +++          K     +       E   + + I  I+++D+F+ + R+F+YA+KA+
Sbjct: 74  STYLTYSYLSKNYDKALEQEATTGSTKLETANFEKSIGSITSVDDFVNNYRVFTYAMKAY 133

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTI 122
           GL DM++A+ ++KK+LESDL+D  S  N L+  +++ FA+++      + + SD      
Sbjct: 134 GLEDMAYAKAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQSLTYGEAVSSDTVSTVE 193

Query: 123 IQDYKQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
            +  +Q+ +     +    +   YF++N   + S   +  D  L   V  +++I  +  +
Sbjct: 194 TKYAQQTMEDNAGASDTGVQLALYFKRNASTVTSAYSILADEALYKVVKATYNIPDEMSN 253

Query: 180 LPFLKD-VLTLGLANPKKYFIESRDNRFRA-MAENFRFQPDGSLSKRDKILTDMQIEKIV 237
                   L     +      E +D  +   + + F  + D   +      +D  ++   
Sbjct: 254 AGIEAQAALISKHID----IEELQDPDYVDKLLKQFSIKYDIENNSA----SDPVLQLFN 305

Query: 238 SNYFNNTIDCVPIVSDQN 255
                ++     I++ + 
Sbjct: 306 DTSSVSSDTAGAILNLKY 323



 Score =  102 bits (254), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 75/184 (40%), Gaps = 7/184 (3%)

Query: 122 IIQDYKQSHQHKEEVALE--ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           + ++Y ++ + +        E+  F K+I  I SVD    + R+  Y ++++ +     +
Sbjct: 82  LSKNYDKALEQEATTGSTKLETANFEKSIGSITSVDDFVNNYRVFTYAMKAYGLEDMAYA 141

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM--QIEKIV 237
             ++K VL   L +   +     D RF+A A+ F+    G     D + T      ++ +
Sbjct: 142 KAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQSLTYGEAVSSDTVSTVETKYAQQTM 201

Query: 238 SNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
            +    +   V +     Y+K   ++V+S    L D  L+K+++ +    +    A    
Sbjct: 202 EDNAGASDTGVQLAL---YFKRNASTVTSAYSILADEALYKVVKATYNIPDEMSNAGIEA 258

Query: 298 TLMQ 301
               
Sbjct: 259 QAAL 262



 Score = 91.4 bits (225), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 36/258 (13%), Positives = 77/258 (29%), Gaps = 41/258 (15%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
           Q       +    +++  +G I S+D+ ++                   +A+ AY L   
Sbjct: 92  QEATTGSTKLETANFEKSIGSITSVDDFVNNYR-------------VFTYAMKAYGLEDM 138

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  ++ VL S+ +D  S+AN   D R      AF                       
Sbjct: 139 AYAKAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQ---------------------- 176

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
              Y     S   +  ++  + + +      +        Y+  N +T+ S   +LA++ 
Sbjct: 177 SLTYGEAVSSDTVSTVETKYAQQTMEDNAGASDTGVQLALYFKRNASTVTSAYSILADEA 236

Query: 526 ILNFLLESKGIDSQKVREDF-LCEIFKSDLKDPKSFANTYKDNRYKE-IISSFNFDIHGE 583
           +   +  +  I  +             S   D        +D  Y + ++  F+     E
Sbjct: 237 LYKVVKATYNIPDEMSNAGIEAQAALISKHID----IEELQDPDYVDKLLKQFSIKYDIE 292

Query: 584 LSHKKIGKVQDNFHIDDT 601
            +      +Q        
Sbjct: 293 NNSASDPVLQLFNDTSSV 310



 Score = 46.4 bits (108), Expect = 0.018,   Method: Composition-based stats.
 Identities = 22/230 (9%), Positives = 64/230 (27%), Gaps = 28/230 (12%)

Query: 216 QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPK 275
               ++      LT   + K                 +   ++ +I S++S  DF+ + +
Sbjct: 65  GCPMTIDLGSTYLTYSYLSKNYDKALEQEATTGSTKLETANFEKSIGSITSVDDFVNNYR 124

Query: 276 LFKMLQLSLFPLN-------------PEITADKFLTLMQENDPIVSQVKYFFQINFHRDN 322
           +F     +    +              ++T D        +    +  + F  +      
Sbjct: 125 VFTYAMKAYGLEDMAYAKAYMKKVLESDLTDDSSFANSLSDGRFKAFAQAFQSL------ 178

Query: 323 SSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQ--SLIKDYQLPLGKIKSIDNLLSGKCQL 380
           +    +  D+         ++  +           L   ++     + S  ++L+ +   
Sbjct: 179 TYGEAVSSDTVSTVETKYAQQTMEDNAGASDTGVQLALYFKRNASTVTSAYSILADEALY 238

Query: 381 EGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKS 430
           +   +           +    +  Q       +++      DPD Y +K 
Sbjct: 239 KVVKATYNIPDE----MSNAGIEAQAALIS--KHIDIEELQDPD-YVDKL 281


>gi|209963548|ref|YP_002296463.1| hypothetical protein RC1_0201 [Rhodospirillum centenum SW]
 gi|209957014|gb|ACI97650.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 508

 Score =  223 bits (568), Expect = 9e-56,   Method: Composition-based stats.
 Identities = 70/542 (12%), Positives = 155/542 (28%), Gaps = 58/542 (10%)

Query: 216 QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN---YYKLAINSVSSFSDFLK 272
               +        +  Q   +           +    ++    Y +  + SV +  + + 
Sbjct: 5   GFGAATVSGGTGSSITQWRLLGRTADRQKTVMMSDPVNKADTQYARAKLASVGTVDELMS 64

Query: 273 DPKLFKMLQLSLFPLNPE----------ITADKFLTLMQENDPIVSQVKYFFQINFHRDN 322
           D +L+  +  +    +             +     +            +     NF  D+
Sbjct: 65  DRRLYSYVMRAFGLEDQINSQALVRKILTSDLSDPSSAANRIADPRFRELAAAFNFGADS 124

Query: 323 SSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEG 382
            S +K       Q      ++  +     K +SL                       +  
Sbjct: 125 KSKSKTSPSFINQIADLYVRERYEESVSSKNESL---------------------GMMLD 163

Query: 383 PNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAF 442
                    +    +            + +  V+      P         ++   L    
Sbjct: 164 FTRNLPTKRSWAEVM----------ADEGMAQVVRIIYDLPKPIGPVDAAEQAKSLEATI 213

Query: 443 NFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE--NKSFNSMEQISTQKRINLEI 500
            F+   ++  +              +   R  SI           S ++         ++
Sbjct: 214 KFSVFTTVTSVQSAFRDDFFDVWDANGNPRGSSIPSKVQWEMLARSYDREKAAFATRYDV 273

Query: 501 NSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSF 560
            S+V   T  I T+ S ++LL ++++L  +L++  ++ +   + +L ++ +SD     SF
Sbjct: 274 KSDVAALTKTIPTLDSVDDLLNDRKLLPIVLKAFDLEDKATDKTYLRKVLESDPNSATSF 333

Query: 561 ANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPN 620
           A        K +  +F     G               ++D  + Y  Q  E      +  
Sbjct: 334 AAKAGPEE-KALALAFGMTNSGAKRRG------SPAFVEDIVNRYTTQSFEVSAGNANEA 386

Query: 621 IALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIND 680
           + L LYF+R    + + Y++L D  L KV    L L    A +   +++ +L   + I  
Sbjct: 387 LRLGLYFQRKAGGLTSWYQVLADQALAKVARLALNLPSQSAQIDLDRQVDMLSSKLDIKK 446

Query: 681 FKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKS 740
            +D  +V   +     M     D      +  +    P            SL  S    +
Sbjct: 447 LQDPAEVGKLIEKFLLM----WDVT-GEDNGNSAAASPLVQLLSGNGGRTSLDPSTLLAA 501

Query: 741 NG 742
             
Sbjct: 502 AS 503



 Score =  157 bits (396), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 68/448 (15%), Positives = 141/448 (31%), Gaps = 30/448 (6%)

Query: 107 SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDY 166
                 I             +++    + V   +++Y R  +  + +VD+L  DRRL  Y
Sbjct: 13  GGTGSSITQWRLLGRTADR-QKTVMMSDPVNKADTQYARAKLASVGTVDELMSDRRLYSY 71

Query: 167 VLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDK 226
           V+++F +  +  S   ++ +LT  L++P        D RFR +A  F F  D     +  
Sbjct: 72  VMRAFGLEDQINSQALVRKILTSDLSDPSSAANRIADPRFRELAAAFNFGADSKSKSKTS 131

Query: 227 ILTDMQIEK--IVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
                QI    +   Y  +       +     +   + +  S+++ + D  + +++++  
Sbjct: 132 PSFINQIADLYVRERYEESVSSKNESLGMMLDFTRNLPTKRSWAEVMADEGMAQVVRIIY 191

Query: 285 FPLNPEITADKFLTLMQENDPIV---SQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
               P    D           I           Q  F  D         + +   +    
Sbjct: 192 DLPKPIGPVDAAEQAKSLEATIKFSVFTTVTSVQSAFRDDFFDVWDANGNPRGSSIPS-- 249

Query: 342 KKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
           K   ++L     +           K   +  L      L+  +        L   L A++
Sbjct: 250 KVQWEMLARSYDREKAAFATRYDVK-SDVAALTKTIPTLDSVDDLLNDRKLLPIVLKAFD 308

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
           L  +  D+  LR VL S+P+   S+A K+  +    L  AF     G+            
Sbjct: 309 LEDKATDKTYLRKVLESDPNSATSFAAKAGPEE-KALALAFGMTNSGAKRRGSPAFVEDI 367

Query: 462 IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL 521
           +               +                           Y+      + S+ ++L
Sbjct: 368 VNRYTTQSFEVSAGNANEAL--------------------RLGLYFQRKAGGLTSWYQVL 407

Query: 522 ANKRILNFLLESKGIDSQKVREDFLCEI 549
           A++ +      +  + SQ  + D   ++
Sbjct: 408 ADQALAKVARLALNLPSQSAQIDLDRQV 435



 Score =  154 bits (389), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 61/393 (15%), Positives = 134/393 (34%), Gaps = 25/393 (6%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
            DP+   + +Y R ++  + T+DE + D+RL+SY ++AFGL D  +++  ++KIL SDLS
Sbjct: 38  SDPVNKADTQYARAKLASVGTVDELMSDRRLYSYVMRAFGLEDQINSQALVRKILTSDLS 97

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH--KTIIQDYKQSHQHKEEVALEES 141
           DP S  N++   +++  A +++F    K            I   Y +    +   +  ES
Sbjct: 98  DPSSAANRIADPRFRELAAAFNFGADSKSKSKTSPSFINQIADLYVRERYEESVSSKNES 157

Query: 142 ----KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKY 197
                 F +N+    S  ++  D  +   V   + +      +   +   +L        
Sbjct: 158 LGMMLDFTRNLPTKRSWAEVMADEGMAQVVRIIYDLPKPIGPVDAAEQAKSLEATIKFSV 217

Query: 198 ------FIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV 251
                    +  + F  + +        S+  + +      + +              + 
Sbjct: 218 FTTVTSVQSAFRDDFFDVWDANGNPRGSSIPSKVQWEM---LARSYDREKAAFATRYDVK 274

Query: 252 SDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-------KFLTLMQEND 304
           SD       I ++ S  D L D KL  ++  +    +                       
Sbjct: 275 SDVAALTKTIPTLDSVDDLLNDRKLLPIVLKAFDLEDKATDKTYLRKVLESDPNSATSFA 334

Query: 305 PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK---DYQ 361
                 +    + F   NS + +    + ++ +++ Y      +        ++    +Q
Sbjct: 335 AKAGPEEKALALAFGMTNSGAKRRGSPAFVEDIVNRYTTQSFEVSAGNANEALRLGLYFQ 394

Query: 362 LPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQ 394
              G + S   +L+ +   +    A        
Sbjct: 395 RKAGGLTSWYQVLADQALAKVARLALNLPSQSA 427



 Score =  109 bits (272), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/247 (14%), Positives = 84/247 (34%), Gaps = 8/247 (3%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
            +  +    V  +     + I  + ++D+ + D++L    LKAF L D +  + +++K+L
Sbjct: 264 KAAFATRYDVKSDVAALTKTIPTLDSVDDLLNDRKLLPIVLKAFDLEDKATDKTYLRKVL 323

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVA 137
           ESD +   S   +    + +  A ++   +   K   S    + I+  Y           
Sbjct: 324 ESDPNSATSFAAK-AGPEEKALALAFGMTNSGAKRRGSPAFVEDIVNRYTTQSFEVSAGN 382

Query: 138 LEES----KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLAN 193
             E+     YF++    + S  Q+  D+ L      + ++  +   +   + V    L++
Sbjct: 383 ANEALRLGLYFQRKAGGLTSWYQVLADQALAKVARLALNLPSQSAQIDLDRQV--DMLSS 440

Query: 194 PKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD 253
                          + E F    D +            + +++S     T      +  
Sbjct: 441 KLDIKKLQDPAEVGKLIEKFLLMWDVTGEDNGNSAAASPLVQLLSGNGGRTSLDPSTLLA 500

Query: 254 QNYYKLA 260
               +  
Sbjct: 501 AASLRRR 507


>gi|15964408|ref|NP_384761.1| hypothetical protein SMc03023 [Sinorhizobium meliloti 1021]
 gi|307318905|ref|ZP_07598336.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
 gi|15073585|emb|CAC45227.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306895319|gb|EFN26074.1| protein of unknown function DUF1217 [Sinorhizobium meliloti AK83]
          Length = 259

 Score =  223 bits (567), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 59/256 (23%), Positives = 107/256 (41%), Gaps = 11/256 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             + + +       + +   +     ++  E +YY   I +I + ++  A+ R+ N+ ++
Sbjct: 1   MTTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++    +    +FAN   D RYK ++ S NF  HGE +       
Sbjct: 61  AHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATA----- 115

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
                     + Y  Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV  
Sbjct: 116 -FERAQKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM-----DHQSIDYKKA 707
            L+L   FA     ++    +  I   DF+D +K+ +FL    A+          D    
Sbjct: 175 VLQLPAEFAAADVDRQADAYEAAIDFKDFQDPQKIAEFLDRFTALWEIDNSSDGYDPLAV 234

Query: 708 LFSSPNQNKDPWNNSF 723
             +S      P     
Sbjct: 235 FGASSGYGISPDLLLT 250



 Score =  170 bits (429), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 44/191 (23%), Positives = 89/191 (46%), Gaps = 7/191 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  ++ +    + D+   L   VS  P V+ E  YY  +I  I T+D+F  D RL++YA+
Sbjct: 1   MTTTYTSYRLITADLTKSL-ERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+   +   +  + 
Sbjct: 60  KAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERA 119

Query: 120 KT-IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           +  + + Y +Q+ + K        +   YF++    I +  ++  D  L   V     + 
Sbjct: 120 QKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLP 179

Query: 175 PKYISLPFLKD 185
            ++ +    + 
Sbjct: 180 AEFAAADVDRQ 190



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 67/177 (37%), Gaps = 1/177 (0%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
              +     E++Y+   I  I ++D  F D RL +Y +++  +     +  F++ VL  G
Sbjct: 22  VSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAFMRKVLAEG 81

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR-DKILTDMQIEKIVSNYFNNTIDCVP 249
           + +   +  +  D R++A+ E+  F   G  +   ++    +  +           +   
Sbjct: 82  IDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQKGVAEKYTRQTLEQKAGEENT 141

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
            V    Y++    ++++  + + D  L  +++  L        AD           I
Sbjct: 142 GVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLPAEFAAADVDRQADAYEAAI 198



 Score = 75.6 bits (184), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 66/213 (30%), Gaps = 33/213 (15%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             DL K   ++     +    + Y   +G IK++D+  +                   +A
Sbjct: 12  TADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSR-------------LYNYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + A+ L      +  +R VL       D++ANK  D R   L  + NF   G        
Sbjct: 59  MKAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGE----AAT 114

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
                 +   + Y  +       E  +                      Y+     TI +
Sbjct: 115 AFERAQKGVAEKYTRQTLEQKAGEENTGV----------------RLALYFQRMAPTIAN 158

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
             E++A++ + + +     + ++    D   + 
Sbjct: 159 GYEIIADEALSSVVRTVLQLPAEFAAADVDRQA 191


>gi|307311550|ref|ZP_07591191.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
 gi|306899567|gb|EFN30196.1| protein of unknown function DUF1217 [Sinorhizobium meliloti BL225C]
          Length = 259

 Score =  222 bits (565), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 56/235 (23%), Positives = 105/235 (44%), Gaps = 10/235 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             + + +       + +   +     ++  E +YY   I +I + ++  A+ R+ N+ ++
Sbjct: 1   MTTTYTSYRLITADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++    +    +FAN   D RYK ++ S NF  HGE +       
Sbjct: 61  AHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATA----- 115

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
                     + Y  Q +E+K  E++  + LALYF+R  P I N YEI+ D  L  VV  
Sbjct: 116 -FERAQKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKA 707
            L+L   FA     ++    +  I   DF+D +K+ +FL    A+     +   +
Sbjct: 175 VLQLPAEFAAADVDRQADAYEAAIDFKDFQDPQKIAEFLDRFTAL----WEIDNS 225



 Score =  170 bits (431), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 44/191 (23%), Positives = 89/191 (46%), Gaps = 7/191 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  ++ +    + D+   L   VS  P V+ E  YY  +I  I T+D+F  D RL++YA+
Sbjct: 1   MTTTYTSYRLITADLTKSL-ERVSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA GL DM++A+ F++K+L   +    +  N+L   +Y+    S +F+   +   +  + 
Sbjct: 60  KAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGEAATAFERA 119

Query: 120 KT-IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           +  + + Y +Q+ + K        +   YF++    I +  ++  D  L   V     + 
Sbjct: 120 QKGVAEKYTRQTLEQKAGEENTGVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLP 179

Query: 175 PKYISLPFLKD 185
            ++ +    + 
Sbjct: 180 AEFAAADVDRQ 190



 Score = 92.6 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 28/177 (15%), Positives = 67/177 (37%), Gaps = 1/177 (0%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
              +     E++Y+   I  I ++D  F D RL +Y +++  +     +  F++ VL  G
Sbjct: 22  VSAQPDVARETEYYLSKIGSIKTLDDFFADSRLYNYAMKAHGLEDMAYAKAFMRKVLAEG 81

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR-DKILTDMQIEKIVSNYFNNTIDCVP 249
           + +   +  +  D R++A+ E+  F   G  +   ++    +  +           +   
Sbjct: 82  IDSDDAFANKLADGRYKALVESLNFARHGEAATAFERAQKGVAEKYTRQTLEQKAGEENT 141

Query: 250 IVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
            V    Y++    ++++  + + D  L  +++  L        AD           I
Sbjct: 142 GVRLALYFQRMAPTIANGYEIIADEALSSVVRTVLQLPAEFAAADVDRQADAYEAAI 198



 Score = 76.0 bits (185), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/213 (15%), Positives = 66/213 (30%), Gaps = 33/213 (15%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             DL K   ++     +    + Y   +G IK++D+  +                   +A
Sbjct: 12  TADLTKSLERVSAQPDVARETEYYLSKIGSIKTLDDFFADSR-------------LYNYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + A+ L      +  +R VL       D++ANK  D R   L  + NF   G        
Sbjct: 59  MKAHGLEDMAYAKAFMRKVLAEGIDSDDAFANKLADGRYKALVESLNFARHGE----AAT 114

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
                 +   + Y  +       E  +                      Y+     TI +
Sbjct: 115 AFERAQKGVAEKYTRQTLEQKAGEENTGV----------------RLALYFQRMAPTIAN 158

Query: 517 FEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
             E++A++ + + +     + ++    D   + 
Sbjct: 159 GYEIIADEALSSVVRTVLQLPAEFAAADVDRQA 191


>gi|240137254|ref|YP_002961723.1| hypothetical protein MexAM1_META1p0505 [Methylobacterium extorquens
           AM1]
 gi|240007220|gb|ACS38446.1| hypothetical protein MexAM1_META1p0505 [Methylobacterium extorquens
           AM1]
          Length = 417

 Score =  222 bits (564), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 74/426 (17%), Positives = 142/426 (33%), Gaps = 66/426 (15%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             +  +   I  Y+  +G++KS+D+LL  +                 +A+ AY L     
Sbjct: 23  AAEPTVAREIAYYEAHIGQVKSVDDLLGDQR-------------LYAYAMKAYGLEDMTY 69

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R VL    +   S+AN+  DDR      AF+F            Q       +  
Sbjct: 70  AKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPA 118

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI- 526
            +  + R+   +  K        S +   +  + S +D  T    TI    + LA +   
Sbjct: 119 RFGEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGQVAN 178

Query: 527 -------------------------LNFLLESKG---IDSQKVREDFLCEIFKSDLKDPK 558
                                    +   L + G    ++  + +      +    +D  
Sbjct: 179 PAKVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGRDAD 238

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           +  N    NR   I ++        +       +  +         Y  Q +E +  + D
Sbjct: 239 TLVNAGGPNRTLTIRNAPLSANRTAVDVGFGTDLGPDSMAQAVTQAYLRQSLESEAGDAD 298

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER---KKIRILKKH 675
             + LALYF R   +I + Y+ILGD+ L +V +  + L             K+ +++ + 
Sbjct: 299 TGVRLALYFARKASSIASAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIDRK 358

Query: 676 IKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLS 735
           I I  F+D  K++ F+    A+     D +       N    P    F    +  +  L 
Sbjct: 359 IDIASFRDPAKLDAFVRRFAAI----WDAQN------NTASAPILALFTGTGSLDAETLQ 408

Query: 736 PQKKSN 741
             + + 
Sbjct: 409 SVQSAR 414



 Score =  180 bits (457), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 58/353 (16%), Positives = 115/353 (32%), Gaps = 58/353 (16%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +  +    +KD+ + L S  + +P V+ E  YY   I  + ++D+ + D+RL++YA+
Sbjct: 1   MTDTLTSYRLIAKDLPASL-SRKAAEPTVAREIAYYEAHIGQVKSVDDLLGDQRLYAYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS------------ 107
           KA+GL DM++A+ F++K+LE   +   S  N+L   +Y  FA+++ F             
Sbjct: 60  KAYGLEDMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPAR 119

Query: 108 -PPPKVIQSDIQHKTIIQDY------KQSHQHKEEVALEESKYFRKNIHKINSVDQLFK- 159
                   S    K +   Y      + S   +  +    ++     ++      Q+   
Sbjct: 120 FGEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGQVANP 179

Query: 160 -----------------DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA------NPKK 196
                               L   V    +              L    A      +   
Sbjct: 180 AKVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGRDADT 239

Query: 197 YFIESRDNRFRAMAEN----------FRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
                  NR   +               F  D       + +T   + + + +   +   
Sbjct: 240 LVNAGGPNRTLTIRNAPLSANRTAVDVGFGTDLGPDSMAQAVTQAYLRQSLESEAGDADT 299

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
            V +     Y+    +S++S  D L D  L ++    +        A      
Sbjct: 300 GVRLAL---YFARKASSIASAYDILGDAALSQVANTVIGLPATSGAATSEALA 349



 Score = 93.4 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 50/128 (39%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +       +    ++K     +  E+ YY  +I  + S ++LL ++R+  + ++
Sbjct: 1   MTDTLTSYRLIAKDLPASLSRKAAEPTVAREIAYYEAHIGQVKSVDDLLGDQRLYAYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +       SFAN   D+RY     +F+F      +     + 
Sbjct: 61  AYGLEDMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPARF 120

Query: 593 QDNFHIDD 600
            +      
Sbjct: 121 GEQARAAS 128


>gi|114706759|ref|ZP_01439659.1| hypothetical protein FP2506_18124 [Fulvimarina pelagi HTCC2506]
 gi|114537707|gb|EAU40831.1| hypothetical protein FP2506_18124 [Fulvimarina pelagi HTCC2506]
          Length = 260

 Score =  221 bits (562), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 57/274 (20%), Positives = 106/274 (38%), Gaps = 16/274 (5%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +       +     +   +  +      Y   I  I S +E LAN R+  + ++
Sbjct: 1   MLDASLSYRLISRDLPASLERTAQDPTVERASQRYLEEIGKISSIDEFLANDRVYRYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +  + D ++FAN   D+RYK+   +FNF+ +GE        +
Sbjct: 61  AMGLEDMTYAKAFMRKVMEEGIDDREAFANKLTDSRYKDFAETFNFNRYGEA------AL 114

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
                     D Y  Q +E+    +     LALYF+R    + ++Y +L D  + KV+  
Sbjct: 115 AFERTQQGIVDKYVRQTLEENTGTESEGARLALYFERKASTVTSYYGLLADPAILKVMQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHI-KINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSS 711
              +      L   K+  + +K +  I D KD +KV + L     +     D      + 
Sbjct: 175 AFSIPAETGTLDIDKQADLFRKALPNIEDLKDPQKVSELLQRFTTL----WDVNNVQAAP 230

Query: 712 PNQNKDPWNNSFDD-PQNNVSLQLSPQKKSNGRF 744
                 P    F +    +  L L+ Q   N  F
Sbjct: 231 ----TSPLLQLFGNGSGVSGDLLLTLQTYRNTAF 260



 Score =  188 bits (476), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 51/191 (26%), Positives = 101/191 (52%), Gaps = 7/191 (3%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ + ++    S+D+ + L    ++DP V    + Y E I  IS+IDEF+ + R++ YA+
Sbjct: 1   MLDASLSYRLISRDLPASL-ERTAQDPTVERASQRYLEEIGKISSIDEFLANDRVYRYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQ 118
           KA GL DM++A+ F++K++E  + D ++  N+L   +Y+ FA +++F+   +   + +  
Sbjct: 60  KAMGLEDMTYAKAFMRKVMEEGIDDREAFANKLTDSRYKDFAETFNFNRYGEAALAFERT 119

Query: 119 HKTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
            + I+  Y +Q+ +       E ++   YF +    + S   L  D  +L  +  +FSI 
Sbjct: 120 QQGIVDKYVRQTLEENTGTESEGARLALYFERKASTVTSYYGLLADPAILKVMQTAFSIP 179

Query: 175 PKYISLPFLKD 185
            +  +L   K 
Sbjct: 180 AETGTLDIDKQ 190



 Score = 96.1 bits (237), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/188 (16%), Positives = 76/188 (40%), Gaps = 7/188 (3%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
             ++      S+ + + I KI+S+D+   + R+  Y +++  +     +  F++ V+  G
Sbjct: 22  TAQDPTVERASQRYLEEIGKISSIDEFLANDRVYRYAMKAMGLEDMTYAKAFMRKVMEEG 81

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLS----KRDKILTDMQIEKIVSNYFNNTID 246
           + + + +  +  D+R++  AE F F   G  +    +  + + D  + + +     NT  
Sbjct: 82  IDDREAFANKLTDSRYKDFAETFNFNRYGEAALAFERTQQGIVDKYVRQTLEE---NTGT 138

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
                    Y++   ++V+S+   L DP + K++Q +        T D           +
Sbjct: 139 ESEGARLALYFERKASTVTSYYGLLADPAILKVMQTAFSIPAETGTLDIDKQADLFRKAL 198

Query: 307 VSQVKYFF 314
            +      
Sbjct: 199 PNIEDLKD 206



 Score = 94.5 bits (233), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 45/273 (16%), Positives = 85/273 (31%), Gaps = 41/273 (15%)

Query: 346 QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
           +   D  ++   + Y   +GKI SID  L+                  ++A+ A  L   
Sbjct: 21  RTAQDPTVERASQRYLEEIGKISSIDEFLANDR-------------VYRYAMKAMGLEDM 67

Query: 406 DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +  +R V+     D +++ANK  D R       FNFN  G          +  +   
Sbjct: 68  TYAKAFMRKVMEEGIDDREAFANKLTDSRYKDFAETFNFNRYGEAALAFERTQQGIVDKY 127

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
           V+                    + +        E      Y+    +T+ S+  LLA+  
Sbjct: 128 VR--------------------QTLEENTGTESEGARLALYFERKASTVTSYYGLLADPA 167

Query: 526 ILNFLLESKGIDSQKVR------EDFLCEIFK--SDLKDPKSFANTYKDNRYKEIISSFN 577
           IL  +  +  I ++          D   +      DLKDP+  +   +       +++  
Sbjct: 168 ILKVMQTAFSIPAETGTLDIDKQADLFRKALPNIEDLKDPQKVSELLQRFTTLWDVNNVQ 227

Query: 578 FDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMI 610
                 L          +  +  T   Y++   
Sbjct: 228 AAPTSPLLQLFGNGSGVSGDLLLTLQTYRNTAF 260


>gi|163850120|ref|YP_001638163.1| hypothetical protein Mext_0680 [Methylobacterium extorquens PA1]
 gi|163661725|gb|ABY29092.1| protein of unknown function DUF1217 [Methylobacterium extorquens
           PA1]
          Length = 417

 Score =  221 bits (562), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 72/421 (17%), Positives = 138/421 (32%), Gaps = 66/421 (15%)

Query: 353 MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQL 412
           +      Y+  +G++K++D+LL  +                 +A+ AY L      +  +
Sbjct: 28  VARETAYYEAHIGRVKTVDDLLGDQR-------------LYAYAMKAYGLEDMTYAKAFM 74

Query: 413 RNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANR 472
           R VL    +   S+AN+  DDR      AF+F            Q       +   +  +
Sbjct: 75  RKVLEEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPARFGEQ 123

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI------ 526
            R+   +  K        S +   +  + S +D  T    TI    + LA +        
Sbjct: 124 ARAASLSAPKLLADTYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGQVANPAKVT 183

Query: 527 --------------------LNFLLESKG---IDSQKVREDFLCEIFKSDLKDPKSFANT 563
                               +   L + G    ++  + +      +    +D  +  N 
Sbjct: 184 PAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGRDTDTLVNV 243

Query: 564 YKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIAL 623
              NR   I ++        +       +  +         Y  Q +E +  + D  + L
Sbjct: 244 GGPNRTLTIRNAPLSANRTAVDVGFGTDLGPDSMAQAVTQAYLRQSLESEAGDADTGVRL 303

Query: 624 ALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER---KKIRILKKHIKIND 680
           ALYF R    I + Y+ILGD+ L +V +  + L             K+ +++   I I  
Sbjct: 304 ALYFARKASTIASAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIAGKIDIAS 363

Query: 681 FKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKS 740
           F+D  K++ F+    A+     D +       N    P    F    +  +  L   + +
Sbjct: 364 FRDPAKLDAFVRRFAAI----WDAQN------NTASAPILALFTGTGSLDAETLQSVQTA 413

Query: 741 N 741
            
Sbjct: 414 R 414



 Score =  183 bits (463), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/353 (16%), Positives = 116/353 (32%), Gaps = 58/353 (16%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +  +    +KD+ + L S  + +P+V+ E  YY   I  + T+D+ + D+RL++YA+
Sbjct: 1   MTDTLTSYRLIAKDLPASL-SRKAAEPMVARETAYYEAHIGRVKTVDDLLGDQRLYAYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS------------ 107
           KA+GL DM++A+ F++K+LE   +   S  N+L   +Y  FA+++ F             
Sbjct: 60  KAYGLEDMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPAR 119

Query: 108 -PPPKVIQSDIQHKTIIQDY------KQSHQHKEEVALEESKYFRKNIHKINSVDQLFK- 159
                   S    K +   Y      + S   +  +    ++     ++      Q+   
Sbjct: 120 FGEQARAASLSAPKLLADTYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGQVANP 179

Query: 160 -----------------DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA------NPKK 196
                               L   V    +              L    A      +   
Sbjct: 180 AKVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGRDTDT 239

Query: 197 YFIESRDNRFRAMAEN----------FRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
                  NR   +               F  D       + +T   + + + +   +   
Sbjct: 240 LVNVGGPNRTLTIRNAPLSANRTAVDVGFGTDLGPDSMAQAVTQAYLRQSLESEAGDADT 299

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
            V +     Y+    ++++S  D L D  L ++    +        A      
Sbjct: 300 GVRLAL---YFARKASTIASAYDILGDAALSQVANTVIGLPATSGAATSEALA 349



 Score = 93.7 bits (231), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 49/128 (38%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +       +    ++K     +  E  YY  +I  + + ++LL ++R+  + ++
Sbjct: 1   MTDTLTSYRLIAKDLPASLSRKAAEPMVARETAYYEAHIGRVKTVDDLLGDQRLYAYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +       SFAN   D+RY     +F+F      +     + 
Sbjct: 61  AYGLEDMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPARF 120

Query: 593 QDNFHIDD 600
            +      
Sbjct: 121 GEQARAAS 128


>gi|288962700|ref|YP_003452994.1| flagellar basal-body rod protein [Azospirillum sp. B510]
 gi|288914966|dbj|BAI76450.1| flagellar basal-body rod protein [Azospirillum sp. B510]
          Length = 263

 Score =  219 bits (558), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 58/264 (21%), Positives = 112/264 (42%), Gaps = 27/264 (10%)

Query: 486 SMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDF 545
           + ++     R    +   + Y+  NI  I S E+ + + ++  F+L++  + SQ      
Sbjct: 13  NHDRYDQAVRSRPAVQRAISYFQDNIGKITSTEDFMKDDKLYRFVLDAFDLGSQARSRGL 72

Query: 546 LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLY 605
           + ++ +  + D  S AN   D++++E+ +   F  +          ++    +    D Y
Sbjct: 73  IRKVLEEGVGDKSSTANRMSDSKFREMATILGFAENQG------DNLKKPAVVQAIIDRY 126

Query: 606 KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
               +E + E+++P + L LYF+R   NI N Y+++ D+ L KVV   L L    A+L  
Sbjct: 127 VAVTLEVESEDRNPAVRLGLYFQRRSANISNWYQVMADNALRKVVYTALGLPEQTALLDV 186

Query: 666 RKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDD 725
            K+  +L+K + I D K   KV   L    AM     D +    ++              
Sbjct: 187 DKQKALLEKRMDIADLKKPDKVAKLLDRFAAM----YDMRNGDAAAAAAIPS-------- 234

Query: 726 PQNNVSLQLSPQKKSNGRFSILNL 749
                   + P  +  GR SI+++
Sbjct: 235 --------IGPVSR-RGRASIISI 249



 Score =  158 bits (398), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 37/171 (21%), Positives = 74/171 (43%), Gaps = 5/171 (2%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
             V   P V     Y+++ I  I++ ++F+KD +L+ + L AF L   + +   I+K+LE
Sbjct: 19  QAVRSRPAVQRAISYFQDNIGKITSTEDFMKDDKLYRFVLDAFDLGSQARSRGLIRKVLE 78

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFS-PPPKVIQSDIQHKTIIQDYKQ-SHQHKEEVA 137
             + D  S  N+++  K++  A    F+      ++     + II  Y   + + + E  
Sbjct: 79  EGVGDKSSTANRMSDSKFREMATILGFAENQGDNLKKPAVVQAIIDRYVAVTLEVESEDR 138

Query: 138 LEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
               +   YF++    I++  Q+  D  L   V  +  +  +   L   K 
Sbjct: 139 NPAVRLGLYFQRRSANISNWYQVMADNALRKVVYTALGLPEQTALLDVDKQ 189



 Score = 93.7 bits (231), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/179 (20%), Positives = 71/179 (39%), Gaps = 2/179 (1%)

Query: 124 QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
             Y Q+ + +         YF+ NI KI S +   KD +L  +VL +F +  +  S   +
Sbjct: 15  DRYDQAVRSR-PAVQRAISYFQDNIGKITSTEDFMKDDKLYRFVLDAFDLGSQARSRGLI 73

Query: 184 KDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFN- 242
           + VL  G+ +         D++FR MA    F  +   + +   +    I++ V+     
Sbjct: 74  RKVLEEGVGDKSSTANRMSDSKFREMATILGFAENQGDNLKKPAVVQAIIDRYVAVTLEV 133

Query: 243 NTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQ 301
            + D  P V    Y++    ++S++   + D  L K++  +L         D       
Sbjct: 134 ESEDRNPAVRLGLYFQRRSANISNWYQVMADNALRKVVYTALGLPEQTALLDVDKQKAL 192



 Score = 77.6 bits (189), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 38/259 (14%), Positives = 76/259 (29%), Gaps = 43/259 (16%)

Query: 352 KMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQ 411
            +Q  I  +Q  +GKI S ++ +                   +F LDA++L  Q   R  
Sbjct: 26  AVQRAISYFQDNIGKITSTEDFMKDD-------------KLYRFVLDAFDLGSQARSRGL 72

Query: 412 LRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYAN 471
           +R VL     D  S AN+  D +  ++     F  +           +  I   V     
Sbjct: 73  IRKVLEEGVGDKSSTANRMSDSKFREMATILGFAENQGDNLKKPAVVQAIIDRYVAVTLE 132

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
            +    +   +                       Y+      I ++ +++A+  +   + 
Sbjct: 133 VESEDRNPAVRLGL--------------------YFQRRSANISNWYQVMADNALRKVVY 172

Query: 532 ESKGIDSQK--VREDFLCEIFK-----SDLKDPKSFANTYKDNRYKEIISSFNFDIHGEL 584
            + G+  Q   +  D    + +     +DLK P   A     +R+  +    N       
Sbjct: 173 TALGLPEQTALLDVDKQKALLEKRMDIADLKKPDKVAKLL--DRFAAMYDMRN-GDAAAA 229

Query: 585 SHKKIGKVQDNFHIDDTCD 603
           +                  
Sbjct: 230 AAIPSIGPVSRRGRASIIS 248


>gi|182679721|ref|YP_001833867.1| hypothetical protein Bind_2809 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182635604|gb|ACB96378.1| protein of unknown function DUF1217 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 259

 Score =  217 bits (551), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 57/262 (21%), Positives = 103/262 (39%), Gaps = 15/262 (5%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             +     N +     +          ++ E  YY  NI+ + + +  L N R+  + ++
Sbjct: 1   MLTTALYYNMTVRDYTKTLATTASEPSVSRESKYYLDNISKVTTIDGFLNNNRLFTYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G+      +  + +I +    DP++ ANT  D+RYK +  +F+F   G  +       
Sbjct: 61  AFGLGDMVYAKGMVRQILQQGTSDPRALANTLNDSRYKALAQTFDFANLGANATSTTTAG 120

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
           Q+        D Y    +E    +  P   +ALY KR  P I + Y IL D  L ++V  
Sbjct: 121 QN------VVDKYVEMQLEDNVGKNSPGAEMALYLKRVAPTITSAYSILADKTLLQIVQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
              L    + L    + +++   +KI+D +D  K++ F     AM     D        P
Sbjct: 175 TFNLPSSMSALDIDVQAKMINSKMKISDLQDPTKLQTFTNRFIAM----YDINN-----P 225

Query: 713 NQNKDPWNNSFDDPQNNVSLQL 734
           N       N+     + +S  L
Sbjct: 226 NTGPSTPTNALLAQSSGLSSDL 247



 Score =  170 bits (431), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 61/237 (25%), Positives = 109/237 (45%), Gaps = 14/237 (5%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ + +    +    +K  +T + +P VS E +YY + I  ++TID F+ + RLF+YA+K
Sbjct: 1   MLTTALYYNMTVRDYTKTLATTASEPSVSRESKYYLDNISKVTTIDGFLNNNRLFTYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH- 119
           AFGL DM +A+  +++IL+   SDP++L N LN  +Y+  A+++DF+       S     
Sbjct: 61  AFGLGDMVYAKGMVRQILQQGTSDPRALANTLNDSRYKALAQTFDFANLGANATSTTTAG 120

Query: 120 KTIIQDYKQSHQHKEEVAL----EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
           + ++  Y +              E + Y ++    I S   +  D+ LL  V  +F++  
Sbjct: 121 QNVVDKYVEMQLEDNVGKNSPGAEMALYLKRVAPTITSAYSILADKTLLQIVQTTFNLPS 180

Query: 176 KYISLPFL-------KDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD 225
              +L            +    L +P K   ++  NRF AM +        S     
Sbjct: 181 SMSALDIDVQAKMINSKMKISDLQDPTKL--QTFTNRFIAMYDINNPNTGPSTPTNA 235



 Score =  101 bits (252), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/194 (18%), Positives = 80/194 (41%), Gaps = 3/194 (1%)

Query: 114 QSDIQHKTIIQDYKQSHQHKEEV--ALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSF 171
            + + +   ++DY ++            ESKY+  NI K+ ++D    + RL  Y +++F
Sbjct: 3   TTALYYNMTVRDYTKTLATTASEPSVSRESKYYLDNISKVTTIDGFLNNNRLFTYAMKAF 62

Query: 172 SITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
            +     +   ++ +L  G ++P+       D+R++A+A+ F F   G+ +         
Sbjct: 63  GLGDMVYAKGMVRQILQQGTSDPRALANTLNDSRYKALAQTFDFANLGANATSTTTAGQN 122

Query: 232 QIEKIVSNYFNNTIDCVPIVSDQN-YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
            ++K V     + +      ++   Y K    +++S    L D  L +++Q +    +  
Sbjct: 123 VVDKYVEMQLEDNVGKNSPGAEMALYLKRVAPTITSAYSILADKTLLQIVQTTFNLPSSM 182

Query: 291 ITADKFLTLMQEND 304
              D  +     N 
Sbjct: 183 SALDIDVQAKMINS 196



 Score = 78.0 bits (190), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 48/274 (17%), Positives = 84/274 (30%), Gaps = 43/274 (15%)

Query: 336 KMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQF 395
            + D  K       +  +    K Y   + K+ +ID  L+                   +
Sbjct: 11  TVRDYTKTLATTASEPSVSRESKYYLDNISKVTTIDGFLNNNR-------------LFTY 57

Query: 396 ALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPM 455
           A+ A+ L      +  +R +L    SDP + AN   D R   L   F+F   G+      
Sbjct: 58  AMKAFGLGDMVYAKGMVRQILQQGTSDPRALANTLNDSRYKALAQTFDFANLGA----NA 113

Query: 456 MQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIH 515
             +    ++ V  Y   +   +  +N     M                  Y      TI 
Sbjct: 114 TSTTTAGQNVVDKYVEMQLEDNVGKNSPGAEM----------------ALYLKRVAPTIT 157

Query: 516 SFEELLANKRILNFLLESKG-------IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNR 568
           S   +LA+K +L  +  +         +D     +    ++  SDL+DP         NR
Sbjct: 158 SAYSILADKTLLQIVQTTFNLPSSMSALDIDVQAKMINSKMKISDLQDPTKL--QTFTNR 215

Query: 569 YKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTC 602
           +  +    N    G  +       Q +    D  
Sbjct: 216 FIAMYD-INNPNTGPSTPTNALLAQSSGLSSDLL 248


>gi|218528724|ref|YP_002419540.1| hypothetical protein Mchl_0691 [Methylobacterium chloromethanicum
           CM4]
 gi|218521027|gb|ACK81612.1| protein of unknown function DUF1217 [Methylobacterium
           chloromethanicum CM4]
          Length = 417

 Score =  217 bits (551), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 72/426 (16%), Positives = 137/426 (32%), Gaps = 66/426 (15%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             +  +      Y+  +G++KS+D+LL  +                 +A+ AY L     
Sbjct: 23  AAEPTVARETAYYEAHIGQVKSVDDLLGDQR-------------LYAYAMKAYGLEDMTY 69

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R VL    +   S+AN+  DDR      AF+F            Q       +  
Sbjct: 70  AKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPA 118

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI- 526
            +  + R+   +  K        S +   +  + S +D  T    TI    + LA +   
Sbjct: 119 RFGEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVAN 178

Query: 527 -------------------------LNFLLESKG---IDSQKVREDFLCEIFKSDLKDPK 558
                                    +   L + G    ++  + +      +        
Sbjct: 179 PAKVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYAD 238

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKD 618
           +  N    NR   I ++        +       +  +         Y  Q +E +  + D
Sbjct: 239 TLVNAGGSNRTLTIRNAALSANRTAVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDAD 298

Query: 619 PNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER---KKIRILKKH 675
             + LALYF R    I + Y+ILGD+ L +V +  + L             K+ +++   
Sbjct: 299 TGVRLALYFARKASTIASAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIAGK 358

Query: 676 IKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLS 735
           I I  F+D  K++ F+    A+     D +       N    P    F    +  +  L 
Sbjct: 359 IDIASFRDPAKLDAFVRRFAAI----WDAQN------NTASAPILALFTGTGSLDAETLQ 408

Query: 736 PQKKSN 741
             + + 
Sbjct: 409 SVQSAR 414



 Score =  173 bits (438), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 56/353 (15%), Positives = 114/353 (32%), Gaps = 58/353 (16%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +  +    +KD+ + L S  + +P V+ E  YY   I  + ++D+ + D+RL++YA+
Sbjct: 1   MTDTLTSYRLIAKDLPASL-SRKAAEPTVARETAYYEAHIGQVKSVDDLLGDQRLYAYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS------------ 107
           KA+GL DM++A+ F++K+LE   +   S  N+L   +Y  FA+++ F             
Sbjct: 60  KAYGLEDMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPAR 119

Query: 108 -PPPKVIQSDIQHKTIIQDY------KQSHQHKEEVALEESKYFRKNIHKINSVDQLFK- 159
                   S    K +   Y      + S   +  +    ++     ++      ++   
Sbjct: 120 FGEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVANP 179

Query: 160 -----------------DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA------NPKK 196
                               L   V    +              L    A          
Sbjct: 180 AKVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYADT 239

Query: 197 YFIESRDNRFRAMAEN----------FRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
                  NR   +               F  D       + +T   + + + +   +   
Sbjct: 240 LVNAGGSNRTLTIRNAALSANRTAVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDADT 299

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
            V +     Y+    ++++S  D L D  L ++    +        A      
Sbjct: 300 GVRLAL---YFARKASTIASAYDILGDAALSQVANTVIGLPATSGAATSEALA 349



 Score = 93.4 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 49/128 (38%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +       +    ++K     +  E  YY  +I  + S ++LL ++R+  + ++
Sbjct: 1   MTDTLTSYRLIAKDLPASLSRKAAEPTVARETAYYEAHIGQVKSVDDLLGDQRLYAYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +       SFAN   D+RY     +F+F      +     + 
Sbjct: 61  AYGLEDMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPARF 120

Query: 593 QDNFHIDD 600
            +      
Sbjct: 121 GEQARAAS 128


>gi|254559265|ref|YP_003066360.1| hypothetical protein METDI0661 [Methylobacterium extorquens DM4]
 gi|254266543|emb|CAX22307.1| hypothetical protein METDI0661 [Methylobacterium extorquens DM4]
          Length = 417

 Score =  216 bits (549), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 70/421 (16%), Positives = 135/421 (32%), Gaps = 66/421 (15%)

Query: 353 MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQL 412
           +      Y+  +G++K++D+LL  +                 +A+ AY L      +  +
Sbjct: 28  VARETAYYEAHIGQVKTVDDLLGDQR-------------LYAYAMKAYGLEEMTYAKAFM 74

Query: 413 RNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANR 472
           R VL    +   S+AN+  DDR      AF+F            Q       +   +  +
Sbjct: 75  RKVLEEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVTATGADPARFGEQ 123

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI------ 526
            R+   +  K        S +   +  + S +D  T    TI    + LA +        
Sbjct: 124 ARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVANPAKVT 183

Query: 527 --------------------LNFLLESKG---IDSQKVREDFLCEIFKSDLKDPKSFANT 563
                               +   L + G    ++  + +      +        +  N 
Sbjct: 184 PAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYADTLVNA 243

Query: 564 YKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIAL 623
              NR   I ++        +       +  +         Y  Q +E +  + D  + L
Sbjct: 244 GGSNRTLTIRNAALSANRTAVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDADTGVRL 303

Query: 624 ALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER---KKIRILKKHIKIND 680
           ALYF R    + + Y+ILGD+ L +V +  + L             K+ +++   I I  
Sbjct: 304 ALYFARKASTLTSAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQLIAGKIDIAS 363

Query: 681 FKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKS 740
           F+D  K++ F+    A+     D +       N    P    F       +  L   + +
Sbjct: 364 FRDPAKLDAFVRRFAAI----WDAQN------NTASAPILALFTGTGGLDAETLQSVQSA 413

Query: 741 N 741
            
Sbjct: 414 R 414



 Score =  174 bits (441), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 56/353 (15%), Positives = 115/353 (32%), Gaps = 58/353 (16%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +  +    +KD+ + L S  + +P+V+ E  YY   I  + T+D+ + D+RL++YA+
Sbjct: 1   MTDTLTSYRLIAKDLPASL-SRKAAEPMVARETAYYEAHIGQVKTVDDLLGDQRLYAYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS------------ 107
           KA+GL +M++A+ F++K+LE   +   S  N+L   +Y  FA+++ F             
Sbjct: 60  KAYGLEEMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPAR 119

Query: 108 -PPPKVIQSDIQHKTIIQDY------KQSHQHKEEVALEESKYFRKNIHKINSVDQLFK- 159
                   S    K +   Y      + S   +  +    ++     ++      ++   
Sbjct: 120 FGEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVANP 179

Query: 160 -----------------DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA------NPKK 196
                               L   V    +              L    A          
Sbjct: 180 AKVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALTDLGADGAYGGTGLYADT 239

Query: 197 YFIESRDNRFRAMAEN----------FRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
                  NR   +               F  D       + +T   + + + +   +   
Sbjct: 240 LVNAGGSNRTLTIRNAALSANRTAVDVGFGTDLGPDSMAQTVTQAYLRQSLESEAGDADT 299

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
            V +     Y+    ++++S  D L D  L ++    +        A      
Sbjct: 300 GVRLAL---YFARKASTLTSAYDILGDAALSQVANTVIGLPATSGAATSEALA 349



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 49/128 (38%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +       +    ++K     +  E  YY  +I  + + ++LL ++R+  + ++
Sbjct: 1   MTDTLTSYRLIAKDLPASLSRKAAEPMVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +       SFAN   D+RY     +F+F      +     + 
Sbjct: 61  AYGLEEMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVTATGADPARF 120

Query: 593 QDNFHIDD 600
            +      
Sbjct: 121 GEQARAAS 128


>gi|170744540|ref|YP_001773195.1| hypothetical protein M446_6503 [Methylobacterium sp. 4-46]
 gi|168198814|gb|ACA20761.1| protein of unknown function DUF1217 [Methylobacterium sp. 4-46]
          Length = 414

 Score =  214 bits (544), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 74/418 (17%), Positives = 139/418 (33%), Gaps = 51/418 (12%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             D  +      Y+  +GK+KS+D+L++ +                 +A+ AY L     
Sbjct: 23  AADPVVARDTAYYEANIGKVKSVDDLMADQR-------------LYAYAMKAYGLEDMTY 69

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFN--------------FNADGSIGPI 453
            +  +R VL    +D  S+AN+  D R +    AF+               +  G + P 
Sbjct: 70  AKAFMRKVLEGGVADASSFANRLADPRYVAFARAFDFAAGAASASGADGSISESGVVPPQ 129

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
           P   +      +   ++       +    +  S    +T + + + +N+     +    T
Sbjct: 130 PAQLTAPAALPDSTDFS-----GANEARFTLTSRLDATTTRSVTITLNAATLAGSAADLT 184

Query: 514 IHSFEELLANKRILNFLLESKGIDSQKV-----REDFLCEIFKSDLKDPKSFANTYKDNR 568
             +  E++A            G++ +       R +   E   S      +        R
Sbjct: 185 RVTGAEIVAAINAQIAASGEDGLEDRVQVGLGARNELYFETTASAPDGFGTAVEAGGTGR 244

Query: 569 YKEIISSFNFDIHGELSHKKIG-KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYF 627
              + ++       +      G  +  +  +    D Y  Q +E    E+D  + LALYF
Sbjct: 245 TLSVENAAPSAADRKAVGIGFGTALPPDAQVRTVTDAYLEQTLESDAGEEDTGLRLALYF 304

Query: 628 KRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP---ERKKIRILKKHIKINDFKDS 684
            R  P + + Y+ILGD+ L KV +    L              +   L   I I  F+D 
Sbjct: 305 ARMAPTLTSAYDILGDAALSKVANTVAGLPATSGAATSEALDARAAFLAAKIDIAGFQDP 364

Query: 685 KKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKKSNG 742
            KV+ F+    A+     D +       +    P    F       +  L     +N 
Sbjct: 365 AKVQAFVRRFAAI----WDAQN------SSGDSPILALFTTAGGGGADPLGSLYPTNA 412



 Score =  169 bits (428), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 68/398 (17%), Positives = 130/398 (32%), Gaps = 58/398 (14%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +       ++D+  K     + DP+V+ +  YY   I  + ++D+ + D+RL++YA+
Sbjct: 1   MTSTFTNYQLVARDLP-KALQRKAADPVVARDTAYYEANIGKVKSVDDLMADQRLYAYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F++K+LE  ++D  S  N+L   +Y  FAR++DF+            
Sbjct: 60  KAYGLEDMTYAKAFMRKVLEGGVADASSFANRLADPRYVAFARAFDFAAGAASASGADGS 119

Query: 120 KTIIQDYKQSHQHKEEVAL--EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
            +               A   + + +   N  +     +L  D      V  + +     
Sbjct: 120 ISESGVVPPQPAQLTAPAALPDSTDFSGANEARFTLTSRL--DATTTRSVTITLNAATLA 177

Query: 178 ISLPFLKDVL----------------TLGLANPKKYFIESRDNRFRAMAENFRFQPDGSL 221
            S   L  V                   GL +  +  + +R+  +     +       ++
Sbjct: 178 GSAADLTRVTGAEIVAAINAQIAASGEDGLEDRVQVGLGARNELYFETTASAPDGFGTAV 237

Query: 222 SKRDKILT--------------------------DMQIEKIVSNYFNNTIDCVPIVSDQ- 254
                  T                          D Q+  +   Y   T++      D  
Sbjct: 238 EAGGTGRTLSVENAAPSAADRKAVGIGFGTALPPDAQVRTVTDAYLEQTLESDAGEEDTG 297

Query: 255 ----NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEN-----DP 305
                Y+     +++S  D L D  L K+             A       +         
Sbjct: 298 LRLALYFARMAPTLTSAYDILGDAALSKVANTVAGLPATSGAATSEALDARAAFLAAKID 357

Query: 306 IVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
           I           F R  ++    Q  S    +L L+  
Sbjct: 358 IAGFQDPAKVQAFVRRFAAIWDAQNSSGDSPILALFTT 395



 Score = 86.4 bits (212), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 45/97 (46%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             S           + +   +K  +  +  +  YY  NI  + S ++L+A++R+  + ++
Sbjct: 1   MTSTFTNYQLVARDLPKALQRKAADPVVARDTAYYEANIGKVKSVDDLMADQRLYAYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRY 569
           + G++     + F+ ++ +  + D  SFAN   D RY
Sbjct: 61  AYGLEDMTYAKAFMRKVLEGGVADASSFANRLADPRY 97


>gi|115523169|ref|YP_780080.1| hypothetical protein RPE_1148 [Rhodopseudomonas palustris BisA53]
 gi|115517116|gb|ABJ05100.1| protein of unknown function DUF1217 [Rhodopseudomonas palustris
           BisA53]
          Length = 257

 Score =  214 bits (544), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 59/241 (24%), Positives = 111/241 (46%), Gaps = 10/241 (4%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             S   +      ++ +   Q     +++ E  YY  +I+ + S E+ + + R+ ++ ++
Sbjct: 1   MVSTVTSYQFITQNLARSLAQTASKPDVSHETTYYLAHIHNVTSVEQFVGDFRLFSYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G+      + FL ++    + DP SFAN   D RY+E  ++FNF   GE + +     
Sbjct: 61  AYGLADMTYAKAFLRKVLTEGVADPSSFANKLVDTRYREFAAAFNFASLGEQATRTTAAT 120

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
                   T + Y  Q +E+   E D  + LALYF+R  P ++  Y+IL D  L +V   
Sbjct: 121 ------SGTVERYVRQSLEQDAGETDQGVQLALYFERKAPTLKTAYQILADKALLQVAQT 174

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            L +SP  ++    ++  +L K I  +DF+   K+  FL    A      + +    ++P
Sbjct: 175 TLGISPLTSMASIDRQAAMLAKKIDFSDFQHPTKLRAFLQRFSA----RWETEYGQTTTP 230

Query: 713 N 713
           +
Sbjct: 231 S 231



 Score =  185 bits (469), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 51/219 (23%), Positives = 102/219 (46%), Gaps = 7/219 (3%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M+ +  +        ++  +  +  P VS E  YY   I +++++++F+ D RLFSYA+K
Sbjct: 1   MVSTVTSYQFITQNLARSLAQTASKPDVSHETTYYLAHIHNVTSVEQFVGDFRLFSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQ 118
           A+GL+DM++A+ F++K+L   ++DP S  N+L   +Y+ FA +++F+         +   
Sbjct: 61  AYGLADMTYAKAFLRKVLTEGVADPSSFANKLVDTRYREFAAAFNFASLGEQATRTTAAT 120

Query: 119 HKTIIQDYKQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             T+ +  +QS +       +  +   YF +    + +  Q+  D+ LL     +  I+P
Sbjct: 121 SGTVERYVRQSLEQDAGETDQGVQLALYFERKAPTLKTAYQILADKALLQVAQTTLGISP 180

Query: 176 KYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
                   +      LA    +       + RA  + F 
Sbjct: 181 LTSMASIDRQA--AMLAKKIDFSDFQHPTKLRAFLQRFS 217



 Score =  101 bits (251), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/173 (21%), Positives = 66/173 (38%), Gaps = 1/173 (0%)

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANP 194
                E+ Y+  +IH + SV+Q   D RL  Y ++++ +     +  FL+ VLT G+A+P
Sbjct: 26  PDVSHETTYYLAHIHNVTSVEQFVGDFRLFSYAMKAYGLADMTYAKAFLRKVLTEGVADP 85

Query: 195 KKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQ 254
             +  +  D R+R  A  F F   G  + R    T   +E+ V                 
Sbjct: 86  SSFANKLVDTRYREFAAAFNFASLGEQATRTTAATSGTVERYVRQSLEQDAGETDQGVQL 145

Query: 255 N-YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
             Y++    ++ +    L D  L ++ Q +L        A            I
Sbjct: 146 ALYFERKAPTLKTAYQILADKALLQVAQTTLGISPLTSMASIDRQAAMLAKKI 198



 Score = 92.2 bits (227), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 40/231 (17%), Positives = 71/231 (30%), Gaps = 40/231 (17%)

Query: 337 MLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFA 396
             +L +   Q      +      Y   +  + S++  +                    +A
Sbjct: 12  TQNLARSLAQTASKPDVSHETTYYLAHIHNVTSVEQFVGDFR-------------LFSYA 58

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMM 456
           + AY L      +  LR VLT   +DP S+ANK  D R  +   AFNF + G        
Sbjct: 59  MKAYGLADMTYAKAFLRKVLTEGVADPSSFANKLVDTRYREFAAAFNFASLGEQATRTTA 118

Query: 457 QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHS 516
            +  T+   V+    +                          +      Y+     T+ +
Sbjct: 119 ATSGTVERYVRQSLEQ--------------------DAGETDQGVQLALYFERKAPTLKT 158

Query: 517 FEELLANKRILNFLLESKGIDS-------QKVREDFLCEIFKSDLKDPKSF 560
             ++LA+K +L     + GI          +       +I  SD + P   
Sbjct: 159 AYQILADKALLQVAQTTLGISPLTSMASIDRQAAMLAKKIDFSDFQHPTKL 209


>gi|188579922|ref|YP_001923367.1| hypothetical protein Mpop_0654 [Methylobacterium populi BJ001]
 gi|179343420|gb|ACB78832.1| protein of unknown function DUF1217 [Methylobacterium populi BJ001]
          Length = 417

 Score =  212 bits (540), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 72/417 (17%), Positives = 133/417 (31%), Gaps = 76/417 (18%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             +  +      Y+  +G++K++D+LL  +                 +A+ AY L     
Sbjct: 23  AAEPTVARETAYYEAHIGQVKTVDDLLGDQR-------------LYAYAMKAYGLEEMTY 69

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R VL    +   S+AN+  DDR      AF+F            Q       +  
Sbjct: 70  AKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFG-----------QGVSATGADAA 118

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
            +  R R+   +  K        S +   +  + S +D  T    TI    + LA +   
Sbjct: 119 RFGERARAATLSAPKLLADAYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGR--- 175

Query: 528 NFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK 587
             + +   +   ++      +I  SDLK           + + E  +  +    G     
Sbjct: 176 --VQDLSKVTPSEIATAVAAQIEGSDLKGKVQAGLAADGSLFFETTALTDLGADGAYGGS 233

Query: 588 KI----------------------------------GKVQDNFHIDDTCDLYKHQMIEKK 613
            +                                    +  +         Y  Q +E  
Sbjct: 234 GLNADTLVSAGGAIRTLAIRNVPLSADRTAVDVGFGTDLGPDTMALTVTQAYLRQSLESD 293

Query: 614 EEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER---KKIR 670
             + D  + LALYF R  P++ + Y+ILGD+ L +V +  + L             K+ +
Sbjct: 294 AGDTDTGVRLALYFARKGPSLSSAYDILGDAALSQVANTVIGLPATSGAATSEALAKRAQ 353

Query: 671 ILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQ 727
           ++   I I   +D  K++ FL    A+     D +       N    P    F    
Sbjct: 354 LIADKIDIAGLRDPAKLDAFLRRFAAI----WDAQN------NTASAPVLALFTGAG 400



 Score =  168 bits (425), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 58/353 (16%), Positives = 116/353 (32%), Gaps = 58/353 (16%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +  +    +KD+ + L +  + +P V+ E  YY   I  + T+D+ + D+RL++YA+
Sbjct: 1   MTDTLTSYRLIAKDLPASL-ARKAAEPTVARETAYYEAHIGQVKTVDDLLGDQRLYAYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS------------ 107
           KA+GL +M++A+ F++K+LE   +   S  N+L   +Y  FA+++ F             
Sbjct: 60  KAYGLEEMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVSATGADAAR 119

Query: 108 -PPPKVIQSDIQHKTIIQDY------KQSHQHKEEVALEESKYFRKNIHKINSVDQL--- 157
                   +    K +   Y      + S   +  +    ++     ++      ++   
Sbjct: 120 FGERARAATLSAPKLLADAYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVQDL 179

Query: 158 ---------------FKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA------NPKK 196
                           +   L   V    +              L    A      N   
Sbjct: 180 SKVTPSEIATAVAAQIEGSDLKGKVQAGLAADGSLFFETTALTDLGADGAYGGSGLNADT 239

Query: 197 YFIESRDNRFRAMAE----------NFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
                   R  A+            +  F  D         +T   + + + +   +T  
Sbjct: 240 LVSAGGAIRTLAIRNVPLSADRTAVDVGFGTDLGPDTMALTVTQAYLRQSLESDAGDTDT 299

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
            V +     Y+     S+SS  D L D  L ++    +        A      
Sbjct: 300 GVRLAL---YFARKGPSLSSAYDILGDAALSQVANTVIGLPATSGAATSEALA 349



 Score = 93.4 bits (230), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 48/127 (37%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +       +     +K     +  E  YY  +I  + + ++LL ++R+  + ++
Sbjct: 1   MTDTLTSYRLIAKDLPASLARKAAEPTVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +       SFAN   D+RY     +F+F      +     + 
Sbjct: 61  AYGLEEMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVSATGADAARF 120

Query: 593 QDNFHID 599
            +     
Sbjct: 121 GERARAA 127



 Score = 41.4 bits (95), Expect = 0.58,   Method: Composition-based stats.
 Identities = 32/335 (9%), Positives = 83/335 (24%), Gaps = 22/335 (6%)

Query: 224 RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLS 283
            D + +   I K +            +  +  YY+  I  V +  D L D +L+     +
Sbjct: 2   TDTLTSYRLIAKDLPASLARKAAEPTVARETAYYEAHIGQVKTVDDLLGDQRLYAYAMKA 61

Query: 284 LFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKI-QQDSQIQKMLDLYK 342
                          +++E     +        + +   + +    Q  S        + 
Sbjct: 62  YGLEEMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAFSFGQGVSATGADAARFG 121

Query: 343 KNCQILHDDKMQSLIKDY-QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
           +  +       + L   Y      +   +          +                D   
Sbjct: 122 ERARAATLSAPKLLADAYDFSGRAEASFLVESRLDATTTQSVTIRLNAQTLAGRVQDLSK 181

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
           +   ++       +  S+          +      +     +  ADG+ G   +    L 
Sbjct: 182 VTPSEIATAVAAQIEGSDLKGKVQAGLAADGSLFFETTALTDLGADGAYGGSGLNADTLV 241

Query: 462 IRDNVKHYANRKRSIHDAE----------NKSFNSMEQISTQKRINLEINSEVD------ 505
                      +     A+          +   ++M    TQ  +   + S+        
Sbjct: 242 SAGGAIRTLAIRNVPLSADRTAVDVGFGTDLGPDTMALTVTQAYLRQSLESDAGDTDTGV 301

Query: 506 ----YYTLNINTIHSFEELLANKRILNFLLESKGI 536
               Y+     ++ S  ++L +  +        G+
Sbjct: 302 RLALYFARKGPSLSSAYDILGDAALSQVANTVIGL 336


>gi|217977818|ref|YP_002361965.1| protein of unknown function DUF1217 [Methylocella silvestris BL2]
 gi|217503194|gb|ACK50603.1| protein of unknown function DUF1217 [Methylocella silvestris BL2]
          Length = 259

 Score =  212 bits (538), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 56/246 (22%), Positives = 103/246 (41%), Gaps = 11/246 (4%)

Query: 493 QKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKS 552
               +     E  YY  NI  + S ++L+ N+R+  ++L++ G+      +  + ++  S
Sbjct: 21  TAASDTVAKRETAYYEANIGKVKSVDDLMKNQRLYAYVLKAYGLSDMAYAKGLIRKVLTS 80

Query: 553 DLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEK 612
           D+ D  S ANT    RYK + +++NF   G +        +       T D Y  Q +E 
Sbjct: 81  DVTDGASLANTLSGGRYKALAAAYNFSAKGAVGTISAEAQKT------TKDNYVEQTLEA 134

Query: 613 KEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRIL 672
              +++    +ALYFKR  P +++ Y IL D  L  VV     LS   +      + + +
Sbjct: 135 NVGKQNDGAKMALYFKRIAPTVKSAYGILADKTLLGVVQTAFGLSASMSQQNIDVQAKTI 194

Query: 673 KKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSFDDPQNNVSL 732
               KI D ++  K++  +    A    + D +  +  S          S  D   ++ +
Sbjct: 195 NALFKIGDLQNPAKLQKLIQRFTA----NYDAQHPMGVSM-TPSSALEVSTPDISQSLLM 249

Query: 733 QLSPQK 738
            L+  K
Sbjct: 250 SLANLK 255



 Score =  169 bits (427), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 56/232 (24%), Positives = 105/232 (45%), Gaps = 8/232 (3%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           ++D  SK  +T + D +   E  YY   I  + ++D+ +K++RL++Y LKA+GLSDM++A
Sbjct: 12  TRDF-SKSLATAASDTVAKRETAYYEANIGKVKSVDDLMKNQRLYAYVLKAYGLSDMAYA 70

Query: 71  EKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK--VIQSDIQHKTIIQDYKQ 128
           +  I+K+L SD++D  SL N L+  +Y+  A +Y+FS       I ++ Q  T     +Q
Sbjct: 71  KGLIRKVLTSDVTDGASLANTLSGGRYKALAAAYNFSAKGAVGTISAEAQKTTKDNYVEQ 130

Query: 129 SHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
           + +       + +K   YF++    + S   +  D+ LL  V  +F ++           
Sbjct: 131 TLEANVGKQNDGAKMALYFKRIAPTVKSAYGILADKTLLGVVQTAFGLSASMSQQNIDVQ 190

Query: 186 VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIV 237
             T  +    K        + + + + F    D        +     +E   
Sbjct: 191 AKT--INALFKIGDLQNPAKLQKLIQRFTANYDAQHPMGVSMTPSSALEVST 240



 Score =  105 bits (261), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/186 (19%), Positives = 70/186 (37%), Gaps = 3/186 (1%)

Query: 122 IIQDYKQSHQHKEEV--ALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           + +D+ +S         A  E+ Y+  NI K+ SVD L K++RL  YVL+++ ++    +
Sbjct: 11  LTRDFSKSLATAASDTVAKRETAYYEANIGKVKSVDDLMKNQRLYAYVLKAYGLSDMAYA 70

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
              ++ VLT  + +           R++A+A  + F   G++            +  V  
Sbjct: 71  KGLIRKVLTSDVTDGASLANTLSGGRYKALAAAYNFSAKGAVGTISAEAQKTTKDNYVEQ 130

Query: 240 YFNNTID-CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLT 298
                +           Y+K    +V S    L D  L  ++Q +          +  + 
Sbjct: 131 TLEANVGKQNDGAKMALYFKRIAPTVKSAYGILADKTLLGVVQTAFGLSASMSQQNIDVQ 190

Query: 299 LMQEND 304
               N 
Sbjct: 191 AKTINA 196



 Score = 94.5 bits (233), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 42/204 (20%), Positives = 74/204 (36%), Gaps = 33/204 (16%)

Query: 334 IQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
                D  K       D   +     Y+  +GK+KS+D+L+  +                
Sbjct: 9   TMLTRDFSKSLATAASDTVAKRETAYYEANIGKVKSVDDLMKNQR-------------LY 55

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
            + L AY L+     +  +R VLTS+ +D  S AN     R   L  A+NF+A G++G I
Sbjct: 56  AYVLKAYGLSDMAYAKGLIRKVLTSDVTDGASLANTLSGGRYKALAAAYNFSAKGAVGTI 115

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT 513
                + T  + V+                    + +        +      Y+     T
Sbjct: 116 SAEAQKTTKDNYVE--------------------QTLEANVGKQNDGAKMALYFKRIAPT 155

Query: 514 IHSFEELLANKRILNFLLESKGID 537
           + S   +LA+K +L  +  + G+ 
Sbjct: 156 VKSAYGILADKTLLGVVQTAFGLS 179


>gi|27381994|ref|NP_773523.1| hypothetical protein blr6883 [Bradyrhizobium japonicum USDA 110]
 gi|27355164|dbj|BAC52148.1| blr6883 [Bradyrhizobium japonicum USDA 110]
          Length = 270

 Score =  211 bits (536), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 58/274 (21%), Positives = 112/274 (40%), Gaps = 13/274 (4%)

Query: 466 VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKR 525
               A    S      +    + +  TQ     +++ E DY+  +I  + + ++ L + R
Sbjct: 2   ATRGARVMLSTIADYTRLTKDLGKSMTQVATQPDVSRETDYFLSHIGNVKTIDDFLKDYR 61

Query: 526 ILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELS 585
           +  + +++ G+      + F+ ++    + +  +FAN   D RY+E  ++FNF   G+ +
Sbjct: 62  LYTYAMKAYGLSDMTYAKAFMRKVLTEGVSNKDAFANKLTDARYREFATAFNFAALGDKA 121

Query: 586 HKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSK 645
            +                 Y  Q +E+K  +++  + LALYF R    I N Y+IL D  
Sbjct: 122 TQTTAATTGTATQ------YVTQTMEQKAGDQNEGLRLALYFTRKASTITNAYQILADKA 175

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYK 705
           L +VV   +  S   +      + +++   I + DF+D  KV  F+    AM     D  
Sbjct: 176 LTQVVQTAMGWSSTISSSDIDAQAKMITDKIDLTDFQDPTKVTKFVQRFAAM----WD-- 229

Query: 706 KALFSSPNQNKDPWNNSFDDPQNNVSLQLSPQKK 739
            A  +  + + +P          + SL      K
Sbjct: 230 -ATQAQSDNSTNPALVLIGGAATSASLDTDMLTK 262



 Score =  178 bits (450), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 50/179 (27%), Positives = 91/179 (50%), Gaps = 7/179 (3%)

Query: 1   MIPSHVAPFP-SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M+ +       +KD+   + + V+  P VS E  Y+   I ++ TID+F+KD RL++YA+
Sbjct: 9   MLSTIADYTRLTKDLGKSM-TQVATQPDVSRETDYFLSHIGNVKTIDDFLKDYRLYTYAM 67

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDI 117
           KA+GLSDM++A+ F++K+L   +S+  +  N+L   +Y+ FA +++F+         +  
Sbjct: 68  KAYGLSDMTYAKAFMRKVLTEGVSNKDAFANKLTDARYREFATAFNFAALGDKATQTTAA 127

Query: 118 QHKTIIQDYKQSHQHKEEVALEE---SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI 173
              T  Q   Q+ + K     E    + YF +    I +  Q+  D+ L   V  +   
Sbjct: 128 TTGTATQYVTQTMEQKAGDQNEGLRLALYFTRKASTITNAYQILADKALTQVVQTAMGW 186



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 30/158 (18%), Positives = 66/158 (41%), Gaps = 1/158 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           +    +     E+ YF  +I  + ++D   KD RL  Y ++++ ++    +  F++ VLT
Sbjct: 28  TQVATQPDVSRETDYFLSHIGNVKTIDDFLKDYRLYTYAMKAYGLSDMTYAKAFMRKVLT 87

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G++N   +  +  D R+R  A  F F   G  + +    T     + V+          
Sbjct: 88  EGVSNKDAFANKLTDARYREFATAFNFAALGDKATQTTAATTGTATQYVTQTMEQKAGDQ 147

Query: 249 PIVSDQN-YYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
                   Y+    +++++    L D  L +++Q ++ 
Sbjct: 148 NEGLRLALYFTRKASTITNAYQILADKALTQVVQTAMG 185



 Score = 88.7 bits (218), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/205 (20%), Positives = 70/205 (34%), Gaps = 33/205 (16%)

Query: 331 DSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPI 390
               +   DL K   Q+     +      +   +G +K+ID+ L                
Sbjct: 14  ADYTRLTKDLGKSMTQVATQPDVSRETDYFLSHIGNVKTIDDFLKDYR------------ 61

Query: 391 ITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI 450
               +A+ AY L+     +  +R VLT   S+ D++ANK  D R  +   AFNF A G  
Sbjct: 62  -LYTYAMKAYGLSDMTYAKAFMRKVLTEGVSNKDAFANKLTDARYREFATAFNFAALGDK 120

Query: 451 GPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLN 510
                  +  T    V     +K    +                           Y+T  
Sbjct: 121 ATQTTAATTGTATQYVTQTMEQKAGDQNEGL--------------------RLALYFTRK 160

Query: 511 INTIHSFEELLANKRILNFLLESKG 535
            +TI +  ++LA+K +   +  + G
Sbjct: 161 ASTITNAYQILADKALTQVVQTAMG 185


>gi|158422870|ref|YP_001524162.1| hypothetical protein AZC_1246 [Azorhizobium caulinodans ORS 571]
 gi|158329759|dbj|BAF87244.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 303

 Score =  208 bits (530), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 102/249 (40%), Gaps = 17/249 (6%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
              N    +       K     + +++ Y+  NI  + + +E + N R+ NF + + G+ 
Sbjct: 49  ATYNYYQKNSAMALKTKAAEPIVKNDIAYFRANITKVKTVDEFVGNYRLFNFAMNAFGLS 108

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSF-NFDIHGELSHKKIGKVQDNF 596
                + ++ ++  SDL D  SF N   D+++K    +F N +    L+           
Sbjct: 109 EMANAKAYMKKVLNSDLSDSSSFVNKLADDKFKVFARAFSNLNPTNALTTVPATA----- 163

Query: 597 HIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL 656
             DD    Y +Q IE +  + D  + LALYFKR    I++ Y ILGD  L+KVV     L
Sbjct: 164 --DDVVGYYLNQSIETELGQTDQGVQLALYFKRNAATIKSAYSILGDPALYKVVKTVFNL 221

Query: 657 SPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNK 716
                 +   ++ RI+   + +ND +D  KV   L    A+     D             
Sbjct: 222 PDNMGKVDIAQQKRIVDAKLNVNDLQDPTKVNKLLQRFAAI----WDATNNTA-----AN 272

Query: 717 DPWNNSFDD 725
           +P    F+ 
Sbjct: 273 NPILTLFNT 281



 Score =  162 bits (410), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 51/188 (27%), Positives = 93/188 (49%), Gaps = 5/188 (2%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
            +       +   +    T + +PIV  +  Y+R  I  + T+DEF+ + RLF++A+ AF
Sbjct: 46  STFATYNYYQKNSAMALKTKAAEPIVKNDIAYFRANITKVKTVDEFVGNYRLFNFAMNAF 105

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSY-DFSPPPKVIQSDIQHKT 121
           GLS+M++A+ ++KK+L SDLSD  S VN+L   K++ FAR++ + +P   +         
Sbjct: 106 GLSEMANAKAYMKKVLNSDLSDSSSFVNKLADDKFKVFARAFSNLNPTNALTTVPATADD 165

Query: 122 IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           ++  Y  QS + +     +  +   YF++N   I S   +  D  L   V   F++    
Sbjct: 166 VVGYYLNQSIETELGQTDQGVQLALYFKRNAATIKSAYSILGDPALYKVVKTVFNLPDNM 225

Query: 178 ISLPFLKD 185
             +   + 
Sbjct: 226 GKVDIAQQ 233



 Score = 88.0 bits (216), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 35/203 (17%), Positives = 78/203 (38%), Gaps = 11/203 (5%)

Query: 96  KYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVD 155
           ++   A + DF           ++  +    K      E +   +  YFR NI K+ +VD
Sbjct: 34  RWGLSAMAIDFGSTFATYNYYQKNSAMALKTKA----AEPIVKNDIAYFRANITKVKTVD 89

Query: 156 QLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRF 215
           +   + RL ++ + +F ++    +  ++K VL   L++   +  +  D++F+  A  F  
Sbjct: 90  EFVGNYRLFNFAMNAFGLSEMANAKAYMKKVLNSDLSDSSSFVNKLADDKFKVFARAFSN 149

Query: 216 ----QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFL 271
                   ++      +    + + +      T   V +     Y+K    ++ S    L
Sbjct: 150 LNPTNALTTVPATADDVVGYYLNQSIETELGQTDQGVQLAL---YFKRNAATIKSAYSIL 206

Query: 272 KDPKLFKMLQLSLFPLNPEITAD 294
            DP L+K+++      +     D
Sbjct: 207 GDPALYKVVKTVFNLPDNMGKVD 229



 Score = 75.6 bits (184), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 44/264 (16%), Positives = 86/264 (32%), Gaps = 47/264 (17%)

Query: 336 KMLDLYKKNCQILHDDKMQSLI-----KDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPI 390
              + Y+KN  +    K    I       ++  + K+K++D  +                
Sbjct: 49  ATYNYYQKNSAMALKTKAAEPIVKNDIAYFRANITKVKTVDEFVGNYR------------ 96

Query: 391 ITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI 450
               FA++A+ L+     +  ++ VL S+ SD  S+ NK  DD+      AF+     ++
Sbjct: 97  -LFNFAMNAFGLSEMANAKAYMKKVLNSDLSDSSSFVNKLADDKFKVFARAFS-----NL 150

Query: 451 GPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLN 510
            P   + +     D+V  Y   +                  T+     +      Y+  N
Sbjct: 151 NPTNALTTVPATADDVVGYYLNQSI---------------ETELGQTDQGVQLALYFKRN 195

Query: 511 INTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC-------EIFKSDLKDPKSFANT 563
             TI S   +L +  +   +     +     + D          ++  +DL+DP    N 
Sbjct: 196 AATIKSAYSILGDPALYKVVKTVFNLPDNMGKVDIAQQKRIVDAKLNVNDLQDPTK-VNK 254

Query: 564 YKDNRYKEIISSFNFDIHGELSHK 587
               R+  I  + N          
Sbjct: 255 LL-QRFAAIWDATNNTAANNPILT 277


>gi|296444947|ref|ZP_06886909.1| protein of unknown function DUF1217 [Methylosinus trichosporium
           OB3b]
 gi|296257615|gb|EFH04680.1| protein of unknown function DUF1217 [Methylosinus trichosporium
           OB3b]
          Length = 266

 Score =  208 bits (529), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 53/241 (21%), Positives = 108/241 (44%), Gaps = 10/241 (4%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            +      +  N+     +      ++ ++  Y+  NI  + S ++ + N R+ N+ + +
Sbjct: 1   MTTLSTYLQIANNQSLWQSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTA 60

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G+      +  + ++ +  + D  + ANT  +   K   ++F+F  +G  +        
Sbjct: 61  FGLGDMTYAKGMMQKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTTS------ 114

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKK 653
            +  +D+    Y  Q +E  + +++P + LALYF+R  P+I + Y IL DSK+  VV   
Sbjct: 115 SSTLVDNVVSRYAEQSLEDNQGQQNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTA 174

Query: 654 LKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPN 713
           L +S          +  +L   + I DF+D KK++ F+    AM     DY  +   + +
Sbjct: 175 LGISTQTTSQSIDSQAAMLTSKLDITDFQDPKKLQQFISRFAAM----YDYNNSGSDANS 230

Query: 714 Q 714
           Q
Sbjct: 231 Q 231



 Score =  176 bits (446), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 7/231 (3%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + +        + QS   S  +K P V+ + +Y+ + I  + ++D+F+K+ RLF+YA+ A
Sbjct: 1   MTTLSTYLQIANNQSLWQSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTA 60

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQ-HK 120
           FGL DM++A+  ++K+LE  +SD  +L N LN+   + FA ++DF+       S      
Sbjct: 61  FGLGDMTYAKGMMQKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTTSSSTLVD 120

Query: 121 TIIQDYKQSHQHKEEVALEE----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            ++  Y +      +         + YF++N   I SV  +  D ++L  V  +  I+ +
Sbjct: 121 NVVSRYAEQSLEDNQGQQNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTALGISTQ 180

Query: 177 YISLPFLKD--VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD 225
             S        +LT  L        +         A  + +   GS +   
Sbjct: 181 TTSQSIDSQAAMLTSKLDITDFQDPKKLQQFISRFAAMYDYNNSGSDANSQ 231



 Score = 99.1 bits (245), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/174 (20%), Positives = 69/174 (39%), Gaps = 1/174 (0%)

Query: 128 QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVL 187
           QS   K+     +++YF  NI K+ SVD   K+ RL +Y + +F +     +   ++ VL
Sbjct: 18  QSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTAFGLGDMTYAKGMMQKVL 77

Query: 188 TLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDC 247
             G+++         +   +A A  F F  +G+ +     L D  + +       +    
Sbjct: 78  EQGVSDNSALANTLNNANIKAFATAFDFADNGASTTSSSTLVDNVVSRYAEQSLEDNQGQ 137

Query: 248 V-PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLM 300
             P V    Y++    S++S    L D K+  ++Q +L       +        
Sbjct: 138 QNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTALGISTQTTSQSIDSQAA 191



 Score = 79.1 bits (193), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 40/244 (16%), Positives = 81/244 (33%), Gaps = 42/244 (17%)

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
                 + +  + ++  +GK++S+D+ +                    +A+ A+ L    
Sbjct: 21  TAKQPDVATQTQYFEDNIGKVQSVDDFMKNDR-------------LFNYAMTAFGLGDMT 67

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
             +  ++ VL    SD  + AN   +  +     AF+F  +G+        S   + + V
Sbjct: 68  YAKGMMQKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTT----SSSTLVDNVV 123

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
             Y            +S    +                 Y+  N  +I S   +LA+ +I
Sbjct: 124 SRY----------AEQSLEDNQGQQNPGVQ------LALYFQRNAPSITSVYGILADSKI 167

Query: 527 LNFLLESKGIDSQKVRE--DFLCEIFKSDLK-----DPKSFANTYKDNRYKEIISSFNFD 579
           L+ +  + GI +Q   +  D    +  S L      DPK        +R+  +    N  
Sbjct: 168 LSVVQTALGISTQTTSQSIDSQAAMLTSKLDITDFQDPKKL--QQFISRFAAMYDYNNSG 225

Query: 580 IHGE 583
               
Sbjct: 226 SDAN 229



 Score = 44.1 bits (102), Expect = 0.095,   Method: Composition-based stats.
 Identities = 25/174 (14%), Positives = 54/174 (31%), Gaps = 11/174 (6%)

Query: 224 RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLS 283
              + T +QI    S + + T     + +   Y++  I  V S  DF+K+ +LF     +
Sbjct: 1   MTTLSTYLQIANNQSLWQSMTAKQPDVATQTQYFEDNIGKVQSVDDFMKNDRLFNYAMTA 60

Query: 284 LFPLNPEITADKFLTLM----QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLD 339
               +          ++     +N  + + +       F      +      +    ++D
Sbjct: 61  FGLGDMTYAKGMMQKVLEQGVSDNSALANTLNNANIKAFATAFDFADNGASTTSSSTLVD 120

Query: 340 LYKKNCQILHDDKMQ-------SLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSA 386
                      +  Q        L   +Q     I S+  +L+    L    +A
Sbjct: 121 NVVSRYAEQSLEDNQGQQNPGVQLALYFQRNAPSITSVYGILADSKILSVVQTA 174


>gi|149912827|ref|ZP_01901361.1| flagellar protein, putative [Roseobacter sp. AzwK-3b]
 gi|149813233|gb|EDM73059.1| flagellar protein, putative [Roseobacter sp. AzwK-3b]
          Length = 267

 Score =  208 bits (529), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 84/226 (37%), Gaps = 21/226 (9%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            +M+           I+S+  Y+   I  I + EEL+ ++R+L   L + G+        
Sbjct: 20  ATMDAQRKAFDAGPRISSDTAYFEARIRDISTAEELVNDRRLLRVALGAFGLQDDIDSRF 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            + ++ +    DP + AN   D RYK++  +F F   G          Q      D  DL
Sbjct: 80  LIRKVLEGGTADPDALANRLTDRRYKDLADAFGFGATGGPET------QSPGFGKDIVDL 133

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKL 656
           ++ +  E    E D  + LAL  +R +  + N           I+G   L KV    L L
Sbjct: 134 FRRRSFENAVGESDQGLRLALNAQRELAILANDTGQGDTGWLRIMGTPPLRKVFETALGL 193

Query: 657 SPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAK 695
              FA L   +++ + K           +    D  + +  +    
Sbjct: 194 PDGFAQLDLDRQLDVFKARAADRLGITDLRQLADEGERDKLVERFL 239



 Score =  135 bits (340), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 38/181 (20%), Positives = 69/181 (38%), Gaps = 13/181 (7%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
                  P +S +  Y+  RI+ IST +E + D+RL   AL AFGL D   +   I+K+L
Sbjct: 26  RKAFDAGPRISSDTAYFEARIRDISTAEELVNDRRLLRVALGAFGLQDDIDSRFLIRKVL 85

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKV-IQSDIQHKTIIQDYKQSHQHKEEVA 137
           E   +DP +L N+L   +Y+  A ++ F        QS    K I+  +++         
Sbjct: 86  EGGTADPDALANRLTDRRYKDLADAFGFGATGGPETQSPGFGKDIVDLFRRRSFENAVGE 145

Query: 138 LEESKYFRKNIHKI------------NSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
            ++      N  +                 ++     L      +  +   +  L   + 
Sbjct: 146 SDQGLRLALNAQRELAILANDTGQGDTGWLRIMGTPPLRKVFETALGLPDGFAQLDLDRQ 205

Query: 186 V 186
           +
Sbjct: 206 L 206



 Score = 94.5 bits (233), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 32/200 (16%), Positives = 63/200 (31%), Gaps = 9/200 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
                   ++ YF   I  I++ ++L  DRRLL   L +F +     S   ++ VL  G 
Sbjct: 30  DAGPRISSDTAYFEARIRDISTAEELVNDRRLLRVALGAFGLQDDIDSRFLIRKVLEGGT 89

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV 251
           A+P        D R++ +A+ F F   G    +        ++      F N +      
Sbjct: 90  ADPDALANRLTDRRYKDLADAFGFGATGGPETQSPGFGKDIVDLFRRRSFENAVGESDQG 149

Query: 252 SDQNYYKLAINSV---------SSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
                      ++         + +   +  P L K+ + +L   +     D    L   
Sbjct: 150 LRLALNAQRELAILANDTGQGDTGWLRIMGTPPLRKVFETALGLPDGFAQLDLDRQLDVF 209

Query: 303 NDPIVSQVKYFFQINFHRDN 322
                 ++          + 
Sbjct: 210 KARAADRLGITDLRQLADEG 229



 Score = 64.1 bits (154), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 29/218 (13%), Positives = 60/218 (27%), Gaps = 31/218 (14%)

Query: 321 DNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQL 380
                  +  ++ +      +    +I  D         ++  +  I + + L++ +   
Sbjct: 9   SGGLGGWVFLNATMDAQRKAFDAGPRISSDTA------YFEARIRDISTAEELVNDRR-- 60

Query: 381 EGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
                       L+ AL A+ L      R  +R VL    +DPD+ AN+  D R   L  
Sbjct: 61  -----------LLRVALGAFGLQDDIDSRFLIRKVLEGGTADPDALANRLTDRRYKDLAD 109

Query: 441 AFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEI 500
           AF F A G          +  +    +            +        Q       N   
Sbjct: 110 AFGFGATGGPETQSPGFGKDIVDLFRRRSFEN-AVGESDQGLRLALNAQRELAILANDTG 168

Query: 501 NSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDS 538
             +  +             ++    +      + G+  
Sbjct: 169 QGDTGWLR-----------IMGTPPLRKVFETALGLPD 195


>gi|13472569|ref|NP_104136.1| hypothetical protein mlr2906 [Mesorhizobium loti MAFF303099]
 gi|14023315|dbj|BAB49922.1| mlr2906 [Mesorhizobium loti MAFF303099]
          Length = 210

 Score =  205 bits (520), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 52/194 (26%), Positives = 94/194 (48%), Gaps = 10/194 (5%)

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
           ++N R+  + L + G+DS    +  + ++ +  ++DP S AN  K+  Y  + S+FNF+ 
Sbjct: 1   MSNSRLYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQ 60

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
           +GE +   +   Q       T D Y  Q +E+     +  + LALYF+R  P+I + Y++
Sbjct: 61  YGENATTIVPAQQP------TVDKYMRQSLEEDAGNTNAGVRLALYFQRKAPDITSWYDV 114

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQ 700
           L D+ L  VV   L L   FA     K+ ++ ++ + I+DF D  K+  FL    +M   
Sbjct: 115 LADTALASVVRTALGLPDSFATADIDKQAQLFEQKLDISDFTDPVKLGKFLTRFTSM--- 171

Query: 701 SIDYKKALFSSPNQ 714
             +      ++   
Sbjct: 172 -YEINNPTSTAVTS 184



 Score =  113 bits (282), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/161 (19%), Positives = 64/161 (39%), Gaps = 12/161 (7%)

Query: 49  IKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP 108
           + + RL++YAL A+GL   +  +  IK++L+  + DP S+ N+  +  Y   A +++F  
Sbjct: 1   MSNSRLYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQ 60

Query: 109 PPKVIQS--DIQHKTIIQDYKQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRL 163
             +   +    Q  T+ +  +QS +          +   YF++    I S   +  D  L
Sbjct: 61  YGENATTIVPAQQPTVDKYMRQSLEEDAGNTNAGVRLALYFQRKAPDITSWYDVLADTAL 120

Query: 164 LDYVLQSFSITPKYISLPFLKDVL-------TLGLANPKKY 197
              V  +  +   + +    K               +P K 
Sbjct: 121 ASVVRTALGLPDSFATADIDKQAQLFEQKLDISDFTDPVKL 161



 Score = 91.4 bits (225), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 58/148 (39%), Gaps = 7/148 (4%)

Query: 158 FKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP 217
             + RL  Y L ++ +         +K VL  G+ +P     + ++  + A+A  F F+ 
Sbjct: 1   MSNSRLYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQ 60

Query: 218 DG----SLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKD 273
            G    ++    +   D  + + +     NT   V +     Y++     ++S+ D L D
Sbjct: 61  YGENATTIVPAQQPTVDKYMRQSLEEDAGNTNAGVRLAL---YFQRKAPDITSWYDVLAD 117

Query: 274 PKLFKMLQLSLFPLNPEITADKFLTLMQ 301
             L  +++ +L   +   TAD       
Sbjct: 118 TALASVVRTALGLPDSFATADIDKQAQL 145



 Score = 72.9 bits (177), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 35/190 (18%), Positives = 61/190 (32%), Gaps = 29/190 (15%)

Query: 392 TLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIG 451
              +AL AY L+    D+  ++ VL     DP+S ANK K+     L  AFNF   G   
Sbjct: 6   LYTYALAAYGLDSATEDKTLIKQVLQGGVRDPNSVANKQKNPAYAALASAFNFEQYGENA 65

Query: 452 PIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNI 511
              +   + T+   ++                                      Y+    
Sbjct: 66  TTIVPAQQPTVDKYMRQSLE--------------------EDAGNTNAGVRLALYFQRKA 105

Query: 512 NTIHSFEELLANKRILNFLLESKGIDSQKVRED-------FLCEIFKSDLKDPKSFANTY 564
             I S+ ++LA+  + + +  + G+       D       F  ++  SD  DP       
Sbjct: 106 PDITSWYDVLADTALASVVRTALGLPDSFATADIDKQAQLFEQKLDISDFTDPVKLGKFL 165

Query: 565 KDNRYKEIIS 574
              R+  +  
Sbjct: 166 T--RFTSMYE 173


>gi|323139683|ref|ZP_08074724.1| protein of unknown function DUF1217 [Methylocystis sp. ATCC 49242]
 gi|322395062|gb|EFX97622.1| protein of unknown function DUF1217 [Methylocystis sp. ATCC 49242]
          Length = 266

 Score =  203 bits (515), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 55/237 (23%), Positives = 104/237 (43%), Gaps = 12/237 (5%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           N + +  +      ++  E  Y+  NI    S E  L ++R+ N+ +++ G+  +     
Sbjct: 12  NDLGRWRSITAKAPDVALETKYFKENIGKATSIEAFLKDRRLFNYAMKAFGLGDRTFAIG 71

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            + ++ +  + DPK+ A T  +        +F+F   G         V     I D    
Sbjct: 72  LMRKVMEQGVDDPKALARTLNNPNILAFAKAFDFSAKGA-------GVPSATLIQDVTAR 124

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLP 664
           +  Q ++ ++ +++P + LALYF+   P + + Y +L D KL +VV   L +SP  +   
Sbjct: 125 FVEQAMQAEQGKRNPGVELALYFREKAPGLTSIYGVLADKKLVQVVQTALDISPRTSAQN 184

Query: 665 ERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKK-ALFSSPNQNKDPWN 720
              + R+LK  + + DFKD KK+  F+    AM     D +     SS   + +   
Sbjct: 185 IDTQARLLKAKVNVEDFKDPKKLTAFIARFSAM----YDMQNQGTVSSATASSNAIL 237



 Score =  159 bits (402), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 56/240 (23%), Positives = 108/240 (45%), Gaps = 16/240 (6%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + +  +     +   +  S  +K P V+ E +Y++E I   ++I+ F+KD+RLF+YA+KA
Sbjct: 1   MTTIASYLSIANDLGRWRSITAKAPDVALETKYFKENIGKATSIEAFLKDRRLFNYAMKA 60

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKT 121
           FGL D + A   ++K++E  + DPK+L   LN+     FA+++DFS     + S    + 
Sbjct: 61  FGLGDRTFAIGLMRKVMEQGVDDPKALARTLNNPNILAFAKAFDFSAKGAGVPSATLIQD 120

Query: 122 IIQDYKQSHQHKEEVA----LEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           +   + +     E+      +E + YFR+    + S+  +  D++L+  V  +  I+P+ 
Sbjct: 121 VTARFVEQAMQAEQGKRNPGVELALYFREKAPGLTSIYGVLADKKLVQVVQTALDISPRT 180

Query: 178 ISLPFLKD-------VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
            +             V      +PKK             +  +  Q  G++S        
Sbjct: 181 SAQNIDTQARLLKAKVNVEDFKDPKKL-----TAFIARFSAMYDMQNQGTVSSATASSNA 235



 Score = 98.0 bits (242), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 42/214 (19%), Positives = 81/214 (37%), Gaps = 2/214 (0%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
           S   K      E+KYF++NI K  S++   KDRRL +Y +++F +  +  ++  ++ V+ 
Sbjct: 19  SITAKAPDVALETKYFKENIGKATSIEAFLKDRRLFNYAMKAFGLGDRTFAIGLMRKVME 78

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G+ +PK       +    A A+ F F   G+      ++ D+    +            
Sbjct: 79  QGVDDPKALARTLNNPNILAFAKAFDFSAKGAGVPSATLIQDVTARFVEQAMQAEQGKRN 138

Query: 249 PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEI--TADKFLTLMQENDPI 306
           P V    Y++     ++S    L D KL +++Q +L           D    L++    +
Sbjct: 139 PGVELALYFREKAPGLTSIYGVLADKKLVQVVQTALDISPRTSAQNIDTQARLLKAKVNV 198

Query: 307 VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL 340
                      F    S+   +Q    +      
Sbjct: 199 EDFKDPKKLTAFIARFSAMYDMQNQGTVSSATAS 232



 Score = 83.3 bits (204), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/255 (14%), Positives = 79/255 (30%), Gaps = 46/255 (18%)

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
                    +    K ++  +GK  SI+  L  +                 +A+ A+ L 
Sbjct: 18  RSITAKAPDVALETKYFKENIGKATSIEAFLKDRR-------------LFNYAMKAFGLG 64

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
            +      +R V+     DP + A    +  ++    AF+F+A G+  P     S   I+
Sbjct: 65  DRTFAIGLMRKVMEQGVDDPKALARTLNNPNILAFAKAFDFSAKGAGVP-----SATLIQ 119

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
           D    +  +                  + Q + N  +   + Y+      + S   +LA+
Sbjct: 120 DVTARFVEQAM---------------QAEQGKRNPGVELAL-YFREKAPGLTSIYGVLAD 163

Query: 524 KRILNFLLESKGIDS-------QKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSF 576
           K+++  +  +  I                  ++   D KDPK               + +
Sbjct: 164 KKLVQVVQTALDISPRTSAQNIDTQARLLKAKVNVEDFKDPKKL-----TAFIARFSAMY 218

Query: 577 NFDIHGELSHKKIGK 591
           +    G +S      
Sbjct: 219 DMQNQGTVSSATASS 233


>gi|158422871|ref|YP_001524163.1| hypothetical protein AZC_1247 [Azorhizobium caulinodans ORS 571]
 gi|158329760|dbj|BAF87245.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 295

 Score =  200 bits (508), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 58/243 (23%), Positives = 100/243 (41%), Gaps = 13/243 (5%)

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
           N    + +    Q+    E+  +  YY  NI ++ S ++ + N R+LN+ + + G+  + 
Sbjct: 43  NYYSKNSDTALKQEAAQPEVARDTAYYEANIGSVTSVDDFVNNYRLLNYAMTAYGLSDET 102

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
             +  + ++  SDL D  S      D RY  +  +F       L+               
Sbjct: 103 NAKALVKQVLSSDLSDSSSLVYKLNDQRYLNLAKAFA-----NLNPNDSAASYTAATTQQ 157

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660
             + Y  Q +E    ++D    LALYF+R   NI + Y ILGDS+L+KVV     L    
Sbjct: 158 VVNSYLEQQLENDVGQQDEGTQLALYFQRNAANITSGYSILGDSQLWKVVQTVYDLPESL 217

Query: 661 AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN 720
             +   ++  +++  + I D +D  KV   L    A+     D   +  +S     DP  
Sbjct: 218 GSIDINQQKDLVESKVNIADLQDPTKVSALLDRFSAV----WDATNSSAAS----SDPVL 269

Query: 721 NSF 723
             F
Sbjct: 270 ELF 272



 Score =  152 bits (384), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 47/212 (22%), Positives = 91/212 (42%), Gaps = 13/212 (6%)

Query: 3   PSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAF 62
            +                  +  P V+ +  YY   I  ++++D+F+ + RL +YA+ A+
Sbjct: 37  STFATFNYYSKNSDTALKQEAAQPEVARDTAYYEANIGSVTSVDDFVNNYRLLNYAMTAY 96

Query: 63  GLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSY-DFSPPPKVIQ-SDIQHK 120
           GLSD ++A+  +K++L SDLSD  SLV +LN  +Y   A+++ + +P       +    +
Sbjct: 97  GLSDETNAKALVKQVLSSDLSDSSSLVYKLNDQRYLNLAKAFANLNPNDSAASYTAATTQ 156

Query: 121 TIIQDYKQSHQHKEEVALEE----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPK 176
            ++  Y +     +    +E    + YF++N   I S   +  D +L   V   + +   
Sbjct: 157 QVVNSYLEQQLENDVGQQDEGTQLALYFQRNAANITSGYSILGDSQLWKVVQTVYDLPES 216

Query: 177 YISLPFLKD-------VLTLGLANPKKYFIES 201
             S+   +        V    L +P K     
Sbjct: 217 LGSIDINQQKDLVESKVNIADLQDPTKVSALL 248



 Score = 95.7 bits (236), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 30/174 (17%), Positives = 69/174 (39%), Gaps = 2/174 (1%)

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
            +  +     ++ Y+  NI  + SVD    + RLL+Y + ++ ++ +  +   +K VL+ 
Sbjct: 55  QEAAQPEVARDTAYYEANIGSVTSVDDFVNNYRLLNYAMTAYGLSDETNAKALVKQVLSS 114

Query: 190 GLANPKKYFIESRDNRFRAMAENF-RFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            L++      +  D R+  +A+ F    P+ S +      T   +   +     N +   
Sbjct: 115 DLSDSSSLVYKLNDQRYLNLAKAFANLNPNDSAASYTAATTQQVVNSYLEQQLENDVGQQ 174

Query: 249 PIVSDQN-YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQ 301
              +    Y++    +++S    L D +L+K++Q          + D       
Sbjct: 175 DEGTQLALYFQRNAANITSGYSILGDSQLWKVVQTVYDLPESLGSIDINQQKDL 228



 Score = 70.3 bits (170), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 41/257 (15%), Positives = 83/257 (32%), Gaps = 46/257 (17%)

Query: 336 KMLDLYKKNCQIL-----HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPI 390
              + Y KN            ++      Y+  +G + S+D+ ++               
Sbjct: 40  ATFNYYSKNSDTALKQEAAQPEVARDTAYYEANIGSVTSVDDFVNNYR------------ 87

Query: 391 ITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI 450
             L +A+ AY L+ +   +  ++ VL+S+ SD  S   K  D R + L  AF   A+ + 
Sbjct: 88  -LLNYAMTAYGLSDETNAKALVKQVLSSDLSDSSSLVYKLNDQRYLNLAKAF---ANLNP 143

Query: 451 GPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLN 510
                  +  T +  V  Y  ++                         E      Y+  N
Sbjct: 144 NDSAASYTAATTQQVVNSYLEQQLE----------------NDVGQQDEGTQLALYFQRN 187

Query: 511 INTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC-------EIFKSDLKDPKSFANT 563
              I S   +L + ++   +     +       D          ++  +DL+DP   +  
Sbjct: 188 AANITSGYSILGDSQLWKVVQTVYDLPESLGSIDINQQKDLVESKVNIADLQDPTKVSAL 247

Query: 564 YKDNRYKEIISSFNFDI 580
              +R+  +  + N   
Sbjct: 248 L--DRFSAVWDATNSSA 262



 Score = 43.7 bits (101), Expect = 0.12,   Method: Composition-based stats.
 Identities = 32/232 (13%), Positives = 63/232 (27%), Gaps = 20/232 (8%)

Query: 224 RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLS 283
                T     K              +  D  YY+  I SV+S  DF+ + +L      +
Sbjct: 36  GSTFATFNYYSKNSDTALKQEAAQPEVARDTAYYEANIGSVTSVDDFVNNYRLLNYAMTA 95

Query: 284 LFPLNPE------------ITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQD 331
               +                +D    + + ND     +   F      D+++S      
Sbjct: 96  YGLSDETNAKALVKQVLSSDLSDSSSLVYKLNDQRYLNLAKAFANLNPNDSAASYTAATT 155

Query: 332 SQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPII 391
            Q+       +    +   D+   L   +Q     I S  ++L            +    
Sbjct: 156 QQVVNSYLEQQLENDVGQQDEGTQLALYFQRNAANITSGYSILGDSQL------WKVVQT 209

Query: 392 TLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFN 443
                    ++++          V  ++  DP   +     DR   +  A N
Sbjct: 210 VYDLPESLGSIDINQQKDLVESKVNIADLQDPTKVSALL--DRFSAVWDATN 259


>gi|319409193|emb|CBI82837.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 266

 Score =  200 bits (508), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 66/268 (24%), Positives = 114/268 (42%), Gaps = 30/268 (11%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +   + ++M+Q S+Q     ++  E DYY  +I  I S ++ LA+ RI  + +++ G++
Sbjct: 6   MSYRSTIDNMKQTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDRIYRYAMKAYGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                +  + ++      DP  +A+   D RY++  ++FNF ++GE         Q    
Sbjct: 66  DMIYAKGMMRKVL----SDPD-YASQLTDRRYQQFAAAFNFSVYGE------EATQRESA 114

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN---------HYEILGDSKLFK 648
              T + Y  Q +E K  E++    LALYF RTI  +            Y+ILGD  L  
Sbjct: 115 KTGTVNKYMQQTLEIKVGEENEGTRLALYFTRTIGEMTKSGVLSEKSWAYQILGDKALSA 174

Query: 649 VVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKAL 708
           VV   L +           +  +L+  + + D +D KK+E F+    AM     D +   
Sbjct: 175 VVFTALNIPESVRSSKIEAQKSLLESRMSLGDLEDPKKLEQFIARFSAM----YDAQN-- 228

Query: 709 FSSPNQNKDPWNNSFDDPQNNVSLQLSP 736
                 + +P      D      L  SP
Sbjct: 229 ----RTDTNPALTLLQDSNLGSGLAFSP 252



 Score =  165 bits (418), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/219 (25%), Positives = 100/219 (45%), Gaps = 26/219 (11%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++++   + D   +  S +  +P V  E  YY   I  I ++D+F+ D R++ YA+K
Sbjct: 1   MISTYMSYRSTIDNMKQTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDRIYRYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQ 118
           A+GL DM +A+  ++K+L    SDP    +QL   +YQ FA +++FS        +   +
Sbjct: 61  AYGLEDMIYAKGMMRKVL----SDPD-YASQLTDRRYQQFAAAFNFSVYGEEATQRESAK 115

Query: 119 HKTIIQDYKQSHQHKEEVALEESK---YFRKNIHKINS---------VDQLFKDRRLLDY 166
             T+ +  +Q+ + K     E ++   YF + I ++             Q+  D+ L   
Sbjct: 116 TGTVNKYMQQTLEIKVGEENEGTRLALYFTRTIGEMTKSGVLSEKSWAYQILGDKALSAV 175

Query: 167 VLQSFSITPKYISLPFL--KDVLTL-----GLANPKKYF 198
           V  + +I     S      K +L        L +PKK  
Sbjct: 176 VFTALNIPESVRSSKIEAQKSLLESRMSLGDLEDPKKLE 214



 Score = 76.0 bits (185), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 32/185 (17%), Positives = 65/185 (35%), Gaps = 17/185 (9%)

Query: 121 TIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYI 178
           + I + KQ+      E     E+ Y+  +I  I SVD    D R+  Y ++++ +     
Sbjct: 10  STIDNMKQTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDRIYRYAMKAYGLEDMIY 69

Query: 179 SLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK-RDKILTDMQIEKIV 237
           +   ++ VL    ++P  Y  +  D R++  A  F F   G  +  R+   T    + + 
Sbjct: 70  AKGMMRKVL----SDPD-YASQLTDRRYQQFAAAFNFSVYGEEATQRESAKTGTVNKYMQ 124

Query: 238 SNYFNNTIDCVPIVSDQNYYKLAINSVSS---------FSDFLKDPKLFKMLQLSLFPLN 288
                   +         Y+   I  ++              L D  L  ++  +L    
Sbjct: 125 QTLEIKVGEENEGTRLALYFTRTIGEMTKSGVLSEKSWAYQILGDKALSAVVFTALNIPE 184

Query: 289 PEITA 293
              ++
Sbjct: 185 SVRSS 189



 Score = 75.3 bits (183), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 43/267 (16%), Positives = 87/267 (32%), Gaps = 49/267 (18%)

Query: 335 QKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQ 394
             + ++ + + Q+ ++ +++     Y   +  I+S+D+ L+                  +
Sbjct: 10  STIDNMKQTSSQLFNEPQVKRETDYYVSHIIGIRSVDDFLADDR-------------IYR 56

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
           +A+ AY L      +  +R VL    SDPD YA++  D R  +   AFNF    S+    
Sbjct: 57  YAMKAYGLEDMIYAKGMMRKVL----SDPD-YASQLTDRRYQQFAAAFNF----SVYGEE 107

Query: 455 MMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTI 514
             Q        V  Y  +   I   E                         Y+T  I  +
Sbjct: 108 ATQRESAKTGTVNKYMQQTLEIKVGEENEGT----------------RLALYFTRTIGEM 151

Query: 515 HS---------FEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK 565
                        ++L +K +   +  +  I           +  KS L+   S  +   
Sbjct: 152 TKSGVLSEKSWAYQILGDKALSAVVFTALNIPESVRSSKIEAQ--KSLLESRMSLGDLED 209

Query: 566 DNRYKEIISSFNFDIHGELSHKKIGKV 592
             + ++ I+ F+     +        +
Sbjct: 210 PKKLEQFIARFSAMYDAQNRTDTNPAL 236



 Score = 44.4 bits (103), Expect = 0.065,   Method: Composition-based stats.
 Identities = 20/149 (13%), Positives = 53/149 (35%), Gaps = 14/149 (9%)

Query: 229 TDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN 288
           T   +++  S  FN       +  + +YY   I  + S  DFL D ++++    +    +
Sbjct: 11  TIDNMKQTSSQLFNEP----QVKRETDYYVSHIIGIRSVDDFLADDRIYRYAMKAYGLED 66

Query: 289 PEITAD--KFLTLMQENDP---IVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
                   + +    +           ++    NF      +T  Q++S     ++ Y +
Sbjct: 67  MIYAKGMMRKVLSDPDYASQLTDRRYQQFAAAFNFSVYGEEAT--QRESAKTGTVNKYMQ 124

Query: 344 NC---QILHDDKMQSLIKDYQLPLGKIKS 369
                ++  +++   L   +   +G++  
Sbjct: 125 QTLEIKVGEENEGTRLALYFTRTIGEMTK 153


>gi|254488868|ref|ZP_05102073.1| flagellar protein, putative [Roseobacter sp. GAI101]
 gi|214045737|gb|EEB86375.1| flagellar protein, putative [Roseobacter sp. GAI101]
          Length = 262

 Score =  200 bits (508), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 93/234 (39%), Gaps = 21/234 (8%)

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
                     + ++       ++E+  + +Y+  NI  I + E L+ ++R+L   L + G
Sbjct: 10  GLSGWRFLQTTYDRQFETFTKSVELKRDTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFG 69

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           +        F+ ++ +    +  S AN + D RY E+  +F F  +    +   G     
Sbjct: 70  LQDDINNRYFIRKVLEEGTTNDDSLANRFADPRYAELSKAFGFGPNESRKNGASG----- 124

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNHYEILGDSKLF 647
               +    ++    E    ++D  + +ALY +R + +I           + I+GD  L 
Sbjct: 125 -FAAEISAKFQANSFEVSTGDQDQAMRIALYAQRQLVDIAESDGSVDTKWFTIMGDPPLR 183

Query: 648 KVVSKKLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAA 694
            +  K L L   F  +   +++ + K+          I  F D++K+++ +   
Sbjct: 184 NLFQKALNLPESFGQIDIDQQLGVFKERAKKAFGTEDIATFGDTEKLQELITKF 237



 Score =  131 bits (330), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 35/184 (19%), Positives = 73/184 (39%), Gaps = 13/184 (7%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
            + F T +K   +  +  Y+++ I  I T +  +KD+RL +  L AFGL D  +   FI+
Sbjct: 22  DRQFETFTKSVELKRDTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFGLQDDINNRYFIR 81

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ--SHQHK 133
           K+LE   ++  SL N+    +Y   ++++ F P              I    Q  S +  
Sbjct: 82  KVLEEGTTNDDSLANRFADPRYAELSKAFGFGPNESRKNGASGFAAEISAKFQANSFEVS 141

Query: 134 EEVALEE---SKYFRKNIHKI--------NSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
                +    + Y ++ +  I             +  D  L +   ++ ++   +  +  
Sbjct: 142 TGDQDQAMRIALYAQRQLVDIAESDGSVDTKWFTIMGDPPLRNLFQKALNLPESFGQIDI 201

Query: 183 LKDV 186
            + +
Sbjct: 202 DQQL 205



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 39/210 (18%), Positives = 67/210 (31%), Gaps = 10/210 (4%)

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           +T      ++          +++YF+KNI  I + + L KDRRLL   L +F +     +
Sbjct: 18  QTTYDRQFETFTK-SVELKRDTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFGLQDDINN 76

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             F++ VL  G  N         D R+  +++ F F P+ S              K  +N
Sbjct: 77  RYFIRKVLEEGTTNDDSLANRFADPRYAELSKAFGFGPNESRKNGASGFAAEISAKFQAN 136

Query: 240 YFNNTIDCVPIVSDQNYYKLAI---------NSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
            F  +            Y             +  + +   + DP L  + Q +L      
Sbjct: 137 SFEVSTGDQDQAMRIALYAQRQLVDIAESDGSVDTKWFTIMGDPPLRNLFQKALNLPESF 196

Query: 291 ITADKFLTLMQENDPIVSQVKYFFQINFHR 320
              D    L    +             F  
Sbjct: 197 GQIDIDQQLGVFKERAKKAFGTEDIATFGD 226



 Score = 54.5 bits (129), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/200 (12%), Positives = 60/200 (30%), Gaps = 12/200 (6%)

Query: 350 DDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDR 409
                   + +   +   +  +        +E      +    L   L A+ L     +R
Sbjct: 18  QTTYDRQFETFTKSVELKRDTEYFQKNIGAIETAEGLVKDRRLLTVTLGAFGLQDDINNR 77

Query: 410 DQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHY 469
             +R VL    ++ DS AN+  D R  +L+ AF F  + S        +         + 
Sbjct: 78  YFIRKVLEEGTTNDDSLANRFADPRYAELSKAFGFGPNESRKNGASGFAAEISAKFQANS 137

Query: 470 ANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNF 529
                   D   +     ++       +   + +  ++T           ++ +  + N 
Sbjct: 138 FEVSTGDQDQAMRIALYAQRQLVDIAESDG-SVDTKWFT-----------IMGDPPLRNL 185

Query: 530 LLESKGIDSQKVREDFLCEI 549
             ++  +     + D   ++
Sbjct: 186 FQKALNLPESFGQIDIDQQL 205


>gi|114765258|ref|ZP_01444390.1| hypothetical protein 1100011001307_R2601_00475 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542393|gb|EAU45421.1| hypothetical protein R2601_00475 [Roseovarius sp. HTCC2601]
          Length = 274

 Score =  200 bits (508), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 40/241 (16%), Positives = 96/241 (39%), Gaps = 4/241 (1%)

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
                + ++     R   +   E+ Y+  NI  + + E+L  + R+ +F++++  ++ Q 
Sbjct: 14  QLVNATEDKDQELIRNEPQHAREIAYFLDNIGNVENVEDLTEDYRLYSFVMKAYDLEDQI 73

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
             +  + ++ +SD+ D  +  N   D+R+K+  ++  F   G+ +   +           
Sbjct: 74  FGKAMMEKLLESDINDSSALVNRLTDSRFKDFHNAMGFGPEGQGNLNTLDASWKAA---- 129

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660
             D Y        + +++  I   L F+R   +I + Y+IL DS L +       L    
Sbjct: 130 VVDKYVDTQYVNGKGDENEAIGTVLEFRRKAGSINSAYDILRDSDLSEFFRTAFGLPEAL 189

Query: 661 AVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWN 720
           A +   ++  I+   + +    D   V+D +    A+   + D   +  ++        +
Sbjct: 190 AGIDIDRQAAIINDRLDLETLSDPDVVDDLVRRYVAISDATSDIATSSNAAVTLLSGALS 249

Query: 721 N 721
            
Sbjct: 250 A 250



 Score =  161 bits (408), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 49/260 (18%), Positives = 101/260 (38%), Gaps = 18/260 (6%)

Query: 14  IQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKF 73
            + K    +  +P  + E  Y+ + I ++  +++  +D RL+S+ +KA+ L D    +  
Sbjct: 19  TEDKDQELIRNEPQHAREIAYFLDNIGNVENVEDLTEDYRLYSFVMKAYDLEDQIFGKAM 78

Query: 74  IKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK---VIQSDIQHKTIIQDYKQSH 130
           ++K+LESD++D  +LVN+L   +++ F  +  F P  +             ++  Y  + 
Sbjct: 79  MEKLLESDINDSSALVNRLTDSRFKDFHNAMGFGPEGQGNLNTLDASWKAAVVDKYVDTQ 138

Query: 131 QHKEEVALEES----KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
               +    E+      FR+    INS   + +D  L ++   +F +      +   +  
Sbjct: 139 YVNGKGDENEAIGTVLEFRRKAGSINSAYDILRDSDLSEFFRTAFGLPEALAGIDIDRQA 198

Query: 187 LT-------LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
                      L++P       R  R+ A+++        + S     L    +     +
Sbjct: 199 AIINDRLDLETLSDPDVVDDLVR--RYVAISDATSDIA--TSSNAAVTLLSGALSAASGS 254

Query: 240 YFNNTIDCVPIVSDQNYYKL 259
           Y   TID   I     Y   
Sbjct: 255 YIPATIDIDAIQGFSGYKAR 274



 Score = 97.6 bits (241), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 72/199 (36%), Gaps = 3/199 (1%)

Query: 110 PKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
                  +Q     +D  Q     E     E  YF  NI  + +V+ L +D RL  +V++
Sbjct: 6   GMSSSVALQLVNATEDKDQELIRNEPQHAREIAYFLDNIGNVENVEDLTEDYRLYSFVMK 65

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPD--GSLSKRDKI 227
           ++ +  +      ++ +L   + +         D+RF+       F P+  G+L+  D  
Sbjct: 66  AYDLEDQIFGKAMMEKLLESDINDSSALVNRLTDSRFKDFHNAMGFGPEGQGNLNTLDAS 125

Query: 228 LTDMQIEKIVS-NYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFP 286
                ++K V   Y N   D    +     ++    S++S  D L+D  L +  + +   
Sbjct: 126 WKAAVVDKYVDTQYVNGKGDENEAIGTVLEFRRKAGSINSAYDILRDSDLSEFFRTAFGL 185

Query: 287 LNPEITADKFLTLMQENDP 305
                  D        ND 
Sbjct: 186 PEALAGIDIDRQAAIINDR 204



 Score = 69.5 bits (168), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/198 (12%), Positives = 61/198 (30%), Gaps = 35/198 (17%)

Query: 354 QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLR 413
              I  +   +G ++++++L                     F + AY+L  Q   +  + 
Sbjct: 34  AREIAYFLDNIGNVENVEDLTEDYR-------------LYSFVMKAYDLEDQIFGKAMME 80

Query: 414 NVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNAD--GSIGPIPMMQSRLTIRDNVKHYAN 471
            +L S+ +D  +  N+  D R    ++A  F  +  G++  +        +   V     
Sbjct: 81  KLLESDINDSSALVNRLTDSRFKDFHNAMGFGPEGQGNLNTLDASWKAAVVDKYVDTQYV 140

Query: 472 RKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLL 531
             +   +    +                       +     +I+S  ++L +  +  F  
Sbjct: 141 NGKGDENEAIGTVLE--------------------FRRKAGSINSAYDILRDSDLSEFFR 180

Query: 532 ESKGIDSQKVREDFLCEI 549
            + G+       D   + 
Sbjct: 181 TAFGLPEALAGIDIDRQA 198


>gi|89068718|ref|ZP_01156104.1| hypothetical protein OG2516_06756 [Oceanicola granulosus HTCC2516]
 gi|89045681|gb|EAR51743.1| hypothetical protein OG2516_06756 [Oceanicola granulosus HTCC2516]
          Length = 274

 Score =  198 bits (503), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 37/199 (18%), Positives = 82/199 (41%), Gaps = 4/199 (2%)

Query: 501 NSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSF 560
              +D +   +  I + E+LLA++ +  F++ +  ++ Q   +  + ++ + D+ D K+ 
Sbjct: 34  ARAIDTFRERVGGIETVEDLLADQDVYAFVMRAYDLEDQIFGKALVGKVLEGDITDSKAL 93

Query: 561 ANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPN 620
            N   D R +E+ +   F   G  +   +             D Y  Q     + +++  
Sbjct: 94  INRLTDPRMRELYTGLGFTEGGTKNANTLDPAWQEAM----VDRYVEQHFINAQADQNAT 149

Query: 621 IALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKIND 680
           + +AL F+R  P I    ++L D+ L  ++   L +    A L   K+  +  +   I  
Sbjct: 150 VGVALEFRRAAPEISTWMDVLKDADLSTLMRTALGVPSSVAQLDIDKQAELFARKFDITK 209

Query: 681 FKDSKKVEDFLYAAKAMDH 699
            +D  +VE  +     +  
Sbjct: 210 LQDPAEVEKLVRKYAIISD 228



 Score =  137 bits (345), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 31/183 (16%), Positives = 73/183 (39%), Gaps = 10/183 (5%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
            ++D Q      +      +     +RER+  I T+++ + D+ ++++ ++A+ L D   
Sbjct: 18  ATRDQQ---LEMIGSSTRHARAIDTFRERVGGIETVEDLLADQDVYAFVMRAYDLEDQIF 74

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF---SPPPKVIQSDIQHKTIIQDY 126
            +  + K+LE D++D K+L+N+L   + +       F                + ++  Y
Sbjct: 75  GKALVGKVLEGDITDSKALINRLTDPRMRELYTGLGFTEGGTKNANTLDPAWQEAMVDRY 134

Query: 127 KQSHQHKEEVALEES----KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
            + H    +     +      FR+   +I++   + KD  L   +  +  +      L  
Sbjct: 135 VEQHFINAQADQNATVGVALEFRRAAPEISTWMDVLKDADLSTLMRTALGVPSSVAQLDI 194

Query: 183 LKD 185
            K 
Sbjct: 195 DKQ 197



 Score = 63.3 bits (152), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 27/196 (13%), Positives = 63/196 (32%), Gaps = 31/196 (15%)

Query: 354 QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLR 413
              I  ++  +G I+++++LL+                   F + AY+L  Q   +  + 
Sbjct: 34  ARAIDTFRERVGGIETVEDLLAD-------------QDVYAFVMRAYDLEDQIFGKALVG 80

Query: 414 NVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRK 473
            VL  + +D  +  N+  D R+ +L     F   G+                V  Y  + 
Sbjct: 81  KVLEGDITDSKALINRLTDPRMRELYTGLGFTEGGTKNA--NTLDPAWQEAMVDRYVEQH 138

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
                A+  +   +                   +      I ++ ++L +  +   +  +
Sbjct: 139 FINAQADQNATVGVALE----------------FRRAAPEISTWMDVLKDADLSTLMRTA 182

Query: 534 KGIDSQKVREDFLCEI 549
            G+ S   + D   + 
Sbjct: 183 LGVPSSVAQLDIDKQA 198


>gi|159184366|ref|NP_353586.2| hypothetical protein Atu0559 [Agrobacterium tumefaciens str. C58]
 gi|2459707|gb|AAB71783.1| OrfX [Agrobacterium tumefaciens]
 gi|159139680|gb|AAK86371.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 211

 Score =  198 bits (502), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 50/214 (23%), Positives = 87/214 (40%), Gaps = 15/214 (7%)

Query: 521 LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
           +A+ R+ N+ L++ G++     + F+ ++      D  +FAN   DNRY E+  S +F  
Sbjct: 1   MADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDF-- 58

Query: 581 HGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEI 640
               +                   Y  Q +E++  + +  + LALYF+R  P I++  + 
Sbjct: 59  ----AGLGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDF 114

Query: 641 LGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQ 700
           L D  L +V      L   FA     K+  +++K I I D +D +KV   L     M   
Sbjct: 115 LADDALAQVFRTTFNLPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLLERFTIM--- 171

Query: 701 SIDYKKALFSSPNQNKDPWNNSFDDPQNNVSLQL 734
             + +      P+   DP           +S  L
Sbjct: 172 -WEMQN-----PSTTYDPLAVFGSSSGYGISPDL 199



 Score =  134 bits (336), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 5/142 (3%)

Query: 49  IKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSP 108
           + D RL++YALKA GL DM++A+ FI+K+L    SD  +  N+L+  +Y   A+S DF+ 
Sbjct: 1   MADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAG 60

Query: 109 PPKVIQSDIQHKT-IIQDY-KQSHQHKEEVALEESK---YFRKNIHKINSVDQLFKDRRL 163
                 +    K+ +I +Y +Q+ + +        +   YF +    I S      D  L
Sbjct: 61  LGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDAL 120

Query: 164 LDYVLQSFSITPKYISLPFLKD 185
                 +F++   + +    K 
Sbjct: 121 AQVFRTTFNLPDAFAAADVDKQ 142



 Score = 79.1 bits (193), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 59/149 (39%), Gaps = 9/149 (6%)

Query: 158 FKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP 217
             D RL +Y L++  +     +  F++ VLT G ++   +  +  DNR+  +A++  F  
Sbjct: 1   MADTRLYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDF-- 58

Query: 218 DGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD-----QNYYKLAINSVSSFSDFLK 272
             +        T+     ++ NY   T++      +       Y++    ++ S  DFL 
Sbjct: 59  --AGLGAAATATEAAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLA 116

Query: 273 DPKLFKMLQLSLFPLNPEITADKFLTLMQ 301
           D  L ++ + +    +    AD       
Sbjct: 117 DDALAQVFRTTFNLPDAFAAADVDKQAAL 145



 Score = 76.8 bits (187), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 26/158 (16%), Positives = 50/158 (31%), Gaps = 20/158 (12%)

Query: 392 TLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIG 451
              +AL A+ L      +  +R VLT   SD +++ANK  D+R  +L  + +F   G+  
Sbjct: 6   LYNYALKAHGLEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAAA 65

Query: 452 PIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNI 511
                     I +  +    ++    +                           Y+    
Sbjct: 66  TATEAAKSGVIGNYARQTLEQEAGDDN--------------------NGVRLALYFERKA 105

Query: 512 NTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
            TI S  + LA+  +      +  +       D   + 
Sbjct: 106 PTIKSGLDFLADDALAQVFRTTFNLPDAFAAADVDKQA 143


>gi|209967005|ref|YP_002299920.1| flagellar basal-body rod protein FlgF, putative [Rhodospirillum
           centenum SW]
 gi|209960471|gb|ACJ01108.1| flagellar basal-body rod protein FlgF, putative [Rhodospirillum
           centenum SW]
          Length = 259

 Score =  197 bits (501), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 60/208 (28%), Positives = 94/208 (45%), Gaps = 8/208 (3%)

Query: 488 EQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC 547
           +   T+ R    +   ++ +   I  I S E LL ++R L F+L S  ++S+  +   L 
Sbjct: 19  DTAVTRYRDQKTVEKTINDFKTRIEKIDSPEALLKDRRALEFVLTSFQLESEIGKTGILR 78

Query: 548 EIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKH 607
           ++   D  + KS AN   D RY ++ +S        LS K     Q+   ++   + Y  
Sbjct: 79  KLLTEDPTEEKSLANRLVDPRYTKLATS--------LSGKIPEAFQNESFVNGLINNYVT 130

Query: 608 QMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERK 667
              EK   E +  +  ALYFKR I N+ +  +IL D  L  VV K L L   FA+    +
Sbjct: 131 NTFEKSVGEGNTGLREALYFKRNIANVTSVSQILADRALSYVVRKGLNLPDSFAMQDFDQ 190

Query: 668 KIRILKKHIKINDFKDSKKVEDFLYAAK 695
           + R L+K + +  FKD   VE F     
Sbjct: 191 QKRYLEKKLDLTKFKDPGYVEKFTQRFL 218



 Score =  129 bits (323), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/188 (21%), Positives = 77/188 (40%), Gaps = 5/188 (2%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           + + V     K       +       V      ++ RI+ I + +  +KD+R   + L +
Sbjct: 5   LGATVTYNILKKQGDTAVTRYRDQKTVEKTINDFKTRIEKIDSPEALLKDRRALEFVLTS 64

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKT 121
           F L         ++K+L  D ++ KSL N+L   +Y   A S      P+  Q++     
Sbjct: 65  FQLESEIGKTGILRKLLTEDPTEEKSLANRLVDPRYTKLATSLS-GKIPEAFQNESFVNG 123

Query: 122 IIQDYK----QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           +I +Y     +    +    L E+ YF++NI  + SV Q+  DR L   V +  ++   +
Sbjct: 124 LINNYVTNTFEKSVGEGNTGLREALYFKRNIANVTSVSQILADRALSYVVRKGLNLPDSF 183

Query: 178 ISLPFLKD 185
               F + 
Sbjct: 184 AMQDFDQQ 191



 Score = 83.0 bits (203), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 71/190 (37%), Gaps = 6/190 (3%)

Query: 105 DFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLL 164
                        Q  T +  Y+     ++ +       F+  I KI+S + L KDRR L
Sbjct: 4   GLGATVTYNILKKQGDTAVTRYRDQKTVEKTIND-----FKTRIEKIDSPEALLKDRRAL 58

Query: 165 DYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR 224
           ++VL SF +  +      L+ +LT      K       D R+  +A +          + 
Sbjct: 59  EFVLTSFQLESEIGKTGILRKLLTEDPTEEKSLANRLVDPRYTKLATSLS-GKIPEAFQN 117

Query: 225 DKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
           +  +  +    + + +  +  +    + +  Y+K  I +V+S S  L D  L  +++  L
Sbjct: 118 ESFVNGLINNYVTNTFEKSVGEGNTGLREALYFKRNIANVTSVSQILADRALSYVVRKGL 177

Query: 285 FPLNPEITAD 294
              +     D
Sbjct: 178 NLPDSFAMQD 187



 Score = 74.5 bits (181), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 37/210 (17%), Positives = 71/210 (33%), Gaps = 37/210 (17%)

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
           D      +      ++  I D++  + KI S + LL  +  L             +F L 
Sbjct: 19  DTAVTRYRD--QKTVEKTINDFKTRIEKIDSPEALLKDRRAL-------------EFVLT 63

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQS 458
           ++ L  +      LR +LT +P++  S AN+  D R  KL          S       Q+
Sbjct: 64  SFQLESEIGKTGILRKLLTEDPTEEKSLANRLVDPRYTKLA------TSLSGKIPEAFQN 117

Query: 459 RLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFE 518
              +   + +Y          E  +                   E  Y+  NI  + S  
Sbjct: 118 ESFVNGLINNYVTNTFEKSVGEGNTGL----------------REALYFKRNIANVTSVS 161

Query: 519 ELLANKRILNFLLESKGIDSQKVREDFLCE 548
           ++LA++ +   + +   +      +DF  +
Sbjct: 162 QILADRALSYVVRKGLNLPDSFAMQDFDQQ 191


>gi|163744335|ref|ZP_02151695.1| hypothetical protein OIHEL45_02090 [Oceanibulbus indolifex HEL-45]
 gi|161381153|gb|EDQ05562.1| hypothetical protein OIHEL45_02090 [Oceanibulbus indolifex HEL-45]
          Length = 277

 Score =  195 bits (496), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 38/246 (15%), Positives = 97/246 (39%), Gaps = 8/246 (3%)

Query: 484 FNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE 543
             + ++       +     +++ +   I  I S +E +A+  +  F++ +  ++ Q   +
Sbjct: 17  DATRDKQLDLVANDALNARQIEAFKERIGDIKSAKEFVADTEVYTFVMRAFDLEDQIFGK 76

Query: 544 DFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
             + ++ +S+  +P +  N   + + KE+  +  F   G  S             D+  D
Sbjct: 77  AMIRKVLESNSDEPSALVNRLSNPKIKEMYDTLGFAPGGGRSFNFNRTGWQ----DEVID 132

Query: 604 LYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVL 663
            +K +++     E++    +AL FK     I +  ++L D+ L   + + L +      +
Sbjct: 133 RFKERIVLNSAGEENEGARIALEFKSKAGEINSWLDVLKDADLGSFMRRALGVPNEAIGV 192

Query: 664 PERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSF 723
              ++I + ++   I   KD  +V+  +    A+     D  + + S+ N        + 
Sbjct: 193 DLDRQIALFEQKFDIEKLKDPAEVDKLVSRFSAI----YDAVEGVSSASNTVLSLMQGAV 248

Query: 724 DDPQNN 729
              Q +
Sbjct: 249 SIGQGS 254



 Score =  141 bits (355), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 48/244 (19%), Positives = 104/244 (42%), Gaps = 11/244 (4%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
            ++D Q  L   V+ D + + +   ++ERI  I +  EF+ D  ++++ ++AF L D   
Sbjct: 18  ATRDKQLDL---VANDALNARQIEAFKERIGDIKSAKEFVADTEVYTFVMRAFDLEDQIF 74

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQ---SDIQHKTIIQDY 126
            +  I+K+LES+  +P +LVN+L++ K +    +  F+P                +I  +
Sbjct: 75  GKAMIRKVLESNSDEPSALVNRLSNPKIKEMYDTLGFAPGGGRSFNFNRTGWQDEVIDRF 134

Query: 127 KQSHQHKEEVALEE----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
           K+           E    +  F+    +INS   + KD  L  ++ ++  +  + I +  
Sbjct: 135 KERIVLNSAGEENEGARIALEFKSKAGEINSWLDVLKDADLGSFMRRALGVPNEAIGVDL 194

Query: 183 LKDV-LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYF 241
            + + L     + +K    +  ++  +         +G  S  + +L+ MQ    +    
Sbjct: 195 DRQIALFEQKFDIEKLKDPAEVDKLVSRFSAIYDAVEGVSSASNTVLSLMQGAVSIGQGS 254

Query: 242 NNTI 245
           + T 
Sbjct: 255 SFTA 258



 Score = 77.2 bits (188), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/196 (15%), Positives = 66/196 (33%), Gaps = 3/196 (1%)

Query: 109 PPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVL 168
                Q  ++     +D +      + +   + + F++ I  I S  +   D  +  +V+
Sbjct: 5   GGMSTQVAVKLFDATRDKQLDLVANDALNARQIEAFKERIGDIKSAKEFVADTEVYTFVM 64

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLS---KRD 225
           ++F +  +      ++ VL      P        + + + M +   F P G  S    R 
Sbjct: 65  RAFDLEDQIFGKAMIRKVLESNSDEPSALVNRLSNPKIKEMYDTLGFAPGGGRSFNFNRT 124

Query: 226 KILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLF 285
               ++          N+  +          +K     ++S+ D LKD  L   ++ +L 
Sbjct: 125 GWQDEVIDRFKERIVLNSAGEENEGARIALEFKSKAGEINSWLDVLKDADLGSFMRRALG 184

Query: 286 PLNPEITADKFLTLMQ 301
             N  I  D    +  
Sbjct: 185 VPNEAIGVDLDRQIAL 200



 Score = 67.9 bits (164), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 31/222 (13%), Positives = 77/222 (34%), Gaps = 36/222 (16%)

Query: 333 QIQKMLDLYKKNCQ-----ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAE 387
             Q  + L+          + +D      I+ ++  +G IKS    ++            
Sbjct: 8   STQVAVKLFDATRDKQLDLVANDALNARQIEAFKERIGDIKSAKEFVADT---------- 57

Query: 388 EPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNAD 447
                  F + A++L  Q   +  +R VL SN  +P +  N+  + ++ ++     F   
Sbjct: 58  ---EVYTFVMRAFDLEDQIFGKAMIRKVLESNSDEPSALVNRLSNPKIKEMYDTLGFAPG 114

Query: 448 GSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYY 507
           G                  + +   +    D     F     +++    N      ++ +
Sbjct: 115 G-----------------GRSFNFNRTGWQDEVIDRFKERIVLNSAGEENEGARIALE-F 156

Query: 508 TLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
                 I+S+ ++L +  + +F+  + G+ ++ +  D   +I
Sbjct: 157 KSKAGEINSWLDVLKDADLGSFMRRALGVPNEAIGVDLDRQI 198


>gi|149203152|ref|ZP_01880123.1| flagellar protein, putative [Roseovarius sp. TM1035]
 gi|149143698|gb|EDM31734.1| flagellar protein, putative [Roseovarius sp. TM1035]
          Length = 267

 Score =  195 bits (494), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 88/235 (37%), Gaps = 21/235 (8%)

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
                     + E+ +     + +I  + +Y+  NI  I + E L++++R+L   L + G
Sbjct: 11  GLSGWALLSRTSERQTDLFNKSPQIVRDTEYFEQNIAKITTAEGLVSDRRLLRVALGAFG 70

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           +        F+  I +       + AN   D+RYK++  +F F          I + Q +
Sbjct: 71  LQEDINSRAFIRAILEEGTIRDDAIANRLADDRYKQLSEAFAFADR------PIPRTQLS 124

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNHYEILGDSKLF 647
               +  + ++ +  E    +++  + LAL  +R + +I           + ILG+  L 
Sbjct: 125 TFGTEITEKFRRREFEVAVGDQNQALRLALNVQRELGDIAGDAETEDTRWFRILGNPPLR 184

Query: 648 KVVSKKLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAK 695
           +V    L L   F      +++  +K           ++D       E  +    
Sbjct: 185 RVFEVALGLPDSFGQADLDRQLDEIKSRSAQQLKIGSLSDLSAESVREQLIQRFL 239



 Score =  126 bits (315), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 29/183 (15%), Positives = 70/183 (38%), Gaps = 13/183 (7%)

Query: 17  KLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKK 76
           +     +K P +  +  Y+ + I  I+T +  + D+RL   AL AFGL +  ++  FI+ 
Sbjct: 24  RQTDLFNKSPQIVRDTEYFEQNIAKITTAEGLVSDRRLLRVALGAFGLQEDINSRAFIRA 83

Query: 77  ILESDLSDPKSLVNQLNSLKYQYFARSYDFS-PPPKVIQSDIQHKTIIQDYKQS-HQHKE 134
           ILE       ++ N+L   +Y+  + ++ F+  P    Q       I + +++   +   
Sbjct: 84  ILEEGTIRDDAIANRLADDRYKQLSEAFAFADRPIPRTQLSTFGTEITEKFRRREFEVAV 143

Query: 135 EVALEE---SKYFRKNIHKI--------NSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
               +    +   ++ +  I            ++  +  L      +  +   +      
Sbjct: 144 GDQNQALRLALNVQRELGDIAGDAETEDTRWFRILGNPPLRRVFEVALGLPDSFGQADLD 203

Query: 184 KDV 186
           + +
Sbjct: 204 RQL 206



 Score = 85.7 bits (210), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 39/194 (20%), Positives = 75/194 (38%), Gaps = 9/194 (4%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +    +K    + +++YF +NI KI + + L  DRRLL   L +F +     S  F++ +
Sbjct: 25  QTDLFNKSPQIVRDTEYFEQNIAKITTAEGLVSDRRLLRVALGAFGLQEDINSRAFIRAI 84

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQ----PDGSLSKRDKILTDMQIEKIVSNYFN 242
           L  G            D+R++ ++E F F     P   LS     +T+    +       
Sbjct: 85  LEEGTIRDDAIANRLADDRYKQLSEAFAFADRPIPRTQLSTFGTEITEKFRRREFEVAVG 144

Query: 243 NTIDCVPIVSDQNYYKLAINSVSSFSD-----FLKDPKLFKMLQLSLFPLNPEITADKFL 297
           +    + +  +       I   +   D      L +P L ++ +++L   +    AD   
Sbjct: 145 DQNQALRLALNVQRELGDIAGDAETEDTRWFRILGNPPLRRVFEVALGLPDSFGQADLDR 204

Query: 298 TLMQENDPIVSQVK 311
            L +       Q+K
Sbjct: 205 QLDEIKSRSAQQLK 218



 Score = 62.5 bits (150), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 34/230 (14%), Positives = 76/230 (33%), Gaps = 32/230 (13%)

Query: 322 NSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLE 381
             S   +   +  ++  DL+ K+ QI+ D       + ++  + KI + + L+S +    
Sbjct: 11  GLSGWALLSRTSERQT-DLFNKSPQIVRD------TEYFEQNIAKITTAEGLVSDRR--- 60

Query: 382 GPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHA 441
                      L+ AL A+ L      R  +R +L       D+ AN+  DDR  +L+ A
Sbjct: 61  ----------LLRVALGAFGLQEDINSRAFIRAILEEGTIRDDAIANRLADDRYKQLSEA 110

Query: 442 FNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEIN 501
           F F                      +          +   +   ++++       + E  
Sbjct: 111 FAFADRPIPRTQLSTFGTEITEKFRRREFEVAVGDQNQALRLALNVQRELGDIAGDAETE 170

Query: 502 SEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
            +  ++            +L N  +      + G+     + D   ++ +
Sbjct: 171 -DTRWFR-----------ILGNPPLRRVFEVALGLPDSFGQADLDRQLDE 208


>gi|85706198|ref|ZP_01037293.1| flagellar protein, putative [Roseovarius sp. 217]
 gi|85669362|gb|EAQ24228.1| flagellar protein, putative [Roseovarius sp. 217]
          Length = 267

 Score =  194 bits (493), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 95/236 (40%), Gaps = 21/236 (8%)

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           S          + E+ S     + +I  + DY+   I  I + E+L++++R+L   L + 
Sbjct: 10  SGLSGWALLARTFERQSDLFNKSPQIVRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAF 69

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G+        F+  I +    +  S AN   D+RYK++  +F F          I + Q 
Sbjct: 70  GLQEDIDSRAFIRAILEGGTINEDSLANRLADDRYKQLAEAFAFADR------PIPRTQL 123

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNHYEILGDSKL 646
           +    +  + ++ +  E    ++D ++ LAL  +R + +I           + ILG++ L
Sbjct: 124 STFGSEITEKFRRREFEVAVGDQDQSLRLALNARRELGDIAGDDAAEDTRWFRILGNTPL 183

Query: 647 FKVVSKKLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAK 695
            +V    L L   FA     +++  +K           ++D  D+   E  L    
Sbjct: 184 RRVFEVALGLPESFAQADLDRQLDEIKSRAARQLNIGSLSDLADTDVQEQLLRRFL 239



 Score =  126 bits (317), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/178 (18%), Positives = 68/178 (38%), Gaps = 13/178 (7%)

Query: 22  VSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESD 81
            +K P +  +  Y+ + I  I+T ++ + D+RL   AL AFGL +   +  FI+ ILE  
Sbjct: 29  FNKSPQIVRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAFGLQEDIDSRAFIRAILEGG 88

Query: 82  LSDPKSLVNQLNSLKYQYFARSYDFS-PPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
             +  SL N+L   +Y+  A ++ F+  P    Q       I + +++          ++
Sbjct: 89  TINEDSLANRLADDRYKQLAEAFAFADRPIPRTQLSTFGSEITEKFRRREFEVAVGDQDQ 148

Query: 141 SKYFRKN------------IHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           S     N              +     ++  +  L      +  +   +      + +
Sbjct: 149 SLRLALNARRELGDIAGDDAAEDTRWFRILGNTPLRRVFEVALGLPESFAQADLDRQL 206



 Score = 84.9 bits (208), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 77/223 (34%), Gaps = 18/223 (8%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +    +K    + ++ YF + I KI + + L  DRRLL   L +F +     S  F++ +
Sbjct: 25  QSDLFNKSPQIVRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAFGLQEDIDSRAFIRAI 84

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQ----PDGSLSKRDKILTDMQIEKIVSNYFN 242
           L  G  N         D+R++ +AE F F     P   LS     +T+    +       
Sbjct: 85  LEGGTINEDSLANRLADDRYKQLAEAFAFADRPIPRTQLSTFGSEITEKFRRREFEVAVG 144

Query: 243 NTIDCVPIVSDQNYYKLAINSVSSFSD-----FLKDPKLFKMLQLSLFPLNPEITADKFL 297
           +    + +  +       I    +  D      L +  L ++ +++L        AD   
Sbjct: 145 DQDQSLRLALNARRELGDIAGDDAAEDTRWFRILGNTPLRRVFEVALGLPESFAQADLDR 204

Query: 298 TLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL 340
            L +       Q+            S S     D Q Q +   
Sbjct: 205 QLDEIKSRAARQLNI---------GSLSDLADTDVQEQLLRRF 238



 Score = 64.1 bits (154), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 32/195 (16%), Positives = 65/195 (33%), Gaps = 25/195 (12%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
              ++  +GKI + ++L+S +               L+ AL A+ L      R  +R +L
Sbjct: 39  TDYFEQTIGKITTAEDLVSDRR-------------LLRVALGAFGLQEDIDSRAFIRAIL 85

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSI 476
                + DS AN+  DDR  +L  AF F AD  I    +      I +  +         
Sbjct: 86  EGGTINEDSLANRLADDRYKQLAEAFAF-ADRPIPRTQLSTFGSEITEKFRRREFEVAVG 144

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI 536
              ++       +         +   +  ++            +L N  +      + G+
Sbjct: 145 DQDQSLRLALNARRELGDIAGDDAAEDTRWFR-----------ILGNTPLRRVFEVALGL 193

Query: 537 DSQKVREDFLCEIFK 551
                + D   ++ +
Sbjct: 194 PESFAQADLDRQLDE 208



 Score = 39.1 bits (89), Expect = 2.7,   Method: Composition-based stats.
 Identities = 23/206 (11%), Positives = 57/206 (27%), Gaps = 19/206 (9%)

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
             + +      +       IV D +Y++  I  +++  D + D +L ++   +       
Sbjct: 16  ALLARTFERQSDLFNKSPQIVRDTDYFEQTIGKITTAEDLVSDRRLLRVALGAFGLQEDI 75

Query: 291 ------------ITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKML 338
                        T ++     +  D    Q+   F      D             +   
Sbjct: 76  DSRAFIRAILEGGTINEDSLANRLADDRYKQLAEAFAF---ADRPIPRTQLSTFGSEITE 132

Query: 339 DLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
              ++  ++   D+ QSL    +L L   + + ++       +           L+   +
Sbjct: 133 KFRRREFEVAVGDQDQSL----RLALNARRELGDIAGDDAAEDTRWFRILGNTPLRRVFE 188

Query: 399 AYNLNMQDLDRDQLRNVLTSNPSDPD 424
                 +   +  L   L    S   
Sbjct: 189 VALGLPESFAQADLDRQLDEIKSRAA 214


>gi|126738585|ref|ZP_01754290.1| flagellar protein, putative [Roseobacter sp. SK209-2-6]
 gi|126720384|gb|EBA17090.1| flagellar protein, putative [Roseobacter sp. SK209-2-6]
          Length = 268

 Score =  194 bits (492), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 41/252 (16%), Positives = 93/252 (36%), Gaps = 32/252 (12%)

Query: 494 KRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSD 553
                 I  E DY+  NI  + + E+L+ ++R+L+  L + G++ Q   +  + ++ +  
Sbjct: 29  FSSGAAIERESDYFLENIGKVETAEDLIKDRRLLSVALGAFGLEDQIDMKALVQKVLEEG 88

Query: 554 LKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKK 613
                + A    D+R+     +F F          +  ++D    + T      Q  E  
Sbjct: 89  SSADDALATRLGDDRWVSFTDAFGFGPGESRKTGDLEAMKDVVFTNKT------QSFETA 142

Query: 614 EEEKDPNIALALYFKRTI------------PNI-RNHYEILGDSKLFKVVSKKLKLSPYF 660
              ++  + +ALY +R +            P+I    Y I+G  +L  ++   L L    
Sbjct: 143 VGNQEQTLRVALYAERELVPLVAEGEDGETPSINTQWYNIIGQPQLHSMMQTALGLPDSI 202

Query: 661 AVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPN 713
             +   ++++I ++          +++F D +K+ + +    A          A F++  
Sbjct: 203 GQVDVDQQVKIFREASERFFGSDDLSEFSDPEKMSNLISTYLARSEI------AAFNASI 256

Query: 714 QNKDPWNNSFDD 725
                       
Sbjct: 257 SGSSAALLLLQS 268



 Score =  137 bits (344), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 41/246 (16%), Positives = 80/246 (32%), Gaps = 32/246 (13%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
            + F   S    +  E  Y+ E I  + T ++ IKD+RL S AL AFGL D    +  ++
Sbjct: 23  DRQFEVFSSGAAIERESDYFLENIGKVETAEDLIKDRRLLSVALGAFGLEDQIDMKALVQ 82

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD--IQHKTIIQDYKQSHQHK 133
           K+LE   S   +L  +L   ++  F  ++ F P       D       +  +  QS +  
Sbjct: 83  KVLEEGSSADDALATRLGDDRWVSFTDAFGFGPGESRKTGDLEAMKDVVFTNKTQSFETA 142

Query: 134 EEVALEE---SKYFRKNIHKI-------------NSVDQLFKDRRLLDYVLQSFSITPKY 177
                +    + Y  + +  +                  +    +L   +  +  +    
Sbjct: 143 VGNQEQTLRVALYAERELVPLVAEGEDGETPSINTQWYNIIGQPQLHSMMQTALGLPDSI 202

Query: 178 ISLPFLKDVLT--------------LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK 223
             +   + V                   ++P+K          R+    F     GS + 
Sbjct: 203 GQVDVDQQVKIFREASERFFGSDDLSEFSDPEKMSNLISTYLARSEIAAFNASISGSSAA 262

Query: 224 RDKILT 229
              + +
Sbjct: 263 LLLLQS 268



 Score = 87.6 bits (215), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 38/217 (17%), Positives = 69/217 (31%), Gaps = 16/217 (7%)

Query: 120 KTIIQDYKQSHQHKEEVAL--EESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
             +   Y +  +     A    ES YF +NI K+ + + L KDRRLL   L +F +  + 
Sbjct: 16  NFLQSTYDRQFEVFSSGAAIERESDYFLENIGKVETAEDLIKDRRLLSVALGAFGLEDQI 75

Query: 178 ISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIV 237
                ++ VL  G +          D+R+ +  + F F P  S    D       +    
Sbjct: 76  DMKALVQKVLEEGSSADDALATRLGDDRWVSFTDAFGFGPGESRKTGDLEAMKDVVFTNK 135

Query: 238 SNYFNNTIDCVPIVSDQNYYKLA-------------INSV-SSFSDFLKDPKLFKMLQLS 283
           +  F   +           Y                  S+ + + + +  P+L  M+Q +
Sbjct: 136 TQSFETAVGNQEQTLRVALYAERELVPLVAEGEDGETPSINTQWYNIIGQPQLHSMMQTA 195

Query: 284 LFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHR 320
           L   +     D    +    +             F  
Sbjct: 196 LGLPDSIGQVDVDQQVKIFREASERFFGSDDLSEFSD 232



 Score = 56.8 bits (135), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 37/250 (14%), Positives = 81/250 (32%), Gaps = 34/250 (13%)

Query: 351 DKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
             ++     +   +GK+++ ++L+  +               L  AL A+ L  Q   + 
Sbjct: 33  AAIERESDYFLENIGKVETAEDLIKDRR-------------LLSVALGAFGLEDQIDMKA 79

Query: 411 QLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYA 470
            ++ VL    S  D+ A +  DDR +    AF F   G       +++   +    K  +
Sbjct: 80  LVQKVLEEGSSADDALATRLGDDRWVSFTDAFGFGP-GESRKTGDLEAMKDVVFTNKTQS 138

Query: 471 NRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFL 530
                 +  +        +      +    + E          I      +   ++ + +
Sbjct: 139 FETAVGNQEQTLRVALYAERELVPLVAEGEDGETPSINTQWYNI------IGQPQLHSMM 192

Query: 531 LESKGIDSQKVREDFLCEI----------FKSD----LKDPKSFANTYKDNRYKEIISSF 576
             + G+     + D   ++          F SD      DP+  +N       +  I++F
Sbjct: 193 QTALGLPDSIGQVDVDQQVKIFREASERFFGSDDLSEFSDPEKMSNLISTYLARSEIAAF 252

Query: 577 NFDIHGELSH 586
           N  I G  + 
Sbjct: 253 NASISGSSAA 262


>gi|319406970|emb|CBI80607.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 266

 Score =  193 bits (490), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 59/244 (24%), Positives = 107/244 (43%), Gaps = 24/244 (9%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +   + ++M+Q   +     ++  E DYY  +I  + S +E LAN +I N+ +++ G++
Sbjct: 6   TSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDEFLANDKIYNYAMKAYGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                +  + ++      DP+ +A+   D RY++   +FNF  +GE +       Q    
Sbjct: 66  DMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKAT------QRESA 114

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN---------HYEILGDSKLFK 648
              T + Y  Q +E +  E +    LALYF RTI  +            Y+IL D  L  
Sbjct: 115 KTVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSA 174

Query: 649 VVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKAL 708
           V+ K   +S      P   +  +L+  + + D +D KK+E  +    AM     D +   
Sbjct: 175 VIFKAFNISENVLTSPIEVQKSLLESRMSLKDLQDPKKLEHLIAKFSAM----YDVQNQT 230

Query: 709 FSSP 712
             +P
Sbjct: 231 VVNP 234



 Score =  169 bits (428), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 104/228 (45%), Gaps = 21/228 (9%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + + P V  E  YY + I  + ++DEF+ + ++++YA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDEFLANDKIYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP-KVIQSDIQH 119
           A+GL DM  A+  I+K+L    SDP+   +QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAK 115

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINS---------VDQLFKDRRLLDY 166
              +  Y +Q+ + +     E ++   YF + I  +             Q+  D+ L   
Sbjct: 116 TVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
           + ++F+I+   ++ P   +V    L +           +   +   F 
Sbjct: 176 IFKAFNISENVLTSPI--EVQKSLLESRMSLKDLQDPKKLEHLIAKFS 221



 Score = 78.7 bits (192), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 43/248 (17%), Positives = 80/248 (32%), Gaps = 55/248 (22%)

Query: 330 QDSQIQKMLDLYKKNCQIL-HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEE 388
             +  +  +D  K+    L    +++     Y   +  +KS+D  L+             
Sbjct: 4   TYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDEFLAND----------- 52

Query: 389 PIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
                 +A+ AY L      +  +R VL    SDP+ YA++  D R  +   AFNF+  G
Sbjct: 53  --KIYNYAMKAYGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYG 105

Query: 449 SIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYT 508
                   Q        V  Y  +   +   E                         Y+T
Sbjct: 106 E----KATQRESAKTVTVNKYMQQTLEVEVGEVNEGT----------------RLALYFT 145

Query: 509 LNINTIHSFE---------ELLANKRILNFLLESKGIDSQKVRE--DFLCEIFKS----- 552
             I  +             ++L++K +   + ++  I    +    +    + +S     
Sbjct: 146 RTIGGMVQNNVLTEKNWAYQILSDKALSAVIFKAFNISENVLTSPIEVQKSLLESRMSLK 205

Query: 553 DLKDPKSF 560
           DL+DPK  
Sbjct: 206 DLQDPKKL 213



 Score = 78.3 bits (191), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 75/201 (37%), Gaps = 17/201 (8%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   +++ I + KQ+     ++     E+ Y+ K+I  + SVD+   + ++ +Y +++
Sbjct: 2   ISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDEFLANDKIYNYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK-RDKILT 229
           + +     +   ++ VL    ++P+ Y  +  D R++  AE F F   G  +  R+   T
Sbjct: 62  YGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAKT 116

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSS---------FSDFLKDPKLFKML 280
               + +         +         Y+   I  +               L D  L  ++
Sbjct: 117 VTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAVI 176

Query: 281 QLSLFPLNPEITADKFLTLMQ 301
             +       +T+   +    
Sbjct: 177 FKAFNISENVLTSPIEVQKSL 197



 Score = 44.4 bits (103), Expect = 0.067,   Method: Composition-based stats.
 Identities = 27/213 (12%), Positives = 67/213 (31%), Gaps = 29/213 (13%)

Query: 229 TDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN 288
           T   +++     F        +  + +YY   I  V S  +FL + K++     +    +
Sbjct: 11  TIDNMKQTFDRLFQKP----QVKRETDYYVKHIIGVKSVDEFLANDKIYNYAMKAYGLED 66

Query: 289 PEITAD--KFLTLMQENDP---IVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
                   + +    E           ++    NF +    +T  Q++S     ++ Y +
Sbjct: 67  MIFAKGMIRKVLSDPEYASQLVDKRYQQFAEAFNFSKYGEKAT--QRESAKTVTVNKYMQ 124

Query: 344 NCQILHDDKM---QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPII--TLQFALD 398
               +   ++     L   +   +G +      +      E   + +             
Sbjct: 125 QTLEVEVGEVNEGTRLALYFTRTIGGM------VQNNVLTEKNWAYQILSDKALSAVIFK 178

Query: 399 AYNLNMQDLDR--DQLRNVLTS-----NPSDPD 424
           A+N++   L    +  +++L S     +  DP 
Sbjct: 179 AFNISENVLTSPIEVQKSLLESRMSLKDLQDPK 211


>gi|319403954|emb|CBI77542.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 266

 Score =  193 bits (490), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 58/244 (23%), Positives = 107/244 (43%), Gaps = 24/244 (9%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +   + ++M+Q   +     ++  E DYY  +I  + S ++ LAN +I N+ +++ G++
Sbjct: 6   TSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKIYNYAMKAYGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                +  + ++      DP+ +A+   D RY++   +FNF  +GE +       Q    
Sbjct: 66  DMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKAT------QRESA 114

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN---------HYEILGDSKLFK 648
              T + Y  Q +E +  E +    LALYF RTI  +            Y+IL D  L  
Sbjct: 115 KTVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSA 174

Query: 649 VVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKAL 708
           V+ K   +S      P   +  +L+  + + D +D KK+E  +    AM     D +   
Sbjct: 175 VIFKAFNISENVLTSPIEVQKSLLESRMSLKDLQDPKKLEHLIAKFSAM----YDVQNQT 230

Query: 709 FSSP 712
             +P
Sbjct: 231 VVNP 234



 Score =  169 bits (427), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 104/228 (45%), Gaps = 21/228 (9%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + + P V  E  YY + I  + ++D+F+ + ++++YA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKIYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP-KVIQSDIQH 119
           A+GL DM  A+  I+K+L    SDP+   +QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAK 115

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKINS---------VDQLFKDRRLLDY 166
              +  Y +Q+ + +     E ++   YF + I  +             Q+  D+ L   
Sbjct: 116 TVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
           + ++F+I+   ++ P   +V    L +           +   +   F 
Sbjct: 176 IFKAFNISENVLTSPI--EVQKSLLESRMSLKDLQDPKKLEHLIAKFS 221



 Score = 80.3 bits (196), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 40/240 (16%), Positives = 84/240 (35%), Gaps = 39/240 (16%)

Query: 330 QDSQIQKMLDLYKKNCQIL-HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEE 388
             +  +  +D  K+    L    +++     Y   +  +KS+D+ L+             
Sbjct: 4   TYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLAND----------- 52

Query: 389 PIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
                 +A+ AY L      +  +R VL    SDP+ YA++  D R  +   AFNF+  G
Sbjct: 53  --KIYNYAMKAYGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYG 105

Query: 449 SIGPIPMMQSRLTIRDNV-KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYY 507
                      +T+   + +        +++    +      I    + N+       Y 
Sbjct: 106 EKATQRESAKTVTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAY- 164

Query: 508 TLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE--DFLCEIFKS-----DLKDPKSF 560
                      ++L++K +   + ++  I    +    +    + +S     DL+DPK  
Sbjct: 165 -----------QILSDKALSAVIFKAFNISENVLTSPIEVQKSLLESRMSLKDLQDPKKL 213



 Score = 79.1 bits (193), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/201 (15%), Positives = 74/201 (36%), Gaps = 17/201 (8%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   +++ I + KQ+     ++     E+ Y+ K+I  + SVD    + ++ +Y +++
Sbjct: 2   ISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKIYNYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK-RDKILT 229
           + +     +   ++ VL    ++P+ Y  +  D R++  AE F F   G  +  R+   T
Sbjct: 62  YGLEDMIFAKGMIRKVL----SDPE-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAKT 116

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSS---------FSDFLKDPKLFKML 280
               + +         +         Y+   I  +               L D  L  ++
Sbjct: 117 VTVNKYMQQTLEVEVGEVNEGTRLALYFTRTIGGMVQNNVLTEKNWAYQILSDKALSAVI 176

Query: 281 QLSLFPLNPEITADKFLTLMQ 301
             +       +T+   +    
Sbjct: 177 FKAFNISENVLTSPIEVQKSL 197



 Score = 44.8 bits (104), Expect = 0.060,   Method: Composition-based stats.
 Identities = 28/213 (13%), Positives = 67/213 (31%), Gaps = 29/213 (13%)

Query: 229 TDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN 288
           T   +++     F        +  + +YY   I  V S  DFL + K++     +    +
Sbjct: 11  TIDNMKQTFDRLFQKP----QVKRETDYYVKHIIGVKSVDDFLANDKIYNYAMKAYGLED 66

Query: 289 PEITAD--KFLTLMQENDP---IVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
                   + +    E           ++    NF +    +T  Q++S     ++ Y +
Sbjct: 67  MIFAKGMIRKVLSDPEYASQLVDKRYQQFAEAFNFSKYGEKAT--QRESAKTVTVNKYMQ 124

Query: 344 NCQILHDDKM---QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPII--TLQFALD 398
               +   ++     L   +   +G +      +      E   + +             
Sbjct: 125 QTLEVEVGEVNEGTRLALYFTRTIGGM------VQNNVLTEKNWAYQILSDKALSAVIFK 178

Query: 399 AYNLNMQDLDR--DQLRNVLTS-----NPSDPD 424
           A+N++   L    +  +++L S     +  DP 
Sbjct: 179 AFNISENVLTSPIEVQKSLLESRMSLKDLQDPK 211


>gi|83944192|ref|ZP_00956648.1| hypothetical protein EE36_02633 [Sulfitobacter sp. EE-36]
 gi|83845059|gb|EAP82940.1| hypothetical protein EE36_02633 [Sulfitobacter sp. EE-36]
          Length = 274

 Score =  192 bits (487), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 42/265 (15%), Positives = 96/265 (36%), Gaps = 9/265 (3%)

Query: 482 KSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKV 541
               + ++     R +       + +   I  I S EEL+A+  + +F++ +  ++ Q  
Sbjct: 15  LIDATRDKQLDLMRDSAANKRAEEAFRDRIGDISSPEELIADFEVYSFVMRAFDLEDQIF 74

Query: 542 REDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDT 601
            +  + ++ +SD  +P S  N   D+R++E+  +  F          +    D   ++D 
Sbjct: 75  GKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLT---DPDFLNDV 131

Query: 602 CDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
              + ++    + + ++  +   L F+     I N +E+L   KL       L L    +
Sbjct: 132 TTRFYNRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLASEKLTNFFQVALSLPEQMS 191

Query: 662 VLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNN 721
            L   K+  +L     +    D  + E  +    A+     D         N        
Sbjct: 192 ALDLDKQKALLADKFDLEKLADPAEREKLIARYVAIS----DAVNPQGFQANSIALDLLQ 247

Query: 722 SFDDPQN--NVSLQLSPQKKSNGRF 744
           S++       +++ ++    S  R 
Sbjct: 248 SYNLGGQFVPITIDVTAVTFSASRL 272



 Score =  126 bits (317), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/218 (20%), Positives = 92/218 (42%), Gaps = 16/218 (7%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
            ++D Q  L    + +      E  +R+RI  IS+ +E I D  ++S+ ++AF L D   
Sbjct: 18  ATRDKQLDLMRDSAAN---KRAEEAFRDRIGDISSPEELIADFEVYSFVMRAFDLEDQIF 74

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH-----KTIIQ 124
            +  I+K+LESD  +P SL+N+L   +++    +  F+        D+           +
Sbjct: 75  GKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTR 134

Query: 125 DYKQSHQHKEEVALE---ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLP 181
            Y + + ++ +   E       FR     IN+  ++    +L ++   + S+  +  +L 
Sbjct: 135 FYNRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLASEKLTNFFQVALSLPEQMSALD 194

Query: 182 FLKD-VLTLGLANPKKYFIESR----DNRFRAMAENFR 214
             K   L     + +K    +       R+ A+++   
Sbjct: 195 LDKQKALLADKFDLEKLADPAEREKLIARYVAISDAVN 232



 Score = 82.2 bits (201), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 33/204 (16%), Positives = 63/204 (30%), Gaps = 9/204 (4%)

Query: 105 DFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLL 164
                  +   D      +   + S  +K          FR  I  I+S ++L  D  + 
Sbjct: 6   GLGSSTALKLIDATRDKQLDLMRDSAANKRAEEA-----FRDRIGDISSPEELIADFEVY 60

Query: 165 DYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR 224
            +V+++F +  +      ++ +L      P        D+RFR M     F  +      
Sbjct: 61  SFVMRAFDLEDQIFGKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTP 120

Query: 225 D----KILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKML 280
           D      L D+        Y N        V     ++   + ++++ + L   KL    
Sbjct: 121 DLTDPDFLNDVTTRFYNRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLASEKLTNFF 180

Query: 281 QLSLFPLNPEITADKFLTLMQEND 304
           Q++L         D         D
Sbjct: 181 QVALSLPEQMSALDLDKQKALLAD 204



 Score = 69.1 bits (167), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 38/234 (16%), Positives = 88/234 (37%), Gaps = 35/234 (14%)

Query: 349 HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
                +   + ++  +G I S + L++                   F + A++L  Q   
Sbjct: 29  DSAANKRAEEAFRDRIGDISSPEELIAD-------------FEVYSFVMRAFDLEDQIFG 75

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKH 468
           +  +R +L S+P +P S  N+  D R  +++ A  F  +       +           + 
Sbjct: 76  KGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTRF 135

Query: 469 YANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN 528
           Y  +  + +DA+N++  ++ +                 +    + I+++ E+LA++++ N
Sbjct: 136 YNRQYINENDAQNETVGTVLE-----------------FRDKFSGINNWFEVLASEKLTN 178

Query: 529 FLLESKGIDSQKVREDFLC-EIFKSDLKDPKSFANTYKDN----RYKEIISSFN 577
           F   +  +  Q    D    +   +D  D +  A+  +      RY  I  + N
Sbjct: 179 FFQVALSLPEQMSALDLDKQKALLADKFDLEKLADPAEREKLIARYVAISDAVN 232


>gi|312115256|ref|YP_004012852.1| hypothetical protein Rvan_2538 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220385|gb|ADP71753.1| protein of unknown function DUF1217 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 264

 Score =  191 bits (486), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 61/257 (23%), Positives = 108/257 (42%), Gaps = 16/257 (6%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             S         N+  + +        + S+ +YY  NI  I S +EL+ + ++ ++ L 
Sbjct: 1   MTSTLTTFLSISNNYSKWTEITAAEPSVASQTEYYKANIGNITSADELVGDYKLFSYALT 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G+  +   +    ++      D  S ++        E+  +FNF+ +G  +       
Sbjct: 61  AYGLGDEVYAKALYKKVLSEG-TDKGSLSSKLGKLGVTELAKTFNFEENGTSTTT----- 114

Query: 593 QDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSK 652
             +   +D  DLY  Q +E+K+ E +    +ALYF R    I + Y+IL D  L K V  
Sbjct: 115 -SDAVQNDVVDLYLAQTLEEKQGETNEGAQMALYFYRNASKIDSVYDILADKTLLKTVYT 173

Query: 653 KLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            L LS Y A +   K+  +L K + +NDFKD +K+  F+     +     D +       
Sbjct: 174 ALGLSEYTAAMNIDKQASLLSKALDLNDFKDPQKLTSFIAKFSTL----YDSENN----- 224

Query: 713 NQNKDPWNNSFDDPQNN 729
           N   D  +  F    +N
Sbjct: 225 NTASDYVSALFGTSSSN 241



 Score =  160 bits (403), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 51/219 (23%), Positives = 92/219 (42%), Gaps = 8/219 (3%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           M  +        +  SK     + +P V+ +  YY+  I +I++ DE + D +LFSYAL 
Sbjct: 1   MTSTLTTFLSISNNYSKWTEITAAEPSVASQTEYYKANIGNITSADELVGDYKLFSYALT 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQH 119
           A+GL D  +A+   KK+L    +D  SL ++L  L     A++++F         SD   
Sbjct: 61  AYGLGDEVYAKALYKKVLSEG-TDKGSLSSKLGKLGVTELAKTFNFEENGTSTTTSDAVQ 119

Query: 120 KTIIQDYKQSHQHKEEVALEE----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITP 175
             ++  Y      +++    E    + YF +N  KI+SV  +  D+ LL  V  +  ++ 
Sbjct: 120 NDVVDLYLAQTLEEKQGETNEGAQMALYFYRNASKIDSVYDILADKTLLKTVYTALGLSE 179

Query: 176 KYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
              ++   K      L+            +  +    F 
Sbjct: 180 YTAAMNIDKQA--SLLSKALDLNDFKDPQKLTSFIAKFS 216



 Score = 85.7 bits (210), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 44/256 (17%), Positives = 88/256 (34%), Gaps = 31/256 (12%)

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
               E     +++Y++ NI  I S D+L  D +L  Y L ++ +  +  +    K VL+ 
Sbjct: 21  ITAAEPSVASQTEYYKANIGNITSADELVGDYKLFSYALTAYGLGDEVYAKALYKKVLSE 80

Query: 190 GLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP 249
           G  +      +        +A+ F F+ +G+ +      +D     +V  Y   T++   
Sbjct: 81  G-TDKGSLSSKLGKLGVTELAKTFNFEENGTSTT----TSDAVQNDVVDLYLAQTLEEKQ 135

Query: 250 IVSDQ-----NYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND 304
             +++      Y+    + + S  D L D  L K +  +L           +   M  + 
Sbjct: 136 GETNEGAQMALYFYRNASKIDSVYDILADKTLLKTVYTALGLSE-------YTAAMNIDK 188

Query: 305 PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPL 364
                 K     +F                 + L  +      L+D +  +   DY   L
Sbjct: 189 QASLLSKALDLNDFKD--------------PQKLTSFIAKFSTLYDSENNNTASDYVSAL 234

Query: 365 GKIKSIDNLLSGKCQL 380
               S + ++S    L
Sbjct: 235 FGTSSSNGVVSFSVDL 250



 Score = 50.2 bits (118), Expect = 0.001,   Method: Composition-based stats.
 Identities = 31/187 (16%), Positives = 64/187 (34%), Gaps = 15/187 (8%)

Query: 224 RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLS 283
              + T + I    S +   T     + S   YYK  I +++S  + + D KLF     +
Sbjct: 2   TSTLTTFLSISNNYSKWTEITAAEPSVASQTEYYKANIGNITSADELVGDYKLFSYALTA 61

Query: 284 LFPLNPEITADKFLTLMQENDP---------IVSQVKYFFQINFHRDNSSSTKIQQDSQI 334
               +       +  ++ E             +   +     NF  + +S+T    D+  
Sbjct: 62  YGLGDEVYAKALYKKVLSEGTDKGSLSSKLGKLGVTELAKTFNFEENGTSTTT--SDAVQ 119

Query: 335 QKMLDLYKKNCQILHDDKMQSLIK---DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPII 391
             ++DLY          +     +    +     KI S+ ++L+ K  L+   +A     
Sbjct: 120 NDVVDLYLAQTLEEKQGETNEGAQMALYFYRNASKIDSVYDILADKTLLKTVYTALGLSE 179

Query: 392 TLQFALD 398
               A++
Sbjct: 180 -YTAAMN 185


>gi|255263694|ref|ZP_05343036.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255106029|gb|EET48703.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 262

 Score =  191 bits (485), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 50/236 (21%), Positives = 92/236 (38%), Gaps = 21/236 (8%)

Query: 490 ISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
             T      +I     Y+  NI+ I + E L+A++++L   L + G+D       F+  I
Sbjct: 24  QQTAFNEAPQIERATSYFRENISKITTAEALVADRQLLEVALGAFGLDDDINNTYFIKTI 83

Query: 550 FKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
            +    D  + AN   D+RYKE   SF F                    DD  + ++   
Sbjct: 84  LEEGTLDDDALANRLADSRYKEFAESFGFGDFSTPRTVLSTFP------DDIINRFEAGQ 137

Query: 610 IEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFA 661
            E+   E++P++ LAL F  T+ +I           ++I+G+    K+    L L   FA
Sbjct: 138 FEQAVGEQNPDLRLALNFSSTMESILATDSSNDVLWFKIMGNPPARKLFETALGLPASFA 197

Query: 662 VLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFS 710
            +   +++ I K+          ++DF      +D +     +       + +  S
Sbjct: 198 QIDIDRQLGIFKERSMSRFGTNSVSDFSSPDTQDDIIRNFLVLSEMDQFAQTSSGS 253



 Score =  125 bits (314), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/180 (20%), Positives = 67/180 (37%), Gaps = 13/180 (7%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
           +  ++ P +     Y+RE I  I+T +  + D++L   AL AFGL D  +   FIK ILE
Sbjct: 26  TAFNEAPQIERATSYFRENISKITTAEALVADRQLLEVALGAFGLDDDINNTYFIKTILE 85

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYKQ-SHQHKEEVA 137
               D  +L N+L   +Y+ FA S+ F                II  ++    +      
Sbjct: 86  EGTLDDDALANRLADSRYKEFAESFGFGDFSTPRTVLSTFPDDIINRFEAGQFEQAVGEQ 145

Query: 138 LEE---SKYFRKNIHKINSVDQ--------LFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
             +   +  F   +  I + D         +  +         +  +   +  +   + +
Sbjct: 146 NPDLRLALNFSSTMESILATDSSNDVLWFKIMGNPPARKLFETALGLPASFAQIDIDRQL 205



 Score = 90.7 bits (223), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 36/203 (17%), Positives = 73/203 (35%), Gaps = 9/203 (4%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +Q+  ++       + YFR+NI KI + + L  DR+LL+  L +F +     +  F+K +
Sbjct: 24  QQTAFNEAPQIERATSYFRENISKITTAEALVADRQLLEVALGAFGLDDDINNTYFIKTI 83

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
           L  G  +         D+R++  AE+F F    +         D  I +  +  F   + 
Sbjct: 84  LEEGTLDDDALANRLADSRYKEFAESFGFGDFSTPRTVLSTFPDDIINRFEAGQFEQAVG 143

Query: 247 CVPIVSDQNY-YKLAINSVSSFSD--------FLKDPKLFKMLQLSLFPLNPEITADKFL 297
                      +   + S+ +            + +P   K+ + +L         D   
Sbjct: 144 EQNPDLRLALNFSSTMESILATDSSNDVLWFKIMGNPPARKLFETALGLPASFAQIDIDR 203

Query: 298 TLMQENDPIVSQVKYFFQINFHR 320
            L    +  +S+       +F  
Sbjct: 204 QLGIFKERSMSRFGTNSVSDFSS 226



 Score = 59.5 bits (142), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/175 (10%), Positives = 56/175 (32%), Gaps = 20/175 (11%)

Query: 340 LYKKNCQILHDDKM------QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITL 393
            + +    +           +     ++  + KI + + L++                 L
Sbjct: 15  RFLERTLDVQQTAFNEAPQIERATSYFRENISKITTAEALVAD-------------RQLL 61

Query: 394 QFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPI 453
           + AL A+ L+    +   ++ +L     D D+ AN+  D R  +   +F F    +   +
Sbjct: 62  EVALGAFGLDDDINNTYFIKTILEEGTLDDDALANRLADSRYKEFAESFGFGDFSTPRTV 121

Query: 454 PMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYT 508
                   I +  +     +       +         + +  +  + +++V ++ 
Sbjct: 122 LSTFPD-DIINRFEAGQFEQAVGEQNPDLRLALNFSSTMESILATDSSNDVLWFK 175


>gi|319898630|ref|YP_004158723.1| hypothetical protein BARCL_0458 [Bartonella clarridgeiae 73]
 gi|319402594|emb|CBI76139.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 266

 Score =  191 bits (485), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 55/244 (22%), Positives = 106/244 (43%), Gaps = 24/244 (9%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +   + ++M+Q   +     ++  E DYY  +I  + S ++ LAN ++ ++ +++ G++
Sbjct: 6   TSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKVYSYAMKAYGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                +  + ++      DP  +A+   D RY++   +FNF  +GE +       Q    
Sbjct: 66  DMIFAKGMIRKVL----SDP-QYASQLVDKRYQQFAEAFNFSKYGEKAT------QRESA 114

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN---------HYEILGDSKLFK 648
              T + Y  Q +E +  + +    LALYF RT+  +            Y+IL D  L  
Sbjct: 115 KTVTVNKYMQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILKEKNWAYQILSDKALSA 174

Query: 649 VVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKAL 708
           VV K   +S      P   +  +L+  + + D +D KK+E  +    AM     D +   
Sbjct: 175 VVFKAFNISENVLTSPIESQKSLLESRMSLKDLQDPKKLEHLIAKFSAM----YDVQNQT 230

Query: 709 FSSP 712
             +P
Sbjct: 231 MINP 234



 Score =  169 bits (427), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 103/228 (45%), Gaps = 21/228 (9%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + + P V  E  YY + I  + ++D+F+ + +++SYA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKVYSYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP-KVIQSDIQH 119
           A+GL DM  A+  I+K+L    SDP+   +QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKVL----SDPQ-YASQLVDKRYQQFAEAFNFSKYGEKATQRESAK 115

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y +Q+ + +     E ++   YF + +  +         N   Q+  D+ L   
Sbjct: 116 TVTVNKYMQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILKEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
           V ++F+I+   ++ P         L +           +   +   F 
Sbjct: 176 VFKAFNISENVLTSPIESQ--KSLLESRMSLKDLQDPKKLEHLIAKFS 221



 Score = 79.5 bits (194), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 83/240 (34%), Gaps = 39/240 (16%)

Query: 330 QDSQIQKMLDLYKKNCQIL-HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEE 388
             +  +  +D  K+    L    +++     Y   +  +KS+D+ L+             
Sbjct: 4   TYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLAND----------- 52

Query: 389 PIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
                 +A+ AY L      +  +R VL    SDP  YA++  D R  +   AFNF+  G
Sbjct: 53  --KVYSYAMKAYGLEDMIFAKGMIRKVL----SDPQ-YASQLVDKRYQQFAEAFNFSKYG 105

Query: 449 SIGPIPMMQSRLTIRDNV-KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYY 507
                      +T+   + +        +++    +      +    + N+       Y 
Sbjct: 106 EKATQRESAKTVTVNKYMQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILKEKNWAY- 164

Query: 508 TLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE--DFLCEIFKS-----DLKDPKSF 560
                      ++L++K +   + ++  I    +    +    + +S     DL+DPK  
Sbjct: 165 -----------QILSDKALSAVVFKAFNISENVLTSPIESQKSLLESRMSLKDLQDPKKL 213



 Score = 78.3 bits (191), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 30/194 (15%), Positives = 71/194 (36%), Gaps = 17/194 (8%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   +++ I + KQ+     ++     E+ Y+ K+I  + SVD    + ++  Y +++
Sbjct: 2   ISTYTSYRSTIDNMKQTFDRLFQKPQVKRETDYYVKHIIGVKSVDDFLANDKVYSYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK-RDKILT 229
           + +     +   ++ VL    ++P +Y  +  D R++  AE F F   G  +  R+   T
Sbjct: 62  YGLEDMIFAKGMIRKVL----SDP-QYASQLVDKRYQQFAEAFNFSKYGEKATQRESAKT 116

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSS---------FSDFLKDPKLFKML 280
               + +                   Y+   +  +               L D  L  ++
Sbjct: 117 VTVNKYMQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILKEKNWAYQILSDKALSAVV 176

Query: 281 QLSLFPLNPEITAD 294
             +       +T+ 
Sbjct: 177 FKAFNISENVLTSP 190



 Score = 45.6 bits (106), Expect = 0.033,   Method: Composition-based stats.
 Identities = 27/210 (12%), Positives = 69/210 (32%), Gaps = 23/210 (10%)

Query: 229 TDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLN 288
           T   +++     F        +  + +YY   I  V S  DFL + K++     +    +
Sbjct: 11  TIDNMKQTFDRLFQKP----QVKRETDYYVKHIIGVKSVDDFLANDKVYSYAMKAYGLED 66

Query: 289 PEITAD--KFLTLMQENDP---IVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
                   + +    +           ++    NF +    +T  Q++S     ++ Y +
Sbjct: 67  MIFAKGMIRKVLSDPQYASQLVDKRYQQFAEAFNFSKYGEKAT--QRESAKTVTVNKYMQ 124

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPII--TLQFALDAYN 401
               +   ++       +L L   +++  ++      E   + +             A+N
Sbjct: 125 QTLEVEAGQVNEGT---RLALYFTRTVGGMVKDNILKEKNWAYQILSDKALSAVVFKAFN 181

Query: 402 LNMQDLDR--DQLRNVLTS-----NPSDPD 424
           ++   L    +  +++L S     +  DP 
Sbjct: 182 ISENVLTSPIESQKSLLESRMSLKDLQDPK 211


>gi|83955108|ref|ZP_00963764.1| hypothetical protein NAS141_03346 [Sulfitobacter sp. NAS-14.1]
 gi|83840437|gb|EAP79610.1| hypothetical protein NAS141_03346 [Sulfitobacter sp. NAS-14.1]
          Length = 274

 Score =  191 bits (484), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 42/265 (15%), Positives = 98/265 (36%), Gaps = 9/265 (3%)

Query: 482 KSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKV 541
               + ++     R +       + +   I  I S EEL+A+  + +F++ +  ++ Q  
Sbjct: 15  LIDATRDKQLDLMRDSAANKRAEEAFRNRIGDISSPEELIADFEVYSFVMRAFDLEDQIF 74

Query: 542 REDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDT 601
            +  + ++ +SD  +P S  N   D+R++E+  +  F          +    D   ++D 
Sbjct: 75  GKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLT---DPDFLNDV 131

Query: 602 CDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
              + ++    + + ++  +   L F+     I N +E+L + KL       L L    +
Sbjct: 132 TTRFYNRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLANEKLTNFFQVALSLPEQMS 191

Query: 662 VLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNN 721
            L   K+  +L     +    D  + E+ +    A+     D         N        
Sbjct: 192 ALDLDKQKALLADKFDLEKLADPAERENLIARYVAIS----DAVNPQGFQANSIALDLLQ 247

Query: 722 SFDDPQN--NVSLQLSPQKKSNGRF 744
           S++       +++ ++    S  R 
Sbjct: 248 SYNLGGQFVPITIDVTAVTFSASRL 272



 Score =  128 bits (320), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 44/218 (20%), Positives = 92/218 (42%), Gaps = 16/218 (7%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
            ++D Q  L    + +      E  +R RI  IS+ +E I D  ++S+ ++AF L D   
Sbjct: 18  ATRDKQLDLMRDSAAN---KRAEEAFRNRIGDISSPEELIADFEVYSFVMRAFDLEDQIF 74

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH-----KTIIQ 124
            +  I+K+LESD  +P SL+N+L   +++    +  F+        D+           +
Sbjct: 75  GKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTR 134

Query: 125 DYKQSHQHKEEVALE---ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLP 181
            Y + + ++ +   E       FR     IN+  ++  + +L ++   + S+  +  +L 
Sbjct: 135 FYNRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLANEKLTNFFQVALSLPEQMSALD 194

Query: 182 FLKD-VLTLGLANPKKYFIESR----DNRFRAMAENFR 214
             K   L     + +K    +       R+ A+++   
Sbjct: 195 LDKQKALLADKFDLEKLADPAERENLIARYVAISDAVN 232



 Score = 83.7 bits (205), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/204 (16%), Positives = 64/204 (31%), Gaps = 9/204 (4%)

Query: 105 DFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLL 164
                  +   D      +   + S  +K          FR  I  I+S ++L  D  + 
Sbjct: 6   GLGSSTALKLIDATRDKQLDLMRDSAANKRAEEA-----FRNRIGDISSPEELIADFEVY 60

Query: 165 DYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR 224
            +V+++F +  +      ++ +L      P        D+RFR M     F  +      
Sbjct: 61  SFVMRAFDLEDQIFGKGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTP 120

Query: 225 D----KILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKML 280
           D      L D+        Y N        V     ++   + ++++ + L + KL    
Sbjct: 121 DLTDPDFLNDVTTRFYNRQYINENDAQNETVGTVLEFRDKFSGINNWFEVLANEKLTNFF 180

Query: 281 QLSLFPLNPEITADKFLTLMQEND 304
           Q++L         D         D
Sbjct: 181 QVALSLPEQMSALDLDKQKALLAD 204



 Score = 71.4 bits (173), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 39/234 (16%), Positives = 88/234 (37%), Gaps = 35/234 (14%)

Query: 349 HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLD 408
                +   + ++  +G I S + L++                   F + A++L  Q   
Sbjct: 29  DSAANKRAEEAFRNRIGDISSPEELIAD-------------FEVYSFVMRAFDLEDQIFG 75

Query: 409 RDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKH 468
           +  +R +L S+P +P S  N+  D R  +++ A  F  +       +           + 
Sbjct: 76  KGLIRKMLESDPVEPSSLLNRLTDSRFREMHLALGFTTEAGPQTPDLTDPDFLNDVTTRF 135

Query: 469 YANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN 528
           Y  +  + +DA+N++  ++ +                 +    + I+++ E+LAN+++ N
Sbjct: 136 YNRQYINENDAQNETVGTVLE-----------------FRDKFSGINNWFEVLANEKLTN 178

Query: 529 FLLESKGIDSQKVREDFLC-EIFKSDLKDPKSFANTYKDN----RYKEIISSFN 577
           F   +  +  Q    D    +   +D  D +  A+  +      RY  I  + N
Sbjct: 179 FFQVALSLPEQMSALDLDKQKALLADKFDLEKLADPAERENLIARYVAISDAVN 232


>gi|121601650|ref|YP_989406.1| hypothetical protein BARBAKC583_1147 [Bartonella bacilliformis
           KC583]
 gi|120613827|gb|ABM44428.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 264

 Score =  190 bits (483), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 58/263 (22%), Positives = 117/263 (44%), Gaps = 30/263 (11%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +   + ++M++   +     ++  E DYY  NI ++ S +E LAN ++  + +++ G++
Sbjct: 6   TSYRSTIDNMKKTLDRLLKEPQVKRETDYYVRNIASVQSVDEFLANDKLYRYAMQAHGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                +  + ++      DP+ +A+   D RY++  ++FNF+++GE +       Q N  
Sbjct: 66  DMIYAKGMMRKVL----LDPR-YASQLSDQRYQQFAAAFNFNLYGEKAT------QQNSA 114

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN---------HYEILGDSKLFK 648
              T + Y  Q +E +  + +    LALYF RT+  +            Y+ILGD  L  
Sbjct: 115 QTATVNKYMQQTLEVQVGQDNEGARLALYFTRTVGGMARDGLLSEKNWAYQILGDKALSA 174

Query: 649 VVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKAL 708
           VV   L +     +     +  +L+  + + D KD K++E F+    A+     D K   
Sbjct: 175 VVFTALDIPENVRLSKIEAQKSLLESRMSLKDLKDPKRLEHFIAQFSAL----YDAKN-- 228

Query: 709 FSSPNQNKDPWNNSFDDPQNNVS 731
                +  +P      +  N ++
Sbjct: 229 ----QEEINPALMILQNSSNGLA 247



 Score =  163 bits (412), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 49/228 (21%), Positives = 93/228 (40%), Gaps = 21/228 (9%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   K    + K+P V  E  YY   I  + ++DEF+ + +L+ YA++
Sbjct: 1   MIGTYTSYRSTIDNMKKTLDRLLKEPQVKRETDYYVRNIASVQSVDEFLANDKLYRYAMQ 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQ 118
           A GL DM +A+  ++K+L     DP+   +QL+  +YQ FA +++F+        Q+  Q
Sbjct: 61  AHGLEDMIYAKGMMRKVLL----DPR-YASQLSDQRYQQFAAAFNFNLYGEKATQQNSAQ 115

Query: 119 HKTIIQDYKQSHQHKEEVALEESK---YFRKNIHKINS---------VDQLFKDRRLLDY 166
             T+ +  +Q+ + +     E ++   YF + +  +             Q+  D+ L   
Sbjct: 116 TATVNKYMQQTLEVQVGQDNEGARLALYFTRTVGGMARDGLLSEKNWAYQILGDKALSAV 175

Query: 167 VLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
           V  +  I                 L +           R       F 
Sbjct: 176 VFTALDIPENVRLSKIEAQ--KSLLESRMSLKDLKDPKRLEHFIAQFS 221



 Score = 77.2 bits (188), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 29/182 (15%), Positives = 61/182 (33%), Gaps = 17/182 (9%)

Query: 121 TIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYI 178
           + I + K++     KE     E+ Y+ +NI  + SVD+   + +L  Y +Q+  +     
Sbjct: 10  STIDNMKKTLDRLLKEPQVKRETDYYVRNIASVQSVDEFLANDKLYRYAMQAHGLEDMIY 69

Query: 179 SLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD-KILTDMQIEKIV 237
           +   ++ VL        +Y  +  D R++  A  F F   G  + +     T    + + 
Sbjct: 70  AKGMMRKVLLD-----PRYASQLSDQRYQQFAAAFNFNLYGEKATQQNSAQTATVNKYMQ 124

Query: 238 SNYFNNTIDCVPIVSDQNYYKLAINSVSS---------FSDFLKDPKLFKMLQLSLFPLN 288
                             Y+   +  ++              L D  L  ++  +L    
Sbjct: 125 QTLEVQVGQDNEGARLALYFTRTVGGMARDGLLSEKNWAYQILGDKALSAVVFTALDIPE 184

Query: 289 PE 290
             
Sbjct: 185 NV 186



 Score = 71.4 bits (173), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 38/251 (15%), Positives = 85/251 (33%), Gaps = 36/251 (14%)

Query: 330 QDSQIQKMLDLYKKNCQ-ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEE 388
             +  +  +D  KK    +L + +++     Y   +  ++S+D  L+             
Sbjct: 4   TYTSYRSTIDNMKKTLDRLLKEPQVKRETDYYVRNIASVQSVDEFLAND----------- 52

Query: 389 PIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
                ++A+ A+ L      +  +R VL     DP  YA++  D R  +   AFNFN  G
Sbjct: 53  --KLYRYAMQAHGLEDMIYAKGMMRKVL----LDPR-YASQLSDQRYQQFAAAFNFNLYG 105

Query: 449 S-IGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYY 507
                    Q+    +   +    +    ++    +      +    R  L       Y 
Sbjct: 106 EKATQQNSAQTATVNKYMQQTLEVQVGQDNEGARLALYFTRTVGGMARDGLLSEKNWAY- 164

Query: 508 TLNINTIHSFEELLANKRILNFLLESKGI-DSQKVREDFLCEIFKSDLKDPKSFANTYKD 566
                      ++L +K +   +  +  I ++ ++ +    +     L+   S  +    
Sbjct: 165 -----------QILGDKALSAVVFTALDIPENVRLSKIEAQKSL---LESRMSLKDLKDP 210

Query: 567 NRYKEIISSFN 577
            R +  I+ F+
Sbjct: 211 KRLEHFIAQFS 221



 Score = 46.0 bits (107), Expect = 0.024,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 58/154 (37%), Gaps = 11/154 (7%)

Query: 253 DQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD--KFLTLMQENDPIVSQV 310
           + +YY   I SV S  +FL + KL++    +    +        + + L       +S  
Sbjct: 31  ETDYYVRNIASVQSVDEFLANDKLYRYAMQAHGLEDMIYAKGMMRKVLLDPRYASQLSDQ 90

Query: 311 KY---FFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNC---QILHDDKMQSLIKDYQLPL 364
           +Y       NF+     +T  QQ+S     ++ Y +     Q+  D++   L   +   +
Sbjct: 91  RYQQFAAAFNFNLYGEKAT--QQNSAQTATVNKYMQQTLEVQVGQDNEGARLALYFTRTV 148

Query: 365 GKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD 398
           G +   D LLS K         +     +  ALD
Sbjct: 149 GGMAR-DGLLSEKNWAYQILGDKALSAVVFTALD 181


>gi|319405395|emb|CBI79014.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 266

 Score =  189 bits (479), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 56/244 (22%), Positives = 105/244 (43%), Gaps = 24/244 (9%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
            +   + ++M+Q   +     ++  E DYY  +I  + S ++ LAN +I N+ +++ G++
Sbjct: 6   TSYRSTIDNMKQTFDRLFKKPQVKHETDYYVKHIIGVKSVDDFLANDKIYNYAMKAYGLE 65

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                +  + ++      DP  +A    D RY++   +FNF  +GE +       Q    
Sbjct: 66  DMIFAKGMIRKVL----SDP-QYAAQLVDKRYQQFAEAFNFSKYGEKTT------QRESA 114

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN---------HYEILGDSKLFK 648
              T + Y  Q +E +  + +    LALYF RT+  +            Y+IL D  L  
Sbjct: 115 KTITVNKYIQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILTEKNWAYQILSDKALSA 174

Query: 649 VVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKAL 708
           V+ K   +S      P   +  +L+  + + D +D KK+E  +    AM     D +   
Sbjct: 175 VIFKAFNISENVLTSPIEAQKSLLESRMSLKDLQDPKKLEHLIAKFSAM----YDVQNQT 230

Query: 709 FSSP 712
             +P
Sbjct: 231 VVNP 234



 Score =  166 bits (419), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 52/228 (22%), Positives = 102/228 (44%), Gaps = 21/228 (9%)

Query: 1   MIPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALK 60
           MI ++ +   + D   + F  + K P V  E  YY + I  + ++D+F+ + ++++YA+K
Sbjct: 1   MISTYTSYRSTIDNMKQTFDRLFKKPQVKHETDYYVKHIIGVKSVDDFLANDKIYNYAMK 60

Query: 61  AFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP-KVIQSDIQH 119
           A+GL DM  A+  I+K+L    SDP+    QL   +YQ FA +++FS    K  Q +   
Sbjct: 61  AYGLEDMIFAKGMIRKVL----SDPQ-YAAQLVDKRYQQFAEAFNFSKYGEKTTQRESAK 115

Query: 120 KTIIQDY-KQSHQHKEEVALEESK---YFRKNIHKI---------NSVDQLFKDRRLLDY 166
              +  Y +Q+ + +     E ++   YF + +  +         N   Q+  D+ L   
Sbjct: 116 TITVNKYIQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILTEKNWAYQILSDKALSAV 175

Query: 167 VLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
           + ++F+I+   ++ P         L +           +   +   F 
Sbjct: 176 IFKAFNISENVLTSPIEAQ--KSLLESRMSLKDLQDPKKLEHLIAKFS 221



 Score = 79.9 bits (195), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 82/240 (34%), Gaps = 39/240 (16%)

Query: 330 QDSQIQKMLDLYKKNCQIL-HDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEE 388
             +  +  +D  K+    L    +++     Y   +  +KS+D+ L+             
Sbjct: 4   TYTSYRSTIDNMKQTFDRLFKKPQVKHETDYYVKHIIGVKSVDDFLAND----------- 52

Query: 389 PIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG 448
                 +A+ AY L      +  +R VL    SDP  YA +  D R  +   AFNF+  G
Sbjct: 53  --KIYNYAMKAYGLEDMIFAKGMIRKVL----SDPQ-YAAQLVDKRYQQFAEAFNFSKYG 105

Query: 449 SIGPIPMMQSRLTIRDNV-KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYY 507
                      +T+   + +        +++    +      +    + N+       Y 
Sbjct: 106 EKTTQRESAKTITVNKYIQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILTEKNWAY- 164

Query: 508 TLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE--DFLCEIFKS-----DLKDPKSF 560
                      ++L++K +   + ++  I    +    +    + +S     DL+DPK  
Sbjct: 165 -----------QILSDKALSAVIFKAFNISENVLTSPIEAQKSLLESRMSLKDLQDPKKL 213



 Score = 78.7 bits (192), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 32/194 (16%), Positives = 73/194 (37%), Gaps = 17/194 (8%)

Query: 113 IQSDIQHKTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           I +   +++ I + KQ+     K+     E+ Y+ K+I  + SVD    + ++ +Y +++
Sbjct: 2   ISTYTSYRSTIDNMKQTFDRLFKKPQVKHETDYYVKHIIGVKSVDDFLANDKIYNYAMKA 61

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGS-LSKRDKILT 229
           + +     +   ++ VL    ++P +Y  +  D R++  AE F F   G   ++R+   T
Sbjct: 62  YGLEDMIFAKGMIRKVL----SDP-QYAAQLVDKRYQQFAEAFNFSKYGEKTTQRESAKT 116

Query: 230 DMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSS---------FSDFLKDPKLFKML 280
               + I                   Y+   +  +               L D  L  ++
Sbjct: 117 ITVNKYIQQTLEVEAGQVNEGTRLALYFTRTVGGMVKDNILTEKNWAYQILSDKALSAVI 176

Query: 281 QLSLFPLNPEITAD 294
             +       +T+ 
Sbjct: 177 FKAFNISENVLTSP 190



 Score = 43.7 bits (101), Expect = 0.11,   Method: Composition-based stats.
 Identities = 24/186 (12%), Positives = 61/186 (32%), Gaps = 19/186 (10%)

Query: 253 DQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD--KFLTLMQENDP---IV 307
           + +YY   I  V S  DFL + K++     +    +        + +    +        
Sbjct: 31  ETDYYVKHIIGVKSVDDFLANDKIYNYAMKAYGLEDMIFAKGMIRKVLSDPQYAAQLVDK 90

Query: 308 SQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKI 367
              ++    NF +        Q++S     ++ Y +    +   ++       +L L   
Sbjct: 91  RYQQFAEAFNFSKYGE--KTTQRESAKTITVNKYIQQTLEVEAGQVNEGT---RLALYFT 145

Query: 368 KSIDNLLSGKCQLEGPNSAEEPII--TLQFALDAYNLNMQDLDR--DQLRNVLTS----- 418
           +++  ++      E   + +             A+N++   L    +  +++L S     
Sbjct: 146 RTVGGMVKDNILTEKNWAYQILSDKALSAVIFKAFNISENVLTSPIEAQKSLLESRMSLK 205

Query: 419 NPSDPD 424
           +  DP 
Sbjct: 206 DLQDPK 211


>gi|56698279|ref|YP_168652.1| flagellar protein, putative [Ruegeria pomeroyi DSS-3]
 gi|56680016|gb|AAV96682.1| flagellar protein, putative [Ruegeria pomeroyi DSS-3]
          Length = 265

 Score =  188 bits (478), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 41/253 (16%), Positives = 95/253 (37%), Gaps = 26/253 (10%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            + +  +     +   N E  Y+   I  + + E+L++++R+L   L + G++       
Sbjct: 20  RTYDAQAQSFSNSTVRNRESSYFMEKIGQVKTAEDLVSDRRLLQVALGAFGLEDDLNNTY 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I +       + AN   D RY+E   +F     GE+    +        ++D    
Sbjct: 80  FVRKILEDGTTSSDALANKLSDKRYREFSKAFGLGP-GEIRTTGLVT-----FMEDIVAK 133

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKL 656
            +    E+    +D  + +ALY +  +  + +         + ++G   L K++   L L
Sbjct: 134 NEAAGFEQAVGAQDETMRIALYAQHELKALADDRSSDNAKWFSLMGIPPLRKMMETALGL 193

Query: 657 SPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQSIDYKKALF 709
                 +   K++ I +  +       +++ F D + VE    A  A          + F
Sbjct: 194 PSGLGSVDIDKQLEIFQDKLQRLTGSPQVSQFTDPEMVEKVTIAYLARSQI-----NSQF 248

Query: 710 SSPNQNKDPWNNS 722
           +  +  ++     
Sbjct: 249 AGSSAAQNALTLL 261



 Score =  125 bits (313), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/180 (19%), Positives = 71/180 (39%), Gaps = 13/180 (7%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
            + S   + + E  Y+ E+I  + T ++ + D+RL   AL AFGL D  +   F++KILE
Sbjct: 27  QSFSNSTVRNRESSYFMEKIGQVKTAEDLVSDRRLLQVALGAFGLEDDLNNTYFVRKILE 86

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQHKTIIQDYKQSHQHKEEVAL 138
              +   +L N+L+  +Y+ F++++   P            + I+   + +   +   A 
Sbjct: 87  DGTTSSDALANKLSDKRYREFSKAFGLGPGEIRTTGLVTFMEDIVAKNEAAGFEQAVGAQ 146

Query: 139 EES----KYFR--------KNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +E+     Y +                   L     L   +  +  +     S+   K +
Sbjct: 147 DETMRIALYAQHELKALADDRSSDNAKWFSLMGIPPLRKMMETALGLPSGLGSVDIDKQL 206



 Score = 89.9 bits (221), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 42/251 (16%), Positives = 81/251 (32%), Gaps = 21/251 (8%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +        V   ES YF + I ++ + + L  DRRLL   L +F +     +  F++ +
Sbjct: 25  QAQSFSNSTVRNRESSYFMEKIGQVKTAEDLVSDRRLLQVALGAFGLEDDLNNTYFVRKI 84

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
           L  G  +      +  D R+R  ++ F   P    +       +  + K  +  F   + 
Sbjct: 85  LEDGTTSSDALANKLSDKRYREFSKAFGLGPGEIRTTGLVTFMEDIVAKNEAAGFEQAVG 144

Query: 247 CVPIVSDQNYY---------KLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
                     Y             +  + +   +  P L KM++ +L   +   + D   
Sbjct: 145 AQDETMRIALYAQHELKALADDRSSDNAKWFSLMGIPPLRKMMETALGLPSGLGSVDIDK 204

Query: 298 TLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQ-IQKMLDLYKKNCQILHDDKMQSL 356
            L    D +                S       D + ++K+   Y    QI       S 
Sbjct: 205 QLEIFQDKLQRLT-----------GSPQVSQFTDPEMVEKVTIAYLARSQINSQFAGSSA 253

Query: 357 IKDYQLPLGKI 367
            ++    LG +
Sbjct: 254 AQNALTLLGNL 264



 Score = 55.2 bits (131), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 25/169 (14%), Positives = 54/169 (31%), Gaps = 15/169 (8%)

Query: 341 YKKNCQILHDDKMQ-SLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
           Y    Q   +  ++      +   +G++K+ ++L+S +               LQ AL A
Sbjct: 22  YDAQAQSFSNSTVRNRESSYFMEKIGQVKTAEDLVSDRR-------------LLQVALGA 68

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           + L     +   +R +L    +  D+ ANK  D R  + + AF            +    
Sbjct: 69  FGLEDDLNNTYFVRKILEDGTTSSDALANKLSDKRYREFSKAFGLGPGEIRTTGLVTFME 128

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYT 508
             +  N      +       E        Q   +   +   +    +++
Sbjct: 129 DIVAKNEAAGFEQ-AVGAQDETMRIALYAQHELKALADDRSSDNAKWFS 176


>gi|89056691|ref|YP_512142.1| flagellar protein, putative [Jannaschia sp. CCS1]
 gi|88866240|gb|ABD57117.1| flagellar protein putative [Jannaschia sp. CCS1]
          Length = 265

 Score =  185 bits (469), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 77/221 (34%), Gaps = 21/221 (9%)

Query: 490 ISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEI 549
             T+   +   + + +Y+  NI  + S E+L+ + R+L   L + G+        F+ ++
Sbjct: 25  QQTRFAEDPVQSRDREYFRENIGAVSSAEDLVGDYRLLRVALGAFGLQDDLPNRAFVEKV 84

Query: 550 FKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
               + D  + +N   D  Y+    +F F              Q     D     +  Q 
Sbjct: 85  LSDGVLDDDALSNKLADKTYRAFAEAFGFGSPLPPLT------QGPGFADKILARFDEQA 138

Query: 610 IEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPYFA 661
            E    E+D ++ LAL   R +P I +           +LG   L +V      L     
Sbjct: 139 FEVAVGEQDTDMRLALEATREVPGIASADTSDTTAWLTVLGKPSLRQVFETAFALPSSIG 198

Query: 662 VLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAK 695
            L   K++   +          +    +D   VED + A  
Sbjct: 199 TLDLDKQLDAFRGGAERVLGSSEFAALQDPTVVEDLVQAFT 239



 Score =  129 bits (324), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 41/212 (19%), Positives = 81/212 (38%), Gaps = 18/212 (8%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
           +  ++DP+ S +  Y+RE I  +S+ ++ + D RL   AL AFGL D      F++K+L 
Sbjct: 27  TRFAEDPVQSRDREYFRENIGAVSSAEDLVGDYRLLRVALGAFGLQDDLPNRAFVEKVLS 86

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKV-IQSDIQHKTIIQDY-KQSHQHKEEVA 137
             + D  +L N+L    Y+ FA ++ F  P     Q       I+  + +Q+ +      
Sbjct: 87  DGVLDDDALSNKLADKTYRAFAEAFGFGSPLPPLTQGPGFADKILARFDEQAFEVAVGEQ 146

Query: 138 LEE---SKYFRKNIHKINSVD--------QLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
             +   +    + +  I S D         +     L      +F++     +L   K +
Sbjct: 147 DTDMRLALEATREVPGIASADTSDTTAWLTVLGKPSLRQVFETAFALPSSIGTLDLDKQL 206

Query: 187 -----LTLGLANPKKYFIESRDNRFRAMAENF 213
                    +    ++           + + F
Sbjct: 207 DAFRGGAERVLGSSEFAALQDPTVVEDLVQAF 238



 Score = 89.1 bits (219), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 34/177 (19%), Positives = 66/177 (37%), Gaps = 9/177 (5%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +Q+   ++ V   + +YFR+NI  ++S + L  D RLL   L +F +     +  F++ V
Sbjct: 25  QQTRFAEDPVQSRDREYFRENIGAVSSAEDLVGDYRLLRVALGAFGLQDDLPNRAFVEKV 84

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
           L+ G+ +      +  D  +RA AE F F        +     D  + +     F   + 
Sbjct: 85  LSDGVLDDDALSNKLADKTYRAFAEAFGFGSPLPPLTQGPGFADKILARFDEQAFEVAVG 144

Query: 247 CVPIVSDQNYY-KLAINSVSSFS--------DFLKDPKLFKMLQLSLFPLNPEITAD 294
                          +  ++S            L  P L ++ + +    +   T D
Sbjct: 145 EQDTDMRLALEATREVPGIASADTSDTTAWLTVLGKPSLRQVFETAFALPSSIGTLD 201



 Score = 62.9 bits (151), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 35/254 (13%), Positives = 72/254 (28%), Gaps = 30/254 (11%)

Query: 342 KKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
            +  +   D       + ++  +G + S ++L+                  L+ AL A+ 
Sbjct: 24  VQQTRFAEDPVQSRDREYFRENIGAVSSAEDLVGDYR-------------LLRVALGAFG 70

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
           L     +R  +  VL+    D D+ +NK  D        AF F +       P+ Q    
Sbjct: 71  LQDDLPNRAFVEKVLSDGVLDDDALSNKLADKTYRAFAEAFGFGS----PLPPLTQGPGF 126

Query: 462 IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL 521
               +  +  +   +   E  +   M       R    I S     T    T+      L
Sbjct: 127 ADKILARFDEQAFEVAVGEQDT--DMRLALEATREVPGIASADTSDTTAWLTV------L 178

Query: 522 ANKRILNFLLESKGIDSQKVREDFLCEIF-----KSDLKDPKSFANTYKDNRYKEIISSF 576
               +      +  + S     D   ++         +     FA        ++++ +F
Sbjct: 179 GKPSLRQVFETAFALPSSIGTLDLDKQLDAFRGGAERVLGSSEFAALQDPTVVEDLVQAF 238

Query: 577 NFDIHGELSHKKIG 590
                       + 
Sbjct: 239 TLQSQAAAGPSALT 252


>gi|126734100|ref|ZP_01749847.1| flagellar protein, putative [Roseobacter sp. CCS2]
 gi|126716966|gb|EBA13830.1| flagellar protein, putative [Roseobacter sp. CCS2]
          Length = 268

 Score =  183 bits (463), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 40/251 (15%), Positives = 88/251 (35%), Gaps = 21/251 (8%)

Query: 488 EQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC 547
           E   T    +  I    DY+  NI  + +  +L+ ++++L+  L + G+D       F+ 
Sbjct: 23  EAQQTAFSNSAPIQRATDYFRENIGDVRTASDLVNDRQLLSIALGAFGLDDDINNRAFIQ 82

Query: 548 EIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKH 607
           +I +       + AN   DNRY +  ++F F          I +        +  D ++ 
Sbjct: 83  KILEDGTVAQDALANRLADNRYADFSAAFGFGD------SPIPRTVLGRFPTEIIDRFEA 136

Query: 608 QMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKLSPY 659
           Q   +   E++ ++ LA      + +I           + I+G++ L +V    L L   
Sbjct: 137 QQFARAIGEQNNDMRLASNVNSGVADIVAGNATNTGRWFSIMGNAPLREVFQTALGLPNS 196

Query: 660 FAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
            A +   K+  + ++          +      K+ E  +         +     +  ++ 
Sbjct: 197 LAGIDIDKQREVFQERALSVFGTDDVAQIATPKQEEKLIRLFLIRSEANDLAASSAGTTA 256

Query: 713 NQNKDPWNNSF 723
                     F
Sbjct: 257 LTLLQSAPRLF 267



 Score =  125 bits (314), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/197 (17%), Positives = 65/197 (32%), Gaps = 13/197 (6%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           +  ++     +       +  S    +     Y+RE I  + T  + + D++L S AL A
Sbjct: 9   LQGYIGWRFLERTAEAQQTAFSNSAPIQRATDYFRENIGDVRTASDLVNDRQLLSIALGA 68

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDI-QHK 120
           FGL D  +   FI+KILE       +L N+L   +Y  F+ ++ F   P           
Sbjct: 69  FGLDDDINNRAFIQKILEDGTVAQDALANRLADNRYADFSAAFGFGDSPIPRTVLGRFPT 128

Query: 121 TIIQDYK-QSHQHKEEVALEE-----------SKYFRKNIHKINSVDQLFKDRRLLDYVL 168
            II  ++ Q           +           +     N         +  +  L +   
Sbjct: 129 EIIDRFEAQQFARAIGEQNNDMRLASNVNSGVADIVAGNATNTGRWFSIMGNAPLREVFQ 188

Query: 169 QSFSITPKYISLPFLKD 185
            +  +      +   K 
Sbjct: 189 TALGLPNSLAGIDIDKQ 205



 Score = 86.4 bits (212), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 34/244 (13%), Positives = 69/244 (28%), Gaps = 19/244 (7%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +Q+           + YFR+NI  + +   L  DR+LL   L +F +     +  F++ +
Sbjct: 25  QQTAFSNSAPIQRATDYFRENIGDVRTASDLVNDRQLLSIALGAFGLDDDINNRAFIQKI 84

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKR---------DKILTDMQIEKIV 237
           L  G            DNR+   +  F F                  D+         I 
Sbjct: 85  LEDGTVAQDALANRLADNRYADFSAAFGFGDSPIPRTVLGRFPTEIIDRFEAQQFARAIG 144

Query: 238 SNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
               +  +         +       +   +   + +  L ++ Q +L   N     D   
Sbjct: 145 EQNNDMRLASNVNSGVADIVAGNATNTGRWFSIMGNAPLREVFQTALGLPNSLAGIDI-- 202

Query: 298 TLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLI 357
                 D      +      F  D+ +        Q +K++ L+    +        +  
Sbjct: 203 ------DKQREVFQERALSVFGTDDVAQIA--TPKQEEKLIRLFLIRSEANDLAASSAGT 254

Query: 358 KDYQ 361
               
Sbjct: 255 TALT 258



 Score = 56.0 bits (133), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/201 (12%), Positives = 64/201 (31%), Gaps = 25/201 (12%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
            +   +Q     ++  +G +++  +L++                 L  AL A+ L+    
Sbjct: 30  SNSAPIQRATDYFRENIGDVRTASDLVND-------------RQLLSIALGAFGLDDDIN 76

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
           +R  ++ +L       D+ AN+  D+R    + AF F  D  I    + +    I D  +
Sbjct: 77  NRAFIQKILEDGTVAQDALANRLADNRYADFSAAFGFG-DSPIPRTVLGRFPTEIIDRFE 135

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
                +       +    S         +     +   +++           ++ N  + 
Sbjct: 136 AQQFARAIGEQNNDMRLASNVNSGVADIVAGNATNTGRWFS-----------IMGNAPLR 184

Query: 528 NFLLESKGIDSQKVREDFLCE 548
                + G+ +     D   +
Sbjct: 185 EVFQTALGLPNSLAGIDIDKQ 205


>gi|254509607|ref|ZP_05121674.1| flagellar protein, putative [Rhodobacteraceae bacterium KLH11]
 gi|221533318|gb|EEE36306.1| flagellar protein, putative [Rhodobacteraceae bacterium KLH11]
          Length = 265

 Score =  182 bits (462), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 39/227 (17%), Positives = 88/227 (38%), Gaps = 21/227 (9%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            + +        +     E DY+  NI  + S E+L++++R+L   L + G+++      
Sbjct: 20  RTYDAQLQSYSASNVNQRETDYFLENIGKVQSAEDLVSDRRLLQVALGAFGLEADLDNRF 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +I     +   + AN   D RY++  ++F     G++    +        ++     
Sbjct: 80  FIQKILSDGTQAEDALANRLADGRYRDFANAFGLGP-GDVRKTGLT-----NEMEKIASD 133

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKL 656
                 E    E D ++ +AL+ +  +  I           ++++G   L  ++   L L
Sbjct: 134 NLVARFEISVGEADESMRIALFTQHALQEIAAQDGSENRKWFDLMGLPPLRSMMETALGL 193

Query: 657 SPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKA 696
              FA L   K++ + +  +        ++ F DS+ +        A
Sbjct: 194 PSAFAQLDIDKQLEVFRDRLQRVTGSSDLSQFTDSEAIGKLTDTYLA 240



 Score =  120 bits (300), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 75/225 (33%), Gaps = 15/225 (6%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
             + S   +   E  Y+ E I  + + ++ + D+RL   AL AFGL        FI+KIL
Sbjct: 26  LQSYSASNVNQRETDYFLENIGKVQSAEDLVSDRRLLQVALGAFGLEADLDNRFFIQKIL 85

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP--KVIQSDIQHKTIIQDYKQSHQHKEEV 136
                   +L N+L   +Y+ FA ++   P    K   ++   K    +     +     
Sbjct: 86  SDGTQAEDALANRLADGRYRDFANAFGLGPGDVRKTGLTNEMEKIASDNLVARFEISVGE 145

Query: 137 ALEE------SKYFRKNIHKINS-----VDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
           A E       +++  + I   +         L     L   +  +  +   +  L   K 
Sbjct: 146 ADESMRIALFTQHALQEIAAQDGSENRKWFDLMGLPPLRSMMETALGLPSAFAQLDIDKQ 205

Query: 186 VLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
           +      +  +    S D      +E      D  L++       
Sbjct: 206 L--EVFRDRLQRVTGSSDLSQFTDSEAIGKLTDTYLARSQIAQLQ 248



 Score = 89.5 bits (220), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 35/211 (16%), Positives = 61/211 (28%), Gaps = 9/211 (4%)

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT 188
                  V   E+ YF +NI K+ S + L  DRRLL   L +F +     +  F++ +L+
Sbjct: 27  QSYSASNVNQRETDYFLENIGKVQSAEDLVSDRRLLQVALGAFGLEADLDNRFFIQKILS 86

Query: 189 LGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCV 248
            G            D R+R  A  F   P            +      +   F  ++   
Sbjct: 87  DGTQAEDALANRLADGRYRDFANAFGLGPGDVRKTGLTNEMEKIASDNLVARFEISVGEA 146

Query: 249 PIVSDQNYYKLAI---------NSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL 299
                   +             +    + D +  P L  M++ +L   +     D    L
Sbjct: 147 DESMRIALFTQHALQEIAAQDGSENRKWFDLMGLPPLRSMMETALGLPSAFAQLDIDKQL 206

Query: 300 MQENDPIVSQVKYFFQINFHRDNSSSTKIQQ 330
               D +           F    +       
Sbjct: 207 EVFRDRLQRVTGSSDLSQFTDSEAIGKLTDT 237



 Score = 51.4 bits (121), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 30/212 (14%), Positives = 69/212 (32%), Gaps = 27/212 (12%)

Query: 341 YKKNCQILHDDKM-QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
           Y    Q      + Q     +   +GK++S ++L+S +               LQ AL A
Sbjct: 22  YDAQLQSYSASNVNQRETDYFLENIGKVQSAEDLVSDRR-------------LLQVALGA 68

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           + L     +R  ++ +L+      D+ AN+  D R     +AF     G +    +    
Sbjct: 69  FGLEADLDNRFFIQKILSDGTQAEDALANRLADGRYRDFANAFGLGP-GDVRKTGLTNEM 127

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
             I  +              E+       Q + Q+    + +    ++           +
Sbjct: 128 EKIASDNLVARFEISVGEADESMRIALFTQHALQEIAAQDGSENRKWF-----------D 176

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
           L+    + + +  + G+      +  + +  +
Sbjct: 177 LMGLPPLRSMMETALGL-PSAFAQLDIDKQLE 207


>gi|163733161|ref|ZP_02140605.1| flagellar protein, putative [Roseobacter litoralis Och 149]
 gi|161393696|gb|EDQ18021.1| flagellar protein, putative [Roseobacter litoralis Och 149]
          Length = 262

 Score =  181 bits (459), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 46/262 (17%), Positives = 101/262 (38%), Gaps = 23/262 (8%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            +          + +        + ++    +Y+   I+++ + EEL+A++R+    L +
Sbjct: 8   STGLTGWRFLQRTYDSQFAAFNQSSQLARAAEYFEEKISSVTTAEELVADRRLREVALGA 67

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G+        F+ ++ +    +  S AN + D+RYK+  ++F      +L  +  G  Q
Sbjct: 68  FGLQDDIDNRFFIKKVLEEGTTNEDSLANRFSDSRYKDFSAAFGLGPGEQLKLQDTGFAQ 127

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSK 645
                 D    Y+    E     +D ++ +AL+ +R IP +           + I+G   
Sbjct: 128 ------DIIAKYRANSFEIATGSQDDSMRVALFAQREIPALATDDTSNDAKWFGIMGQPP 181

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMD 698
           L  V  K L L   F  +   +++ + K+         +++ F   + V+D +     + 
Sbjct: 182 LRAVFEKALNLPSSFGQIDIDQQLVVFKERSRAVFGTDEVSQFAGDEAVQDLVTKY--IV 239

Query: 699 HQSIDYKKALFSSPNQNKDPWN 720
              +D   A  SS +       
Sbjct: 240 RSQLDSFNANTSSASIALTLLQ 261



 Score =  121 bits (302), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 34/184 (18%), Positives = 79/184 (42%), Gaps = 13/184 (7%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
              F+  ++   ++    Y+ E+I  ++T +E + D+RL   AL AFGL D      FIK
Sbjct: 22  DSQFAAFNQSSQLARAAEYFEEKISSVTTAEELVADRRLREVALGAFGLQDDIDNRFFIK 81

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPK-VIQSDIQHKTIIQDYKQSHQHKE 134
           K+LE   ++  SL N+ +  +Y+ F+ ++   P  +  +Q     + II  Y+ +     
Sbjct: 82  KVLEEGTTNEDSLANRFSDSRYKDFSAAFGLGPGEQLKLQDTGFAQDIIAKYRANSFEIA 141

Query: 135 EVALEE----SKYFRKNIHKINS--------VDQLFKDRRLLDYVLQSFSITPKYISLPF 182
             + ++    + + ++ I  + +           +     L     ++ ++   +  +  
Sbjct: 142 TGSQDDSMRVALFAQREIPALATDDTSNDAKWFGIMGQPPLRAVFEKALNLPSSFGQIDI 201

Query: 183 LKDV 186
            + +
Sbjct: 202 DQQL 205



 Score = 88.4 bits (217), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 37/229 (16%), Positives = 72/229 (31%), Gaps = 10/229 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
           ++       ++YF + I  + + ++L  DRRL +  L +F +     +  F+K VL  G 
Sbjct: 29  NQSSQLARAAEYFEEKISSVTTAEELVADRRLREVALGAFGLQDDIDNRFFIKKVLEEGT 88

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV 251
            N         D+R++  +  F   P   L  +D       I K  +N F          
Sbjct: 89  TNEDSLANRFSDSRYKDFSAAFGLGPGEQLKLQDTGFAQDIIAKYRANSFEIATGSQDDS 148

Query: 252 SDQNYYKLAINSVSSFSD---------FLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
                +        +  D          +  P L  + + +L   +     D    L+  
Sbjct: 149 MRVALFAQREIPALATDDTSNDAKWFGIMGQPPLRAVFEKALNLPSSFGQIDIDQQLVVF 208

Query: 303 NDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDD 351
            +   +         F  D +    +     ++  LD +  N       
Sbjct: 209 KERSRAVFGTDEVSQFAGDEAVQDLV-TKYIVRSQLDSFNANTSSASIA 256



 Score = 56.4 bits (134), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/160 (11%), Positives = 52/160 (32%), Gaps = 14/160 (8%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
               ++    + ++  +  + + + L++ +                + AL A+ L     
Sbjct: 29  NQSSQLARAAEYFEEKISSVTTAEELVADRR-------------LREVALGAFGLQDDID 75

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
           +R  ++ VL    ++ DS AN+  D R    + AF       +       ++  I     
Sbjct: 76  NRFFIKKVLEEGTTNEDSLANRFSDSRYKDFSAAFGLGPGEQLKLQDTGFAQDIIAKYRA 135

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYY 507
           +      +    ++       Q         + +++  ++
Sbjct: 136 NSFE-IATGSQDDSMRVALFAQREIPALATDDTSNDAKWF 174



 Score = 38.3 bits (87), Expect = 4.7,   Method: Composition-based stats.
 Identities = 29/211 (13%), Positives = 71/211 (33%), Gaps = 18/211 (8%)

Query: 232 QIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEI 291
            +++   + F        +     Y++  I+SV++  + + D +L ++   +    +   
Sbjct: 16  FLQRTYDSQFAAFNQSSQLARAAEYFEEKISSVTTAEELVADRRLREVALGAFGLQDDID 75

Query: 292 TADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDD 351
                  +++E       +   F  + ++D S++  +    Q++     +          
Sbjct: 76  NRFFIKKVLEEGTTNEDSLANRFSDSRYKDFSAAFGLGPGEQLKLQDTGF---------- 125

Query: 352 KMQSLIKDYQLPLGKIK--SIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDR 409
             Q +I  Y+    +I   S D+ +      +    A     T   A   + +  Q    
Sbjct: 126 -AQDIIAKYRANSFEIATGSQDDSMRVALFAQREIPALATDDTSNDA-KWFGIMGQPP-- 181

Query: 410 DQLRNVLTSNPSDPDSYANKSKDDRLIKLNH 440
             LR V     + P S+     D +L+    
Sbjct: 182 --LRAVFEKALNLPSSFGQIDIDQQLVVFKE 210


>gi|296531762|ref|ZP_06894584.1| possible flagellar protein [Roseomonas cervicalis ATCC 49957]
 gi|296267901|gb|EFH13706.1| possible flagellar protein [Roseomonas cervicalis ATCC 49957]
          Length = 389

 Score =  180 bits (457), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 59/303 (19%), Positives = 109/303 (35%), Gaps = 26/303 (8%)

Query: 396 ALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPM 455
            L AY L+ Q      +R VL SNP D +S A +  D R  +++   N+          +
Sbjct: 67  VLKAYGLDGQIGYDALIRKVLESNPDDSNSVAGRMTDYRYRQISRDLNYGGIAVPEIPAV 126

Query: 456 MQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIH 515
             +     + V    +   +         ++++     +R ++    +  +         
Sbjct: 127 PSTTTLQIEGVMAGQSFTAAGASFAGLRIDNVDLQGLTRRQDIAAALQAAFRK------- 179

Query: 516 SFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISS 575
                 A+    +  + + G+  + V  D      +   K   SF           ++S 
Sbjct: 180 ------ADGGAEDISVTALGL--RLVVTDA-----RGRGKGSFSFVADPASTARAFLVS- 225

Query: 576 FNFDIHGELSHKKIGKVQ--DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPN 633
              +  G       G  +  D   ID   + Y     E+   +    +  A+Y KR +P 
Sbjct: 226 ---ETQGSKVVPGSGGPKVGDKETIDFIANRYTQIRFEESLGQSSETLRRAVYAKRMLPQ 282

Query: 634 IRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYA 693
           + N + ++ D  L +VV   L L   FA L   ++  +L+K + I DFKD  K+   L  
Sbjct: 283 MNNWFSVIADRNLAEVVQNVLGLPDSFASLDVDRQKAVLEKRMSIADFKDPAKLSKLLDR 342

Query: 694 AKA 696
             A
Sbjct: 343 YVA 345



 Score = 99.5 bits (246), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 43/288 (14%), Positives = 94/288 (32%), Gaps = 14/288 (4%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
           F   +KDP++  +  Y RE +    T  + + D+RL +  LKA+GL      +  I+K+L
Sbjct: 28  FKAFAKDPVLQRDLAYLRETLPTKLTAKDLLADRRLQTIVLKAYGLDGQIGYDALIRKVL 87

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSP---PPKVIQSDIQHKTIIQDYKQSHQHKEE 135
           ES+  D  S+  ++   +Y+  +R  ++     P            I             
Sbjct: 88  ESNPDDSNSVAGRMTDYRYRQISRDLNYGGIAVPEIPAVPSTTTLQIEGVMAGQSFTAAG 147

Query: 136 VALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPK 195
            +    +    ++  +     +     L     ++               ++        
Sbjct: 148 ASFAGLRIDNVDLQGLTRRQDIAA--ALQAAFRKADGGAEDISVTALGLRLVVTDARGRG 205

Query: 196 K-----YFIESRDNRFRAMAENFRFQP---DGSLSKRDKILTDMQIEKIVSNYFNNTIDC 247
           K         +   R   ++E    +     G     DK   D    +     F  ++  
Sbjct: 206 KGSFSFVADPASTARAFLVSETQGSKVVPGSGGPKVGDKETIDFIANRYTQIRFEESLGQ 265

Query: 248 VPIVSDQN-YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
                 +  Y K  +  ++++   + D  L +++Q  L   +   + D
Sbjct: 266 SSETLRRAVYAKRMLPQMNNWFSVIADRNLAEVVQNVLGLPDSFASLD 313



 Score = 77.6 bits (189), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 49/132 (37%), Gaps = 5/132 (3%)

Query: 492 TQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
                +  +  ++ Y    + T  + ++LLA++R+   +L++ G+D Q   +  + ++ +
Sbjct: 29  KAFAKDPVLQRDLAYLRETLPTKLTAKDLLADRRLQTIVLKAYGLDGQIGYDALIRKVLE 88

Query: 552 SDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIE 611
           S+  D  S A    D RY++I    N+     +             I+        Q   
Sbjct: 89  SNPDDSNSVAGRMTDYRYRQISRDLNYGGI-AVPEIPAVPSTTTLQIEGVMAG---QSF- 143

Query: 612 KKEEEKDPNIAL 623
                    + +
Sbjct: 144 TAAGASFAGLRI 155


>gi|159045898|ref|YP_001534692.1| hypothetical protein Dshi_3358 [Dinoroseobacter shibae DFL 12]
 gi|157913658|gb|ABV95091.1| protein of unknown function DUF1217 [Dinoroseobacter shibae DFL 12]
          Length = 263

 Score =  180 bits (456), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 91/237 (38%), Gaps = 21/237 (8%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
                       ++E        + +   E DY+  NI  I + E+L+A++R+L F L +
Sbjct: 9   TGGLAGWTFLNRTLEAQKEAFGQSTQYRREEDYFRANIGNIETAEQLVADRRLLAFSLSA 68

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G+D+    + F+ +I      D  + +N   D  Y+E   +F                Q
Sbjct: 69  FGLDADLPNKFFIQKILSDGTSDNAALSNRLSDKTYREFSDAFGLGQGQVRKT------Q 122

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSK 645
                D+    Y+ Q  E+     + ++ LAL  KR I ++ +         + +LG   
Sbjct: 123 QTSFADEIIQKYETQKFEESVGNVNDDLRLALNLKREISDLASSDMSERAKLFTVLGSPP 182

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHIK-------INDFKDSKKVEDFLYAAK 695
           L        +L   FA L   +++ +L++ ++       I+ FKD    E  +    
Sbjct: 183 LRTTFETAFRLPSAFAGLDIDRQVTVLEEKLESAFGDASISQFKDPDLSERLIQKFL 239



 Score =  111 bits (278), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/191 (20%), Positives = 79/191 (41%), Gaps = 14/191 (7%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
           F ++ ++++      +      EE Y+R  I +I T ++ + D+RL +++L AFGL    
Sbjct: 17  FLNRTLEAQ-KEAFGQSTQYRREEDYFRANIGNIETAEQLVADRRLLAFSLSAFGLDADL 75

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPP-KVIQSDIQHKTIIQDYK 127
             + FI+KIL    SD  +L N+L+   Y+ F+ ++       +  Q       IIQ Y+
Sbjct: 76  PNKFFIQKILSDGTSDNAALSNRLSDKTYREFSDAFGLGQGQVRKTQQTSFADEIIQKYE 135

Query: 128 QSHQHKEEVALEE----SKYFRKNIHKINSVD--------QLFKDRRLLDYVLQSFSITP 175
                +    + +    +   ++ I  + S D         +     L      +F +  
Sbjct: 136 TQKFEESVGNVNDDLRLALNLKREISDLASSDMSERAKLFTVLGSPPLRTTFETAFRLPS 195

Query: 176 KYISLPFLKDV 186
            +  L   + V
Sbjct: 196 AFAGLDIDRQV 206



 Score = 75.6 bits (184), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 41/223 (18%), Positives = 75/223 (33%), Gaps = 10/223 (4%)

Query: 140 ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFI 199
           E  YFR NI  I + +QL  DRRLL + L +F +     +  F++ +L+ G ++      
Sbjct: 38  EEDYFRANIGNIETAEQLVADRRLLAFSLSAFGLDADLPNKFFIQKILSDGTSDNAALSN 97

Query: 200 ESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNY-YK 258
              D  +R  ++ F          +     D  I+K  +  F  ++  V          K
Sbjct: 98  RLSDKTYREFSDAFGLGQGQVRKTQQTSFADEIIQKYETQKFEESVGNVNDDLRLALNLK 157

Query: 259 LAINSVSSFS--------DFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQV 310
             I+ ++S            L  P L    + +    +     D    +    + + S  
Sbjct: 158 REISDLASSDMSERAKLFTVLGSPPLRTTFETAFRLPSAFAGLDIDRQVTVLEEKLESAF 217

Query: 311 KYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKM 353
                  F  D   S ++ Q   +Q  L  ++           
Sbjct: 218 GDASISQFK-DPDLSERLIQKFLLQSELSSFEATSSPAATALF 259



 Score = 48.3 bits (113), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/218 (12%), Positives = 72/218 (33%), Gaps = 29/218 (13%)

Query: 358 KDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
             ++  +G I++ + L++ +               L F+L A+ L+    ++  ++ +L+
Sbjct: 40  DYFRANIGNIETAEQLVADRR-------------LLAFSLSAFGLDADLPNKFFIQKILS 86

Query: 418 SNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIH 477
              SD  + +N+  D    + + AF               +   I+          +   
Sbjct: 87  DGTSDNAALSNRLSDKTYREFSDAFGLGQGQVRKTQQTSFADEIIQKYET------QKFE 140

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
           ++     + +      KR   ++ S        + T+      L +  +      +  + 
Sbjct: 141 ESVGNVNDDLRLALNLKREISDLASSDMSERAKLFTV------LGSPPLRTTFETAFRLP 194

Query: 538 SQKVREDFLCE--IFKSDLKDP--KSFANTYKDNRYKE 571
           S     D   +  + +  L+     +  + +KD    E
Sbjct: 195 SAFAGLDIDRQVTVLEEKLESAFGDASISQFKDPDLSE 232


>gi|260574408|ref|ZP_05842412.1| protein of unknown function DUF1217 [Rhodobacter sp. SW2]
 gi|259023304|gb|EEW26596.1| protein of unknown function DUF1217 [Rhodobacter sp. SW2]
          Length = 267

 Score =  179 bits (454), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 42/264 (15%), Positives = 91/264 (34%), Gaps = 27/264 (10%)

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
           +    +M               E +Y+  NI  I + E L++++++L   L + G+D+  
Sbjct: 16  SLLKRTMTTQKAAFAAVSTSKREEEYFRANIGKIKTAEALVSDRKLLKVALGAFGLDADI 75

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
             + F+ ++ +       + AN   D +Y+   + F F              Q +   D+
Sbjct: 76  NSKAFIQKVLEGGTLKTGALANKLADKQYQAFSAGFGFGDFATPRT------QLSTFADE 129

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSK 652
               YK++  E    E++ ++ LA+  +R +  +           + ++G   L  V  K
Sbjct: 130 ILTAYKNRQFETAVGEQNDDMRLAMNVERELVTLAGKSTTEDAKWFTVMGSKPLRAVFEK 189

Query: 653 KLKLSPYFAVLPERKKIRILKKHIK-------INDFKDSKKVEDFLYAAKAMDHQSIDYK 705
              L    A L   +++ + K           ++ F D+ K++  +              
Sbjct: 190 AFGLPSSLAALDLDQQLSVFKSAANKAFGATSVSQFADTTKLDKLVKQFLIRSEV----- 244

Query: 706 KALFSSPNQNKDPWNNSFDDPQNN 729
            A   +               Q N
Sbjct: 245 -AAGMTSTSGASNALQLLQAMQGN 267



 Score =  111 bits (278), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/196 (19%), Positives = 72/196 (36%), Gaps = 13/196 (6%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
            +  +       EE Y+R  I  I T +  + D++L   AL AFGL    +++ FI+K+L
Sbjct: 26  KAAFAAVSTSKREEEYFRANIGKIKTAEALVSDRKLLKVALGAFGLDADINSKAFIQKVL 85

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSP-PPKVIQSDIQHKTIIQDYK-QSHQHKEEV 136
           E       +L N+L   +YQ F+  + F        Q       I+  YK +  +     
Sbjct: 86  EGGTLKTGALANKLADKQYQAFSAGFGFGDFATPRTQLSTFADEILTAYKNRQFETAVGE 145

Query: 137 ALEESKYFRKN-------IHKINSVD----QLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
             ++ +              K  + D     +   + L     ++F +     +L   + 
Sbjct: 146 QNDDMRLAMNVERELVTLAGKSTTEDAKWFTVMGSKPLRAVFEKAFGLPSSLAALDLDQQ 205

Query: 186 VLTLGLANPKKYFIES 201
           +     A  K +   S
Sbjct: 206 LSVFKSAANKAFGATS 221



 Score = 73.3 bits (178), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/228 (15%), Positives = 70/228 (30%), Gaps = 10/228 (4%)

Query: 133 KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA 192
               +  E +YFR NI KI + + L  DR+LL   L +F +     S  F++ VL  G  
Sbjct: 31  AVSTSKREEEYFRANIGKIKTAEALVSDRKLLKVALGAFGLDADINSKAFIQKVLEGGTL 90

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD----MQIEKIVSNYFNNTIDCV 248
                  +  D +++A +  F F    +   +     D        +          D +
Sbjct: 91  KTGALANKLADKQYQAFSAGFGFGDFATPRTQLSTFADEILTAYKNRQFETAVGEQNDDM 150

Query: 249 PIVSDQNYYKLAINSVSSFSD-----FLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEN 303
            +  +     + +   S+  D      +    L  + + +    +     D    L    
Sbjct: 151 RLAMNVERELVTLAGKSTTEDAKWFTVMGSKPLRAVFEKAFGLPSSLAALDLDQQLSVFK 210

Query: 304 DPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDD 351
                         F  D +   K+ +   I+  +     +     + 
Sbjct: 211 SAANKAFGATSVSQF-ADTTKLDKLVKQFLIRSEVAAGMTSTSGASNA 257



 Score = 55.2 bits (131), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 30/213 (14%), Positives = 64/213 (30%), Gaps = 30/213 (14%)

Query: 351 DKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
              +   + ++  +GKIK+ + L+S                 L+ AL A+ L+     + 
Sbjct: 33  STSKREEEYFRANIGKIKTAEALVSD-------------RKLLKVALGAFGLDADINSKA 79

Query: 411 QLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYA 470
            ++ VL        + ANK  D +    +  F F    +        +   +    K+  
Sbjct: 80  FIQKVLEGGTLKTGALANKLADKQYQAFSAGFGFGDFATPRTQLSTFADEILTAY-KNRQ 138

Query: 471 NRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFL 530
                    ++       +             +  ++T           ++ +K +    
Sbjct: 139 FETAVGEQNDDMRLAMNVERELVTLAGKSTTEDAKWFT-----------VMGSKPLRAVF 187

Query: 531 LESKGIDSQKVREDFLCEIFKSDLKDPKSFANT 563
            ++ G+ S     D         L   KS AN 
Sbjct: 188 EKAFGLPSSLAALD-----LDQQLSVFKSAANK 215


>gi|86139476|ref|ZP_01058045.1| flagellar protein, putative [Roseobacter sp. MED193]
 gi|85823979|gb|EAQ44185.1| flagellar protein, putative [Roseobacter sp. MED193]
          Length = 268

 Score =  178 bits (452), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 38/223 (17%), Positives = 89/223 (39%), Gaps = 26/223 (11%)

Query: 494 KRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSD 553
              +  +  + +Y+  NI  + + E+L+++ R+L   L + G+ S+   +  + ++ +  
Sbjct: 29  FNKDPILERDNEYFMENIGNVKTAEDLVSDYRLLEVALNAFGLASEIDSKAMIQKVLEDG 88

Query: 554 LKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKK 613
            +   + AN   D+R+ +   +F F            K+Q      +  D    Q  E  
Sbjct: 89  SEADDALANKLGDDRWIDFTDAFKFGPGLAPVTGLTYKMQ------EIADKNVVQSFEDA 142

Query: 614 EEEKDPNIALALYFKRTIPNIRN-------------HYEILGDSKLFKVVSKKLKLSPYF 660
              +D ++ +ALY +R + ++                  I+G  +L  ++   L L    
Sbjct: 143 VGAQDVSMQIALYAERELVDLVTFDDEGEELSITGQWLNIIGQPQLQSMMQTTLGLPSDL 202

Query: 661 AVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKA 696
           A+L   +++ IL+           +  F D ++++  +    A
Sbjct: 203 ALLDIDQQVDILQDAAKKRFGSDDLKMFSDPEEMKTLINTYLA 245



 Score =  125 bits (314), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 35/189 (18%), Positives = 71/189 (37%), Gaps = 18/189 (9%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
            + F   +KDPI+  +  Y+ E I ++ T ++ + D RL   AL AFGL+    ++  I+
Sbjct: 23  DRQFEHFNKDPILERDNEYFMENIGNVKTAEDLVSDYRLLEVALNAFGLASEIDSKAMIQ 82

Query: 76  KILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-DIQHKTIIQDYKQSHQHKE 134
           K+LE       +L N+L   ++  F  ++ F P    +     + + I            
Sbjct: 83  KVLEDGSEADDALANKLGDDRWIDFTDAFKFGPGLAPVTGLTYKMQEIADKNVVQSFEDA 142

Query: 135 EVALE----ESKYFRKNIHKINSVDQ-------------LFKDRRLLDYVLQSFSITPKY 177
             A +     + Y  + +  + + D              +    +L   +  +  +    
Sbjct: 143 VGAQDVSMQIALYAERELVDLVTFDDEGEELSITGQWLNIIGQPQLQSMMQTTLGLPSDL 202

Query: 178 ISLPFLKDV 186
             L   + V
Sbjct: 203 ALLDIDQQV 211



 Score = 87.6 bits (215), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 38/232 (16%), Positives = 76/232 (32%), Gaps = 17/232 (7%)

Query: 105 DFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVA--LEESKYFRKNIHKINSVDQLFKDRR 162
            F P             +   Y +  +H  +      +++YF +NI  + + + L  D R
Sbjct: 2   SFEPTIPSTGLTGWA-FLQSTYDRQFEHFNKDPILERDNEYFMENIGNVKTAEDLVSDYR 60

Query: 163 LLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLS 222
           LL+  L +F +  +  S   ++ VL  G         +  D+R+    + F+F P  +  
Sbjct: 61  LLEVALNAFGLASEIDSKAMIQKVLEDGSEADDALANKLGDDRWIDFTDAFKFGPGLAPV 120

Query: 223 KRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQN-YYKLAINSVSSFSD------------ 269
                      +K V   F + +    +      Y +  +  + +F D            
Sbjct: 121 TGLTYKMQEIADKNVVQSFEDAVGAQDVSMQIALYAERELVDLVTFDDEGEELSITGQWL 180

Query: 270 -FLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHR 320
             +  P+L  M+Q +L   +     D    +    D    +        F  
Sbjct: 181 NIIGQPQLQSMMQTTLGLPSDLALLDIDQQVDILQDAAKKRFGSDDLKMFSD 232



 Score = 52.5 bits (124), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 13/93 (13%)

Query: 354 QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLR 413
           +   + +   +G +K+ ++L+S                 L+ AL+A+ L  +   +  ++
Sbjct: 36  ERDNEYFMENIGNVKTAEDLVSDYR-------------LLEVALNAFGLASEIDSKAMIQ 82

Query: 414 NVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNA 446
            VL       D+ ANK  DDR I    AF F  
Sbjct: 83  KVLEDGSEADDALANKLGDDRWIDFTDAFKFGP 115


>gi|260432290|ref|ZP_05786261.1| putative flagellar protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416118|gb|EEX09377.1| putative flagellar protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 265

 Score =  177 bits (448), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 40/238 (16%), Positives = 85/238 (35%), Gaps = 21/238 (8%)

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLES 533
            S          + +        + E   E  Y+  NI  + S E+L++++R+L   L++
Sbjct: 9   TSGLVGWRFLQRTYDAQLQTFSASAENERETQYFLENIRNVRSAEDLVSDRRLLRVALDA 68

Query: 534 KGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQ 593
            G+++      F+ ++     K   + AN   D+RY+E   +F            I    
Sbjct: 69  FGLEADLDNRYFIQKVLSDGTKAEDALANRLADSRYREFSEAFGLGPGEVRKTALIT--- 125

Query: 594 DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFK--------RTIPNIRNHYEILGDSK 645
               ++           E    E D  + +ALY +        +T    +  Y+++    
Sbjct: 126 ---DMEKIAQKGIVARFESAVGESDETMRIALYAQHSLRELAEQTGSETKKWYDLMSLPP 182

Query: 646 LFKVVSKKLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKA 696
           L  ++   L L   F  L   K++ I +  +        ++ F  ++ ++       A
Sbjct: 183 LRSMMETALGLPSSFGQLDIDKQLEIFRDKLAGLTGSEDLSQFVSTQAIQSLTDTYLA 240



 Score =  122 bits (306), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 32/181 (17%), Positives = 68/181 (37%), Gaps = 13/181 (7%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKIL 78
             T S       E +Y+ E I+++ + ++ + D+RL   AL AFGL        FI+K+L
Sbjct: 26  LQTFSASAENERETQYFLENIRNVRSAEDLVSDRRLLRVALDAFGLEADLDNRYFIQKVL 85

Query: 79  ESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQS-----DIQHKTIIQDYKQSHQHK 133
                   +L N+L   +Y+ F+ ++   P      +     +   +  I    +S   +
Sbjct: 86  SDGTKAEDALANRLADSRYREFSEAFGLGPGEVRKTALITDMEKIAQKGIVARFESAVGE 145

Query: 134 EEVALEESKYFRKNI--------HKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD 185
            +  +  + Y + ++         +      L     L   +  +  +   +  L   K 
Sbjct: 146 SDETMRIALYAQHSLRELAEQTGSETKKWYDLMSLPPLRSMMETALGLPSSFGQLDIDKQ 205

Query: 186 V 186
           +
Sbjct: 206 L 206



 Score = 86.0 bits (211), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 43/243 (17%), Positives = 74/243 (30%), Gaps = 20/243 (8%)

Query: 120 KTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           +       Q+          E++YF +NI  + S + L  DRRLL   L +F +     +
Sbjct: 19  QRTYDAQLQTF-SASAENERETQYFLENIRNVRSAEDLVSDRRLLRVALDAFGLEADLDN 77

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             F++ VL+ G            D+R+R  +E F   P            +   +K +  
Sbjct: 78  RYFIQKVLSDGTKAEDALANRLADSRYREFSEAFGLGPGEVRKTALITDMEKIAQKGIVA 137

Query: 240 YFNNTIDCVPIVSDQNYY---------KLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
            F + +           Y         +   +    + D +  P L  M++ +L   +  
Sbjct: 138 RFESAVGESDETMRIALYAQHSLRELAEQTGSETKKWYDLMSLPPLRSMMETALGLPSSF 197

Query: 291 ITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHD 350
              D    L    D +           F               IQ + D Y    QI   
Sbjct: 198 GQLDIDKQLEIFRDKLAGLTGSEDLSQFV----------STQAIQSLTDTYLARSQIAQI 247

Query: 351 DKM 353
              
Sbjct: 248 QSA 250



 Score = 51.0 bits (120), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 32/243 (13%), Positives = 80/243 (32%), Gaps = 33/243 (13%)

Query: 341 YKKNCQILHDDKM-QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
           Y    Q        +   + +   +  ++S ++L+S +               L+ ALDA
Sbjct: 22  YDAQLQTFSASAENERETQYFLENIRNVRSAEDLVSDRR-------------LLRVALDA 68

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           + L     +R  ++ VL+      D+ AN+  D R  + + AF       +GP  + ++ 
Sbjct: 69  FGLEADLDNRYFIQKVLSDGTKAEDALANRLADSRYREFSEAF------GLGPGEVRKTA 122

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
           L                  A  +S  +M      +    E+  +    T          +
Sbjct: 123 LITDMEKIAQKGIVARFESAVGESDETMRIALYAQHSLRELAEQTGSETKKWY------D 176

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEIFK------SDLKDPKSFANTYKDNRYKEII 573
           L++   + + +  + G+      +  + +  +      + L   +  +        + + 
Sbjct: 177 LMSLPPLRSMMETALGL-PSSFGQLDIDKQLEIFRDKLAGLTGSEDLSQFVSTQAIQSLT 235

Query: 574 SSF 576
            ++
Sbjct: 236 DTY 238


>gi|170748128|ref|YP_001754388.1| hypothetical protein Mrad2831_1710 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654650|gb|ACB23705.1| protein of unknown function DUF1217 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 472

 Score =  176 bits (447), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 76/508 (14%), Positives = 157/508 (30%), Gaps = 102/508 (20%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           I + ++    N      + +D  Y+   I  V+S  DF+ + +LF     +    +    
Sbjct: 11  ISRDIAKSLKNKAAERAVANDTKYFSEHIGDVTSVDDFIGNARLFNFAMRAFGLEDMAYA 70

Query: 293 ADKFLTLMQENDPIVSQ-----------VKYFFQINFHRDNSSSTKIQQ--DSQIQKMLD 339
                 ++                      +    NF       +K +   + +++ ML+
Sbjct: 71  KSFMKKVLLGEPDANGHVLVDRLQDTRYRDFANAFNFRSYGDDPSKPKTFDNPEVEAMLE 130

Query: 340 LYKKNCQILH-----DDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQ 394
               N  +       D++     +          S+D+++S                   
Sbjct: 131 SVGANKTVDQQKLAYDNQTGRDTQYISDFAAYATSVDDIVSD-------------PKLSS 177

Query: 395 FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
                  L               S  +DP + A         ++   F+     +     
Sbjct: 178 IVRATVGLPPA------------SETADPATQA--------AEIASKFD-----AATFQN 212

Query: 455 MMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTI 514
                  I + +      +++I D             T    + E      Y+    +T+
Sbjct: 213 PAAVDAFIDEYLAMRKEGRKAIIDPY------FRPSGTYANSDAETEKLAAYFRAKASTL 266

Query: 515 HSFEELLANKRILNFLLESKGI-------DSQKVREDFLCEIFKSDLKDPKS---FANTY 564
            + ++++A+  + + +  + G+       D +         +  + L+DP++   F + +
Sbjct: 267 QTAQDIVADTTLTDIVWSTLGLPATNASKDPKAQAALIAKNLDVASLRDPRTLSQFIDRF 326

Query: 565 KDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALA 624
           KD R     +                          T D Y  Q +E     +D    LA
Sbjct: 327 KDARVAARSA--------------------------TVDAYVRQTLEDDAGAQDQGTRLA 360

Query: 625 LYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDS 684
           LYFKR    I++ Y IL D  L +VV   L      A      ++  + + + I  F+D 
Sbjct: 361 LYFKRQAGTIKSIYGILADKALAEVVRTTLGFPAEMARSNLDSQVAQISRKLDITTFQDP 420

Query: 685 KKVEDFLYAAKAMDHQSIDYKKALFSSP 712
           +K++ F+     M     D K    + P
Sbjct: 421 EKLDRFIRRFTIM----WDAKNDTAAQP 444



 Score =  164 bits (415), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 72/407 (17%), Positives = 144/407 (35%), Gaps = 41/407 (10%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +++     S+DI   L +  ++   V+ + +Y+ E I  ++++D+FI + RLF++A+
Sbjct: 1   MSSTYMDYTLISRDIAKSLKNKAAERA-VANDTKYFSEHIGDVTSVDDFIGNARLFNFAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLS-DPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQ 118
           +AFGL DM++A+ F+KK+L  +   +   LV++L   +Y+ FA +++F            
Sbjct: 60  RAFGLEDMAYAKSFMKKVLLGEPDANGHVLVDRLQDTRYRDFANAFNFRSYGDDPSKPKT 119

Query: 119 HKT-----------IIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYV 167
                           +   Q     +     +++Y         SVD +  D +L   V
Sbjct: 120 FDNPEVEAMLESVGANKTVDQQKLAYDNQTGRDTQYISDFAAYATSVDDIVSDPKLSSIV 179

Query: 168 LQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKI 227
             +  + P            T   A          D              D  L+ R + 
Sbjct: 180 RATVGLPPASE---------TADPATQAAEIASKFDAATFQNPAAVDAFIDEYLAMRKEG 230

Query: 228 LTDMQIEKIVSNYFNNTIDCVPIVSDQ----NYYKLAINSVSSFSDFLKDPKLFKMLQLS 283
                 + I+  YF  +       ++      Y++   +++ +  D + D  L  ++  +
Sbjct: 231 R-----KAIIDPYFRPSGTYANSDAETEKLAAYFRAKASTLQTAQDIVADTTLTDIVWST 285

Query: 284 LFPLNPEITADKFLTLMQ--ENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
           L       + D         +N  + S         F      +            +D Y
Sbjct: 286 LGLPATNASKDPKAQAALIAKNLDVASLRDPRTLSQFIDRFKDARVA----ARSATVDAY 341

Query: 342 KKNCQILHDDKM---QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNS 385
            +               L   ++   G IKSI  +L+ K   E   +
Sbjct: 342 VRQTLEDDAGAQDQGTRLALYFKRQAGTIKSIYGILADKALAEVVRT 388



 Score =  126 bits (317), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 34/229 (14%), Positives = 81/229 (35%), Gaps = 7/229 (3%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             S +         + +    K     + ++  Y++ +I  + S ++ + N R+ NF + 
Sbjct: 1   MSSTYMDYTLISRDIAKSLKNKAAERAVANDTKYFSEHIGDVTSVDDFIGNARLFNFAMR 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKS-FANTYKDNRYKEIISSFNFDIHGELSHKKIGK 591
           + G++     + F+ ++   +         +  +D RY++  ++FNF  +G+   K    
Sbjct: 61  AFGLEDMAYAKSFMKKVLLGEPDANGHVLVDRLQDTRYRDFANAFNFRSYGDDPSKPKTF 120

Query: 592 --VQDNFHIDDT-CDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFK 648
              +    ++    +    Q    K    +       Y         +  +I+ D KL  
Sbjct: 121 DNPEVEAMLESVGANKTVDQQ---KLAYDNQTGRDTQYISDFAAYATSVDDIVSDPKLSS 177

Query: 649 VVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
           +V   + L P         +   +        F++   V+ F+    AM
Sbjct: 178 IVRATVGLPPASETADPATQAAEIASKFDAATFQNPAAVDAFIDEYLAM 226



 Score = 70.6 bits (171), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 47/331 (14%), Positives = 106/331 (32%), Gaps = 31/331 (9%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
             ++ D     + +Y  +   + +++D+ + D +L S      GL               
Sbjct: 141 QKLAYDNQTGRDTQYISDFAAYATSVDDIVSDPKLSSIVRATVGLPP------------A 188

Query: 80  SDLSDPKS----LVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEE 135
           S+ +DP +    + ++ ++  +Q  A    F      ++ + +   I   ++ S  +   
Sbjct: 189 SETADPATQAAEIASKFDAATFQNPAAVDAFIDEYLAMRKEGRKAIIDPYFRPSGTYANS 248

Query: 136 VALEE--SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLP-FLKDVLTLGLA 192
            A  E  + YFR     + +   +  D  L D V  +  +     S     +  L     
Sbjct: 249 DAETEKLAAYFRAKASTLQTAQDIVADTTLTDIVWSTLGLPATNASKDPKAQAALIAKNL 308

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS 252
           +        RD R       F  +   +         D  + + + +          +  
Sbjct: 309 D----VASLRDPRTL---SQFIDRFKDARVAARSATVDAYVRQTLEDDAGAQDQGTRLAL 361

Query: 253 DQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITA--DKFLTLMQENDPIVSQV 310
              Y+K    ++ S    L D  L ++++ +L        +  D  +  +     I +  
Sbjct: 362 ---YFKRQAGTIKSIYGILADKALAEVVRTTLGFPAEMARSNLDSQVAQISRKLDITTFQ 418

Query: 311 KYFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
                  F R  +     + D+  Q  L L+
Sbjct: 419 DPEKLDRFIRRFTIMWDAKNDTAAQPALSLF 449


>gi|221634512|ref|YP_002523200.1| hypothetical protein RSKD131_4487 [Rhodobacter sphaeroides KD131]
 gi|221163385|gb|ACM04347.1| Hypothetical Protein RSKD131_4487 [Rhodobacter sphaeroides KD131]
          Length = 262

 Score =  176 bits (447), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 81/231 (35%), Gaps = 21/231 (9%)

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
                +ME+       + ++  EV Y+   I T+ + E+L+++ R+L   L + G+    
Sbjct: 16  RFLGRTMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAI 75

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
             +  + ++      D  + AN   D R+  +  +F+F                    D 
Sbjct: 76  NGKALIRKVLGEGAADKGALANRLSDKRWLALAKAFDF------GGASGAGTGTAGFADR 129

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSK 652
               Y+ Q  E    E D N+ LAL   R +  + +         + +LG + L  V   
Sbjct: 130 IAGQYRTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDG 189

Query: 653 KLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKA 696
              L   FA L   +++ I +            + F    K E  +     
Sbjct: 190 AFGLPREFAALDLDRQVEIYQDRAARMFGSGSASQFAAEDKRETLIKTFLI 240



 Score =  129 bits (325), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 68/176 (38%), Gaps = 13/176 (7%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           +   V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +
Sbjct: 31  QSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGAA 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE-- 140
           D  +L N+L+  ++   A+++DF         +      I   Y+          ++   
Sbjct: 91  DKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDANL 150

Query: 141 --SKYFRKNIHKINS--------VDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
             +    + +  + S           +     L      +F +  ++ +L   + V
Sbjct: 151 GLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 82.2 bits (201), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 56/199 (28%), Gaps = 9/199 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            + +    E  YF + I  + + + L  D RLL   L +F +         ++ VL  G 
Sbjct: 30  DQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGA 89

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV 251
           A+         D R+ A+A+ F F              D    +  +  F   I  V   
Sbjct: 90  ADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDAN 149

Query: 252 SDQNY-YKLAINSVSS--------FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
                     + +++S        +   L    L  +   +          D    +   
Sbjct: 150 LGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVEIY 209

Query: 303 NDPIVSQVKYFFQINFHRD 321
            D             F  +
Sbjct: 210 QDRAARMFGSGSASQFAAE 228



 Score = 66.4 bits (160), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 68/210 (32%), Gaps = 27/210 (12%)

Query: 342 KKNCQILHDDK--MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
            +  +  HD    +Q  +  +   +G +++ ++L+S                 L+ AL A
Sbjct: 22  MERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYR-------------LLKVALGA 68

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           + L      +  +R VL    +D  + AN+  D R + L  AF+F      G      + 
Sbjct: 69  FGLGEAINGKALIRKVLGEGAADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFAD 128

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                  +  +          N               + +++ E  +++           
Sbjct: 129 RIAGQY-RTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFS----------- 176

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEI 549
           +L +  +      + G+  +    D   ++
Sbjct: 177 VLGSTSLRAVFDGAFGLPREFAALDLDRQV 206


>gi|126464886|ref|YP_001041862.1| hypothetical protein Rsph17029_4159 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126106701|gb|ABN79226.1| protein of unknown function DUF1217 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 262

 Score =  176 bits (447), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 43/231 (18%), Positives = 81/231 (35%), Gaps = 21/231 (9%)

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
                +ME+       + ++  EV Y+   I T+ + E+L+++ R+L   L + G+    
Sbjct: 16  RFLGRTMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAI 75

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
             +  + ++      D  + AN   D R+  +  +F+F                    D 
Sbjct: 76  NGKALIRKVLGEGAADKGALANRLSDKRWLALAKAFDF------GGTSGAGTGTAGFADR 129

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSK 652
               Y+ Q  E    E D N+ LAL   R +  + +         + +LG + L  V   
Sbjct: 130 IAGQYRTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDG 189

Query: 653 KLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKA 696
              L   FA L   +++ I +            + F    K E  +     
Sbjct: 190 AFGLPREFAALDLDRQVEIYQDRTARMFGSGSASQFAAEDKRETLIKTFLI 240



 Score =  130 bits (326), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 68/176 (38%), Gaps = 13/176 (7%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           +   V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +
Sbjct: 31  QSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGAA 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE-- 140
           D  +L N+L+  ++   A+++DF         +      I   Y+          ++   
Sbjct: 91  DKGALANRLSDKRWLALAKAFDFGGTSGAGTGTAGFADRIAGQYRTQSFEAAIGEVDANL 150

Query: 141 --SKYFRKNIHKINS--------VDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
             +    + +  + S           +     L      +F +  ++ +L   + V
Sbjct: 151 GLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 81.4 bits (199), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 56/199 (28%), Gaps = 9/199 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            + +    E  YF + I  + + + L  D RLL   L +F +         ++ VL  G 
Sbjct: 30  DQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLGEGA 89

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV 251
           A+         D R+ A+A+ F F              D    +  +  F   I  V   
Sbjct: 90  ADKGALANRLSDKRWLALAKAFDFGGTSGAGTGTAGFADRIAGQYRTQSFEAAIGEVDAN 149

Query: 252 SDQNY-YKLAINSVSS--------FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
                     + +++S        +   L    L  +   +          D    +   
Sbjct: 150 LGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVEIY 209

Query: 303 NDPIVSQVKYFFQINFHRD 321
            D             F  +
Sbjct: 210 QDRTARMFGSGSASQFAAE 228



 Score = 66.4 bits (160), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 68/210 (32%), Gaps = 27/210 (12%)

Query: 342 KKNCQILHDDK--MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
            +  +  HD    +Q  +  +   +G +++ ++L+S                 L+ AL A
Sbjct: 22  MERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYR-------------LLKVALGA 68

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           + L      +  +R VL    +D  + AN+  D R + L  AF+F      G      + 
Sbjct: 69  FGLGEAINGKALIRKVLGEGAADKGALANRLSDKRWLALAKAFDFGGTSGAGTGTAGFAD 128

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                  +  +          N               + +++ E  +++           
Sbjct: 129 RIAGQY-RTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFS----------- 176

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEI 549
           +L +  +      + G+  +    D   ++
Sbjct: 177 VLGSTSLRAVFDGAFGLPREFAALDLDRQV 206


>gi|89069825|ref|ZP_01157160.1| flagellar protein, putative [Oceanicola granulosus HTCC2516]
 gi|89044626|gb|EAR50742.1| flagellar protein, putative [Oceanicola granulosus HTCC2516]
          Length = 264

 Score =  176 bits (445), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 40/232 (17%), Positives = 83/232 (35%), Gaps = 20/232 (8%)

Query: 478 DAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGID 537
                   ++E        +  I    + +   +  I S ++LL +++ +  +L + G+D
Sbjct: 13  AGYRFLARTLEVQQAAYAASAPIERATESFREKVPQITSIDDLLDDRQAMQVVLGAFGLD 72

Query: 538 SQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFH 597
                  F+ ++ +     P SFA    D RY ++  +  F   G       GK Q    
Sbjct: 73  DDIDSAAFVRKVLEEGTVAPDSFAIRLSDKRYLQLADALGFGDLG-----GAGKTQWLGF 127

Query: 598 IDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNHYEILGDSKLFKV 649
            D     Y+ +  E+   E+D  + +AL   R +  +           + I+G++ L  V
Sbjct: 128 ADVIVARYEARQFERAVGEQDEQLRIALSVSRGVEEVLQGQDGRTARWFAIMGNAPLRSV 187

Query: 650 VSKKLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAA 694
               L  S  F  +   +++   ++            DF++    E  +   
Sbjct: 188 FETALGFSSSFGSIDLDQQLEQFQERTESVLGSGDPADFENEAVQEKLIRLY 239



 Score =  119 bits (299), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 33/214 (15%), Positives = 74/214 (34%), Gaps = 26/214 (12%)

Query: 20  STVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILE 79
           +  +    +      +RE++  I++ID+ + D++     L AFGL D   +  F++K+LE
Sbjct: 27  AAYAASAPIERATESFREKVPQITSIDDLLDDRQAMQVVLGAFGLDDDIDSAAFVRKVLE 86

Query: 80  SDLSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQHKTIIQDYKQSHQHKEEVA 137
                P S   +L+  +Y   A +  F         Q       I+  Y+     +    
Sbjct: 87  EGTVAPDSFAIRLSDKRYLQLADALGFGDLGGAGKTQWLGFADVIVARYEARQFERAVGE 146

Query: 138 LEE----SKYFRKNIHKINSVDQ--------LFKDRRLLDYVLQSFSITPKYISLPFLKD 185
            +E    +    + + ++             +  +  L      +   +  + S+   + 
Sbjct: 147 QDEQLRIALSVSRGVEEVLQGQDGRTARWFAIMGNAPLRSVFETALGFSSSFGSIDLDQQ 206

Query: 186 ----------VLTLGLANPKKYFIESRDNRFRAM 209
                     VL  G  +P  +  E+   +   +
Sbjct: 207 LEQFQERTESVLGSG--DPADFENEAVQEKLIRL 238



 Score = 76.4 bits (186), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 37/245 (15%), Positives = 82/245 (33%), Gaps = 20/245 (8%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           +Q+           ++ FR+ + +I S+D L  DR+ +  VL +F +     S  F++ V
Sbjct: 25  QQAAYAASAPIERATESFREKVPQITSIDDLLDDRQAMQVVLGAFGLDDDIDSAAFVRKV 84

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRD-KILTDMQIEKIVSNYFNNTI 245
           L  G   P  + I   D R+  +A+   F   G   K       D+ + +  +  F   +
Sbjct: 85  LEEGTVAPDSFAIRLSDKRYLQLADALGFGDLGGAGKTQWLGFADVIVARYEARQFERAV 144

Query: 246 DCVPIVSDQNY---------YKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
                                +      + +   + +  L  + + +L   +   + D  
Sbjct: 145 GEQDEQLRIALSVSRGVEEVLQGQDGRTARWFAIMGNAPLRSVFETALGFSSSFGSIDLD 204

Query: 297 LTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSL 356
             L Q  +   S +      +F          + ++  +K++ LY    ++     +   
Sbjct: 205 QQLEQFQERTESVLGSGDPADF----------ENEAVQEKLIRLYMVRTEMAASQSLSGA 254

Query: 357 IKDYQ 361
                
Sbjct: 255 AAALT 259



 Score = 61.0 bits (146), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 45/127 (35%), Gaps = 14/127 (11%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
                ++   + ++  + +I SID+LL  +  +             Q  L A+ L+    
Sbjct: 30  AASAPIERATESFREKVPQITSIDDLLDDRQAM-------------QVVLGAFGLDDDID 76

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI-GPIPMMQSRLTIRDNV 466
               +R VL      PDS+A +  D R ++L  A  F   G       +  + + +    
Sbjct: 77  SAAFVRKVLEEGTVAPDSFAIRLSDKRYLQLADALGFGDLGGAGKTQWLGFADVIVARYE 136

Query: 467 KHYANRK 473
                R 
Sbjct: 137 ARQFERA 143


>gi|310816824|ref|YP_003964788.1| flagellar protein, putative [Ketogulonicigenium vulgare Y25]
 gi|308755559|gb|ADO43488.1| flagellar protein, putative [Ketogulonicigenium vulgare Y25]
          Length = 262

 Score =  174 bits (441), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 47/242 (19%), Positives = 83/242 (34%), Gaps = 25/242 (10%)

Query: 488 EQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLC 547
           E+ +     + E+     Y+   I  I + E+LLA++R+L+  L + G+      + F+ 
Sbjct: 23  ERQTAVFAASGEVAMNSTYFRDTIAKIQTPEDLLADRRLLSVALGAFGLQDDLNAKAFIK 82

Query: 548 EIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKH 607
            +      D  +FAN   D RY  + ++F F   G       G        D     Y  
Sbjct: 83  RVLVEGTDDKTAFANKLSDKRYAALANAFGFGNEGGARTADAG------FADTILARYTA 136

Query: 608 QMIEKKEEEKDPNIALALYF--------KRTIPNIRNHYEILGDSKLFKVVSKKLKLSPY 659
           +  E    E+D  + LAL          +    +    + ++GDS L  V    L     
Sbjct: 137 ESFELAVGEQDNTMRLALNLSGGISDVMQHATSDSAQWFAMMGDSPLRSVFETALGFPTG 196

Query: 660 FAVLPERKKIRILKKHIK-------INDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSP 712
           F  +   ++ +      K         DF D    E  +           +   +  +SP
Sbjct: 197 FGQIDIDQQKQQFMARAKATFGVESFADFTDPAVQEKLIRLF----MLRSEMNNSSLNSP 252

Query: 713 NQ 714
             
Sbjct: 253 AS 254



 Score =  127 bits (319), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 38/190 (20%), Positives = 69/190 (36%), Gaps = 13/190 (6%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           +  +           +  +  +    V+    Y+R+ I  I T ++ + D+RL S AL A
Sbjct: 9   LSGYTGWRFLSQTLERQTAVFAASGEVAMNSTYFRDTIAKIQTPEDLLADRRLLSVALGA 68

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDI-QHK 120
           FGL D  +A+ FIK++L     D  +  N+L+  +Y   A ++ F        +D     
Sbjct: 69  FGLQDDLNAKAFIKRVLVEGTDDKTAFANKLSDKRYAALANAFGFGNEGGARTADAGFAD 128

Query: 121 TIIQDYK-QSHQHKEEVALEESKYFRKNIHKINSVDQ-----------LFKDRRLLDYVL 168
           TI+  Y  +S +          +        I+ V Q           +  D  L     
Sbjct: 129 TILARYTAESFELAVGEQDNTMRLALNLSGGISDVMQHATSDSAQWFAMMGDSPLRSVFE 188

Query: 169 QSFSITPKYI 178
            +      + 
Sbjct: 189 TALGFPTGFG 198



 Score = 90.7 bits (223), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 37/195 (18%), Positives = 63/195 (32%), Gaps = 9/195 (4%)

Query: 133 KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA 192
                   S YFR  I KI + + L  DRRLL   L +F +     +  F+K VL  G  
Sbjct: 31  ASGEVAMNSTYFRDTIAKIQTPEDLLADRRLLSVALGAFGLQDDLNAKAFIKRVLVEGTD 90

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS 252
           +   +  +  D R+ A+A  F F  +G     D    D  + +  +  F   +       
Sbjct: 91  DKTAFANKLSDKRYAALANAFGFGNEGGARTADAGFADTILARYTAESFELAVGEQDNTM 150

Query: 253 DQNY---------YKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEN 303
                         + A +  + +   + D  L  + + +L         D      Q  
Sbjct: 151 RLALNLSGGISDVMQHATSDSAQWFAMMGDSPLRSVFETALGFPTGFGQIDIDQQKQQFM 210

Query: 304 DPIVSQVKYFFQINF 318
               +        +F
Sbjct: 211 ARAKATFGVESFADF 225



 Score = 62.9 bits (151), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 43/121 (35%), Gaps = 13/121 (10%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
               ++      ++  + KI++ ++LL+ +               L  AL A+ L     
Sbjct: 30  AASGEVAMNSTYFRDTIAKIQTPEDLLADRR-------------LLSVALGAFGLQDDLN 76

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  ++ VL     D  ++ANK  D R   L +AF F  +G         +   +     
Sbjct: 77  AKAFIKRVLVEGTDDKTAFANKLSDKRYAALANAFGFGNEGGARTADAGFADTILARYTA 136

Query: 468 H 468
            
Sbjct: 137 E 137



 Score = 39.1 bits (89), Expect = 2.6,   Method: Composition-based stats.
 Identities = 22/179 (12%), Positives = 47/179 (26%), Gaps = 17/179 (9%)

Query: 232 QIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP-- 289
            + + +            +  +  Y++  I  + +  D L D +L  +   +    +   
Sbjct: 17  FLSQTLERQTAVFAASGEVAMNSTYFRDTIAKIQTPEDLLADRRLLSVALGAFGLQDDLN 76

Query: 290 ----------EITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLD 339
                     E T DK     + +D   +         F  +  + T          +L 
Sbjct: 77  AKAFIKRVLVEGTDDKTAFANKLSDKRYAA--LANAFGFGNEGGARTA--DAGFADTILA 132

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLL-SGKCQLEGPNSAEEPIITLQFAL 397
            Y      L   +  + ++      G I  +     S   Q              + AL
Sbjct: 133 RYTAESFELAVGEQDNTMRLALNLSGGISDVMQHATSDSAQWFAMMGDSPLRSVFETAL 191


>gi|125654647|ref|YP_001033841.1| flagellar basal-body rod protein FLGF [Rhodobacter sphaeroides
           2.4.1]
 gi|77386307|gb|ABA81736.1| possible flagellar basal-body ROD protein FLGF [Rhodobacter
           sphaeroides 2.4.1]
          Length = 262

 Score =  174 bits (440), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 80/231 (34%), Gaps = 21/231 (9%)

Query: 481 NKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQK 540
                +ME+       + ++  EV Y+   I T+ + E+L+++ R+L   L + G+    
Sbjct: 16  RFLGRTMERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAI 75

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
             +  + ++      D  + AN   D R+  +  +F+F                    D 
Sbjct: 76  NGKALIRKVLNEGAADKGALANRLSDKRWLALAKAFDF------GGASGAGTGTAGFADR 129

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSK 652
               Y+ Q  E    E D N+ LAL     +  + +         + +LG + L  V   
Sbjct: 130 IAGQYRTQSFEAAIGEVDANLGLALTLDHEMATLASDDMSEEAKWFSVLGSTSLRAVFDG 189

Query: 653 KLKLSPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKA 696
              L   FA L   +++ I +            + F    K E  +     
Sbjct: 190 AFGLPREFAALDLDRQVEIYQDRTARMFGSGSASQFAAEDKRETLIKTFLI 240



 Score =  131 bits (330), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 31/176 (17%), Positives = 67/176 (38%), Gaps = 13/176 (7%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           +   V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +
Sbjct: 31  QSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGAA 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE-- 140
           D  +L N+L+  ++   A+++DF         +      I   Y+          ++   
Sbjct: 91  DKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDANL 150

Query: 141 ----------SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
                     +     ++ +      +     L      +F +  ++ +L   + V
Sbjct: 151 GLALTLDHEMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 80.3 bits (196), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 56/199 (28%), Gaps = 9/199 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            + +    E  YF + I  + + + L  D RLL   L +F +         ++ VL  G 
Sbjct: 30  DQSQQVQREVAYFAEKIGTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGA 89

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV 251
           A+         D R+ A+A+ F F              D    +  +  F   I  V   
Sbjct: 90  ADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDAN 149

Query: 252 SDQNY-YKLAINSVSS--------FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
                     + +++S        +   L    L  +   +          D    +   
Sbjct: 150 LGLALTLDHEMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVEIY 209

Query: 303 NDPIVSQVKYFFQINFHRD 321
            D             F  +
Sbjct: 210 QDRTARMFGSGSASQFAAE 228



 Score = 67.6 bits (163), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 29/210 (13%), Positives = 68/210 (32%), Gaps = 27/210 (12%)

Query: 342 KKNCQILHDDK--MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
            +  +  HD    +Q  +  +   +G +++ ++L+S                 L+ AL A
Sbjct: 22  MERQRDSHDQSQQVQREVAYFAEKIGTVRTPEDLVSDYR-------------LLKVALGA 68

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           + L      +  +R VL    +D  + AN+  D R + L  AF+F      G      + 
Sbjct: 69  FGLGEAINGKALIRKVLNEGAADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFAD 128

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                  +  +          N               + +++ E  +++           
Sbjct: 129 RIAGQY-RTQSFEAAIGEVDANLGLALTLDHEMATLASDDMSEEAKWFS----------- 176

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEI 549
           +L +  +      + G+  +    D   ++
Sbjct: 177 VLGSTSLRAVFDGAFGLPREFAALDLDRQV 206


>gi|332561334|ref|ZP_08415649.1| flagellar basal-body rod protein FLGF [Rhodobacter sphaeroides
           WS8N]
 gi|332274133|gb|EGJ19450.1| flagellar basal-body rod protein FLGF [Rhodobacter sphaeroides
           WS8N]
          Length = 262

 Score =  173 bits (438), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 82/227 (36%), Gaps = 21/227 (9%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            +ME+       + ++  EV Y+   I+T+ + E+L+++ R+L   L + G+      + 
Sbjct: 20  RTMERQRDSHDQSQQVQREVAYFAEKIDTVRTPEDLVSDYRLLKVALGAFGLGEAINGKA 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            + ++      D  + AN   D R+  +  +F+F                    D     
Sbjct: 80  LIRKVLNEGAADKGALANRLSDKRWLALAKAFDF------GGASGAGTGTAGFADRIAGQ 133

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKL 656
           Y+ Q  E    E D N+ LAL   R +  + +         + +LG + L  V      L
Sbjct: 134 YRTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGL 193

Query: 657 SPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKA 696
              FA L   +++ I +            + F    K E  +     
Sbjct: 194 PREFAALDLDRQVEIYQDRTARMFGSGSASQFAAEDKRETLIKTFLI 240



 Score =  129 bits (323), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 32/176 (18%), Positives = 68/176 (38%), Gaps = 13/176 (7%)

Query: 24  KDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLS 83
           +   V  E  Y+ E+I  + T ++ + D RL   AL AFGL +  + +  I+K+L    +
Sbjct: 31  QSQQVQREVAYFAEKIDTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGAA 90

Query: 84  DPKSLVNQLNSLKYQYFARSYDF-SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE-- 140
           D  +L N+L+  ++   A+++DF         +      I   Y+          ++   
Sbjct: 91  DKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDANL 150

Query: 141 --SKYFRKNIHKINS--------VDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
             +    + +  + S           +     L      +F +  ++ +L   + V
Sbjct: 151 GLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQV 206



 Score = 80.3 bits (196), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 56/199 (28%), Gaps = 9/199 (4%)

Query: 132 HKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGL 191
            + +    E  YF + I  + + + L  D RLL   L +F +         ++ VL  G 
Sbjct: 30  DQSQQVQREVAYFAEKIDTVRTPEDLVSDYRLLKVALGAFGLGEAINGKALIRKVLNEGA 89

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIV 251
           A+         D R+ A+A+ F F              D    +  +  F   I  V   
Sbjct: 90  ADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFADRIAGQYRTQSFEAAIGEVDAN 149

Query: 252 SDQNY-YKLAINSVSS--------FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
                     + +++S        +   L    L  +   +          D    +   
Sbjct: 150 LGLALTLDREMATLASDDMSEEAKWFSVLGSTSLRAVFDGAFGLPREFAALDLDRQVEIY 209

Query: 303 NDPIVSQVKYFFQINFHRD 321
            D             F  +
Sbjct: 210 QDRTARMFGSGSASQFAAE 228



 Score = 64.9 bits (156), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 28/210 (13%), Positives = 67/210 (31%), Gaps = 27/210 (12%)

Query: 342 KKNCQILHDDK--MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
            +  +  HD    +Q  +  +   +  +++ ++L+S                 L+ AL A
Sbjct: 22  MERQRDSHDQSQQVQREVAYFAEKIDTVRTPEDLVSDYR-------------LLKVALGA 68

Query: 400 YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
           + L      +  +R VL    +D  + AN+  D R + L  AF+F      G      + 
Sbjct: 69  FGLGEAINGKALIRKVLNEGAADKGALANRLSDKRWLALAKAFDFGGASGAGTGTAGFAD 128

Query: 460 LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                  +  +          N               + +++ E  +++           
Sbjct: 129 RIAGQY-RTQSFEAAIGEVDANLGLALTLDREMATLASDDMSEEAKWFS----------- 176

Query: 520 LLANKRILNFLLESKGIDSQKVREDFLCEI 549
           +L +  +      + G+  +    D   ++
Sbjct: 177 VLGSTSLRAVFDGAFGLPREFAALDLDRQV 206


>gi|294679038|ref|YP_003579653.1| flagellar protein [Rhodobacter capsulatus SB 1003]
 gi|294477858|gb|ADE87246.1| flagellar protein, putative [Rhodobacter capsulatus SB 1003]
          Length = 275

 Score =  172 bits (435), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 41/204 (20%), Positives = 85/204 (41%), Gaps = 13/204 (6%)

Query: 482 KSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKV 541
               +ME+       + +I  + DY+   I +I + E+L++++R+L   L + G+DS   
Sbjct: 17  LLNRTMEKQKAAFAASADIKRDEDYFRAKIGSITTAEDLVSDRRLLKVALGAFGLDSDID 76

Query: 542 REDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDT 601
            + F+ ++ ++   D    AN   D  Y ++ ++F F            + Q +   D+ 
Sbjct: 77  NKFFIRKVLETAADDKTGLANKLADKTYLKLATAFGFGD-----TPDAPRTQTSGFADEI 131

Query: 602 CDLYKHQMIEKKEEEKDPNIALALYFKRTIPNI--------RNHYEILGDSKLFKVVSKK 653
              Y+ +  E    E D +  LA+  +R +  +           Y ++G   L  V+   
Sbjct: 132 LSKYETRQFETAVGESDESYRLAMAAQRDLGELVASSSTNNAKWYSVIGSKSLSTVMRTA 191

Query: 654 LKLSPYFAVLPERKKIRILKKHIK 677
           L L    + L   +++ I  +  K
Sbjct: 192 LGLPESVSSLDVDQQLVIYTQKAK 215



 Score =  125 bits (313), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 72/192 (37%), Gaps = 15/192 (7%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
             ++ ++ K  +  +    +  +E Y+R +I  I+T ++ + D+RL   AL AFGL    
Sbjct: 17  LLNRTME-KQKAAFAASADIKRDEDYFRAKIGSITTAEDLVSDRRLLKVALGAFGLDSDI 75

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFS--PPPKVIQSDIQHKTIIQDY 126
             + FI+K+LE+   D   L N+L    Y   A ++ F   P     Q+      I+  Y
Sbjct: 76  DNKFFIRKVLETAADDKTGLANKLADKTYLKLATAFGFGDTPDAPRTQTSGFADEILSKY 135

Query: 127 KQSHQHKEEVALEES------------KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
           +           +ES            +    +         +   + L   +  +  + 
Sbjct: 136 ETRQFETAVGESDESYRLAMAAQRDLGELVASSSTNNAKWYSVIGSKSLSTVMRTALGLP 195

Query: 175 PKYISLPFLKDV 186
               SL   + +
Sbjct: 196 ESVSSLDVDQQL 207



 Score = 81.0 bits (198), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 31/178 (17%), Positives = 59/178 (33%), Gaps = 16/178 (8%)

Query: 133 KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA 192
                  +  YFR  I  I + + L  DRRLL   L +F +     +  F++ VL     
Sbjct: 31  ASADIKRDEDYFRAKIGSITTAEDLVSDRRLLKVALGAFGLDSDIDNKFFIRKVLETAAD 90

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS 252
           +      +  D  +  +A  F F   G      +  T    ++I+S Y     +     S
Sbjct: 91  DKTGLANKLADKTYLKLATAFGF---GDTPDAPRTQTSGFADEILSKYETRQFETAVGES 147

Query: 253 DQNYYKLAIN-------------SVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
           D++Y                   + + +   +    L  +++ +L       + D   
Sbjct: 148 DESYRLAMAAQRDLGELVASSSTNNAKWYSVIGSKSLSTVMRTALGLPESVSSLDVDQ 205



 Score = 61.4 bits (147), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 70/202 (34%), Gaps = 24/202 (11%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
                ++     ++  +G I + ++L+S +               L+ AL A+ L+    
Sbjct: 30  AASADIKRDEDYFRAKIGSITTAEDLVSDRR-------------LLKVALGAFGLDSDID 76

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
           ++  +R VL +   D    ANK  D   +KL  AF F   G     P  Q+     + + 
Sbjct: 77  NKFFIRKVLETAADDKTGLANKLADKTYLKLATAFGF---GDTPDAPRTQTSGFADEILS 133

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
            Y  R+      E     S E          ++   V   + N    +S    + +K + 
Sbjct: 134 KYETRQFETAVGE-----SDESYRLAMAAQRDLGELVASSSTNNAKWYSV---IGSKSLS 185

Query: 528 NFLLESKGIDSQKVREDFLCEI 549
             +  + G+       D   ++
Sbjct: 186 TVMRTALGLPESVSSLDVDQQL 207



 Score = 49.5 bits (116), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/205 (11%), Positives = 64/205 (31%), Gaps = 16/205 (7%)

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
           + + +            I  D++Y++  I S+++  D + D +L K+   +    + +I 
Sbjct: 18  LNRTMEKQKAAFAASADIKRDEDYFRAKIGSITTAEDLVSDRRLLKVALGAFGL-DSDID 76

Query: 293 ADKFLTLMQEND-----------PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
              F+  + E                + +K      F  D   + + Q      ++L  Y
Sbjct: 77  NKFFIRKVLETAADDKTGLANKLADKTYLKLATAFGFG-DTPDAPRTQTSGFADEILSKY 135

Query: 342 KKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
           +       +  +    + Y+L +   + +  L++          +     +L   +    
Sbjct: 136 ETRQ---FETAVGESDESYRLAMAAQRDLGELVASSSTNNAKWYSVIGSKSLSTVMRTAL 192

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSY 426
              + +    +   L        S 
Sbjct: 193 GLPESVSSLDVDQQLVIYTQKAKSV 217


>gi|119384357|ref|YP_915413.1| flagellar protein, putative [Paracoccus denitrificans PD1222]
 gi|119374124|gb|ABL69717.1| flagellar protein, putative [Paracoccus denitrificans PD1222]
          Length = 264

 Score =  171 bits (432), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 89/226 (39%), Gaps = 22/226 (9%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            +M +       +  I S  +Y++     + + ++ + + RIL   L + G+DS    + 
Sbjct: 20  RTMLRQRGALSQDHVIRSSKEYFSQRFPLVETADQFVNDYRILTVALRAFGLDSDISNKY 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           FL ++ ++D  D  SF N   D RY  +  + +F          + +      I    + 
Sbjct: 80  FLKKVLEADPNDSGSFINRLSDKRYLRMNQALSFYA-------PLDERGGVIDISSIIEK 132

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKL 656
           Y+ + +EK    + P I LAL  +R + ++           Y++L    L +V      L
Sbjct: 133 YEIRSLEKNIGGRYPEIELALNARRELSDLAASDASENVKWYQVLSSKPLRRVFEVAYGL 192

Query: 657 SPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAK 695
              F+ L   +++  LK           ++ FK  + ++  L    
Sbjct: 193 GEGFSALSIDRQLYELKGRTGILTGSNDVSQFKSDEVLDIILKRFL 238



 Score =  116 bits (290), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 40/184 (21%), Positives = 79/184 (42%), Gaps = 12/184 (6%)

Query: 17  KLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKK 76
           +    +S+D ++   + Y+ +R   + T D+F+ D R+ + AL+AFGL      + F+KK
Sbjct: 24  RQRGALSQDHVIRSSKEYFSQRFPLVETADQFVNDYRILTVALRAFGLDSDISNKYFLKK 83

Query: 77  ILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKE-- 134
           +LE+D +D  S +N+L+  +Y    ++  F  P       I   +II+ Y+     K   
Sbjct: 84  VLEADPNDSGSFINRLSDKRYLRMNQALSFYAPLDERGGVIDISSIIEKYEIRSLEKNIG 143

Query: 135 ------EVALEESKYFRKNIHKINS----VDQLFKDRRLLDYVLQSFSITPKYISLPFLK 184
                 E+AL   +          S      Q+   + L      ++ +   + +L   +
Sbjct: 144 GRYPEIELALNARRELSDLAASDASENVKWYQVLSSKPLRRVFEVAYGLGEGFSALSIDR 203

Query: 185 DVLT 188
            +  
Sbjct: 204 QLYE 207



 Score = 76.0 bits (185), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 30/199 (15%), Positives = 61/199 (30%), Gaps = 8/199 (4%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
             ++ V     +YF +    + + DQ   D R+L   L++F +     +  FLK VL   
Sbjct: 29  LSQDHVIRSSKEYFSQRFPLVETADQFVNDYRILTVALRAFGLDSDISNKYFLKKVLEAD 88

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPD----GSLSKRDKILTDMQIEKIVSNYFNNTID 246
             +   +     D R+  M +   F       G +     I+   +I  +  N      +
Sbjct: 89  PNDSGSFINRLSDKRYLRMNQALSFYAPLDERGGVIDISSIIEKYEIRSLEKNIGGRYPE 148

Query: 247 CVPIVSDQNYYKLAINSVSS----FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
               ++ +        S +S    +   L    L ++ +++               L + 
Sbjct: 149 IELALNARRELSDLAASDASENVKWYQVLSSKPLRRVFEVAYGLGEGFSALSIDRQLYEL 208

Query: 303 NDPIVSQVKYFFQINFHRD 321
                          F  D
Sbjct: 209 KGRTGILTGSNDVSQFKSD 227



 Score = 62.5 bits (150), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 29/204 (14%), Positives = 76/204 (37%), Gaps = 26/204 (12%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             D  ++S  + +      +++ D  ++                 L  AL A+ L+    
Sbjct: 30  SQDHVIRSSKEYFSQRFPLVETADQFVNDYR-------------ILTVALRAFGLDSDIS 76

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
           ++  L+ VL ++P+D  S+ N+  D R +++N A +F A        +  S +  +  ++
Sbjct: 77  NKYFLKKVLEADPNDSGSFINRLSDKRYLRMNQALSFYAPLDERGGVIDISSIIEKYEIR 136

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
                    +     + N+  ++S       + +  V +Y           ++L++K + 
Sbjct: 137 SLEKNIGGRYPEIELALNARRELSDLAA--SDASENVKWY-----------QVLSSKPLR 183

Query: 528 NFLLESKGIDSQKVREDFLCEIFK 551
                + G+           ++++
Sbjct: 184 RVFEVAYGLGEGFSALSIDRQLYE 207


>gi|218661874|ref|ZP_03517804.1| hypothetical protein RetlI_21473 [Rhizobium etli IE4771]
          Length = 133

 Score =  161 bits (407), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 54/134 (40%), Positives = 89/134 (66%), Gaps = 2/134 (1%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           MI + +A    SKD+ S L + V+    V  + +YY + I  ++++D+F+ D +L+SYA+
Sbjct: 1   MITASLAYSILSKDMTSSL-NKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQH 119
           KA+GL DM++A+ F+KK+LESDL+DP S  N+L+  +Y+ FA +++F+ P K +Q+D Q 
Sbjct: 60  KAYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNAPEKDVQTDAQE 119

Query: 120 KTIIQDYKQSHQHK 133
             +I  YKQS    
Sbjct: 120 DELIGLYKQSFVDA 133



 Score = 95.7 bits (236), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 32/141 (22%), Positives = 63/141 (44%), Gaps = 8/141 (5%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
             +   A +     M     +      +  +  YY  +IN + S ++ L + ++ ++ ++
Sbjct: 1   MITASLAYSILSKDMTSSLNKVASQATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +SDL DP S+AN   D RY+E  ++FNF+            V
Sbjct: 61  AYGLEDMTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNA-------PEKDV 113

Query: 593 QDNFHIDDTCDLYKHQMIEKK 613
           Q +   D+   LYK Q     
Sbjct: 114 QTDAQEDELIGLYK-QSFVDA 133



 Score = 79.9 bits (195), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 52/127 (40%), Gaps = 18/127 (14%)

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
            ++     ++   + Y   + K+ S+D+ L                    +A+ AY L  
Sbjct: 20  NKVASQATVKKDAQYYADHINKVTSVDDFLGDY-------------KLYSYAMKAYGLED 66

Query: 405 QDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRD 464
               +  ++ VL S+ +DP+SYANK  D R  +   AFNFNA     P   +Q+     +
Sbjct: 67  MTYAKAFMKKVLESDLTDPNSYANKLSDARYREFAAAFNFNA-----PEKDVQTDAQEDE 121

Query: 465 NVKHYAN 471
            +  Y  
Sbjct: 122 LIGLYKQ 128



 Score = 78.7 bits (192), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 54/114 (47%), Gaps = 5/114 (4%)

Query: 134 EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLAN 193
           +    ++++Y+  +I+K+ SVD    D +L  Y ++++ +     +  F+K VL   L +
Sbjct: 25  QATVKKDAQYYADHINKVTSVDDFLGDYKLYSYAMKAYGLEDMTYAKAFMKKVLESDLTD 84

Query: 194 PKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDC 247
           P  Y  +  D R+R  A  F F           + TD Q ++++  Y  + +D 
Sbjct: 85  PNSYANKLSDARYREFAAAFNFNAPEK-----DVQTDAQEDELIGLYKQSFVDA 133


>gi|296535173|ref|ZP_06897395.1| hypothetical protein HMPREF0731_2877 [Roseomonas cervicalis ATCC
           49957]
 gi|296264501|gb|EFH10904.1| hypothetical protein HMPREF0731_2877 [Roseomonas cervicalis ATCC
           49957]
          Length = 256

 Score =  149 bits (377), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 78/218 (35%), Gaps = 6/218 (2%)

Query: 480 ENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQ 539
             ++  + ++ + +   +  I  ++D     I+   S EELL +      LLES G+  Q
Sbjct: 30  YKQTLKNEDKATERLSKDAAITRDLDRLQKAIDKAKSPEELLKDPTARRVLLESFGLAGQ 89

Query: 540 KVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHID 599
           +       +   +DL    +  +   +  +    ++ +F   G      + K++D     
Sbjct: 90  ENNVGLAVKALTADLSKDGNLPSRLTNKAWSAAATTLDFAKSG------LDKLRDPKVFA 143

Query: 600 DTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPY 659
           +    Y       +   +   +A AL+ +         Y ILGD  L +V      L   
Sbjct: 144 EIRANYIEYKRVDEVSAQSQPVADALHVRSMEDKTPGVYNILGDKILRRVALTLAGLPET 203

Query: 660 FAVLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAM 697
            A      + R L+K I +  F   +  E  +     M
Sbjct: 204 IAFQSIESQARQLEKRIDLKQFATPEGREKLIQRYLVM 241



 Score =  116 bits (290), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/199 (15%), Positives = 67/199 (33%), Gaps = 6/199 (3%)

Query: 15  QSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFI 74
           + K    +SKD  ++ +    ++ I    + +E +KD       L++FGL+   +     
Sbjct: 37  EDKATERLSKDAAITRDLDRLQKAIDKAKSPEELLKDPTARRVLLESFGLAGQENNVGLA 96

Query: 75  KKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSD-----IQHKTIIQDYKQS 129
            K L +DLS   +L ++L +  +   A + DF+        D           I+  +  
Sbjct: 97  VKALTADLSKDGNLPSRLTNKAWSAAATTLDFAKSGLDKLRDPKVFAEIRANYIEYKRVD 156

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLT- 188
               +   + ++ + R    K   V  +  D+ L    L    +                
Sbjct: 157 EVSAQSQPVADALHVRSMEDKTPGVYNILGDKILRRVALTLAGLPETIAFQSIESQARQL 216

Query: 189 LGLANPKKYFIESRDNRFR 207
               + K++       +  
Sbjct: 217 EKRIDLKQFATPEGREKLI 235



 Score = 56.4 bits (134), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 27/198 (13%), Positives = 61/198 (30%), Gaps = 13/198 (6%)

Query: 104 YDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALE---------ESKYFRKNIHKINSV 154
           + +      + S  +    I  YKQ+ +++++             +    +K I K  S 
Sbjct: 11  FGYGSDGGTVMSGSER---IGLYKQTLKNEDKATERLSKDAAITRDLDRLQKAIDKAKSP 67

Query: 155 DQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
           ++L KD      +L+SF +  +  ++      LT  L+          +  + A A    
Sbjct: 68  EELLKDPTARRVLLESFGLAGQENNVGLAVKALTADLSKDGNLPSRLTNKAWSAAATTLD 127

Query: 215 FQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVS-SFSDFLKD 273
           F   G    RD  +        +     + +           +  ++   +    + L D
Sbjct: 128 FAKSGLDKLRDPKVFAEIRANYIEYKRVDEVSAQSQPVADALHVRSMEDKTPGVYNILGD 187

Query: 274 PKLFKMLQLSLFPLNPEI 291
             L ++            
Sbjct: 188 KILRRVALTLAGLPETIA 205


>gi|23011439|ref|ZP_00051796.1| hypothetical protein Magn03006068 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 325

 Score =  149 bits (376), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/267 (19%), Positives = 98/267 (36%), Gaps = 22/267 (8%)

Query: 1   MIPSHVAP-FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYAL 59
           M  +  +    +KD+ + L    + DP+V+ E  YY   I  + ++D+ + D+RL++YA+
Sbjct: 1   MTDTLTSYRLIAKDLTASL-KRKAADPVVARETAYYEAHIGQVKSVDDLLGDQRLYAYAM 59

Query: 60  KAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSY----DFSPPPKVIQS 115
           KA+GL +M++A+ F++K+LE   +   S  N+L   +Y  FAR++     F+       +
Sbjct: 60  KAYGLEEMTYAKAFMRKVLEEGAASSASFANRLADDRYTAFARAFTFGQGFTATGADPTT 119

Query: 116 DIQHKTIIQDY-----KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
                             S+          +   R +     SV        L   V   
Sbjct: 120 FGSTARNAMLSAPLALADSYDFSGTAEASLTLESRIDAKTTQSVTIRLNAGILSRQVENL 179

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAE-----------NFRFQPDG 219
            ++TP  IS   +  +    L    +  + +  + F                      D 
Sbjct: 180 AAVTPTEISQAVMAQIDASPLKGRVQAGLAADGSLFFQTTALTDLGADGAAGGEGVNADT 239

Query: 220 SLSKRDKILTDMQIEKIVSNYFNNTID 246
            +     + T       +S      +D
Sbjct: 240 VVQAGGAVRTLTIRNAPLSTADRTAVD 266



 Score = 98.8 bits (244), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 46/124 (37%)

Query: 473 KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
                 +       +     +K  +  +  E  YY  +I  + S ++LL ++R+  + ++
Sbjct: 1   MTDTLTSYRLIAKDLTASLKRKAADPVVARETAYYEAHIGQVKSVDDLLGDQRLYAYAMK 60

Query: 533 SKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
           + G++     + F+ ++ +       SFAN   D+RY     +F F      +       
Sbjct: 61  AYGLEEMTYAKAFMRKVLEEGAASSASFANRLADDRYTAFARAFTFGQGFTATGADPTTF 120

Query: 593 QDNF 596
               
Sbjct: 121 GSTA 124



 Score = 96.8 bits (239), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 39/231 (16%), Positives = 79/231 (34%), Gaps = 29/231 (12%)

Query: 348 LHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDL 407
             D  +      Y+  +G++KS+D+LL  +                 +A+ AY L     
Sbjct: 23  AADPVVARETAYYEAHIGQVKSVDDLLGDQR-------------LYAYAMKAYGLEEMTY 69

Query: 408 DRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVK 467
            +  +R VL    +   S+AN+  DDR      AF F            Q       +  
Sbjct: 70  AKAFMRKVLEEGAASSASFANRLADDRYTAFARAFTFG-----------QGFTATGADPT 118

Query: 468 HYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL 527
            + +  R+   +   +       S     +L + S +D  T    TI     +L+ +++ 
Sbjct: 119 TFGSTARNAMLSAPLALADSYDFSGTAEASLTLESRIDAKTTQSVTIRLNAGILS-RQVE 177

Query: 528 NFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNF 578
           N       +   ++ +  + +I  S LK           + + +  +  + 
Sbjct: 178 NLA----AVTPTEISQAVMAQIDASPLKGRVQAGLAADGSLFFQTTALTDL 224


>gi|114800299|ref|YP_758998.1| putative flagellar protein [Hyphomonas neptunium ATCC 15444]
 gi|114740473|gb|ABI78598.1| putative flagellar protein [Hyphomonas neptunium ATCC 15444]
          Length = 282

 Score =  147 bits (371), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 33/232 (14%), Positives = 83/232 (35%), Gaps = 23/232 (9%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            + ++       + ++ ++ DY         S E+ L + R++   + +  +  ++ ++ 
Sbjct: 20  ATYDKQLESYTNSPQVRNDRDYMIEKFAQPISVEDFLKDSRLVRVTMTAFDLAGEEWKKG 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
           F+ +  +       +F     + +Y  + ++        L         D   I      
Sbjct: 80  FIKKTLEEVSDPESTFLARLNNPKYTALANA--------LKPVNDTISLDVDDIAAMAVR 131

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRN--------HYEILGDSKLFKVVSKKLKL 656
           ++    E    + D ++ L+L +K  I  I           Y ++ D   + VV   L L
Sbjct: 132 FESNSFEIAVGDVDDSMRLSLNYKSEINTIVGSGANEDSIAYRLMADIPAYTVVRSALNL 191

Query: 657 SPYFAVLPERKKIRILKKHI-------KINDFKDSKKVEDFLYAAKAMDHQS 701
               + LP  ++  ++K  +       K+++    + V+  +    AM   S
Sbjct: 192 PSDMSNLPVERQAEMIKDGLKKALGVSKLSEISSPEAVDKMIVRYHAMKSIS 243



 Score = 89.5 bits (220), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 37/182 (20%), Positives = 69/182 (37%), Gaps = 13/182 (7%)

Query: 16  SKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIK 75
            K   + +  P V  +  Y  E+     ++++F+KD RL    + AF L+     + FIK
Sbjct: 23  DKQLESYTNSPQVRNDRDYMIEKFAQPISVEDFLKDSRLVRVTMTAFDLAGEEWKKGFIK 82

Query: 76  KILESDLSDPKS-LVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKE 134
           K LE  +SDP+S  + +LN+ KY   A +         +  D      ++    S +   
Sbjct: 83  KTLEE-VSDPESTFLARLNNPKYTALANALKPVNDTISLDVDDIAAMAVRFESNSFEIAV 141

Query: 135 EVALEESKYFRKNIHKINS-----------VDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
               +  +       +IN+             +L  D      V  + ++     +LP  
Sbjct: 142 GDVDDSMRLSLNYKSEINTIVGSGANEDSIAYRLMADIPAYTVVRSALNLPSDMSNLPVE 201

Query: 184 KD 185
           + 
Sbjct: 202 RQ 203



 Score = 60.2 bits (144), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/183 (14%), Positives = 59/183 (32%), Gaps = 11/183 (6%)

Query: 120 KTIIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
           K +   Y +  +          +  Y  +   +  SV+   KD RL+   + +F +  + 
Sbjct: 16  KFLQATYDKQLESYTNSPQVRNDRDYMIEKFAQPISVEDFLKDSRLVRVTMTAFDLAGEE 75

Query: 178 ISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIV 237
               F+K  L         +     + ++ A+A   +   D      D I     +    
Sbjct: 76  WKKGFIKKTLEEVSDPESTFLARLNNPKYTALANALKPVNDTISLDVDDIAAMA-VRFES 134

Query: 238 SNYFNNTIDCVPIVSDQNYYKLAINSV--------SSFSDFLKDPKLFKMLQLSLFPLNP 289
           +++     D    +     YK  IN++        S     + D   + +++ +L   + 
Sbjct: 135 NSFEIAVGDVDDSMRLSLNYKSEINTIVGSGANEDSIAYRLMADIPAYTVVRSALNLPSD 194

Query: 290 EIT 292
              
Sbjct: 195 MSN 197


>gi|326402279|ref|YP_004282360.1| hypothetical protein ACMV_01310 [Acidiphilium multivorum AIU301]
 gi|325049140|dbj|BAJ79478.1| hypothetical protein ACMV_01310 [Acidiphilium multivorum AIU301]
          Length = 303

 Score =  145 bits (366), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/212 (19%), Positives = 90/212 (42%), Gaps = 8/212 (3%)

Query: 492 TQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
             +  + ++  ++  +T  +N+  + ++LL N  +L  LL + G+ SQ        +   
Sbjct: 75  QAEAKSPQVQRDIAAFTKAVNSAKTAKQLLQNPTVLKVLLTANGLGSQVGFPALAQKALL 134

Query: 552 SDLKDPKSFANTYK--DNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
           S+  DP   AN     ++++      + F   G      +  +Q    I    + Y   +
Sbjct: 135 SNPSDPNGLANQLSSTNSQWLSTAQIYQFATKG------LSIIQKPSSISTLTNAYAEVL 188

Query: 610 IEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKI 669
             +  +++ P ++ ALYF +      N  +ILGDS +  VV+  L +    A  P   + 
Sbjct: 189 WRQSLDKQTPGLSNALYFIQNAQKFTNATQILGDSVMRSVVTTALGVPQQIAFQPLLAQE 248

Query: 670 RILKKHIKINDFKDSKKVEDFLYAAKAMDHQS 701
           + +   + ++ F++ + V+ F     A+   S
Sbjct: 249 QAITSRLDVSKFQNKQFVQSFADRFLAVTQAS 280



 Score =  127 bits (318), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 89/234 (38%), Gaps = 19/234 (8%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KDIQ++     +K P V  +   + + +    T  + +++  +    L A GL      
Sbjct: 71  TKDIQAE-----AKSPQVQRDIAAFTKAVNSAKTAKQLLQNPTVLKVLLTANGLGSQVGF 125

Query: 71  EKFIKKILESDLSDPKSLVNQL--NSLKYQYFARSYDFSPPP-KVIQSDIQHKTIIQDYK 127
               +K L S+ SDP  L NQL   + ++   A+ Y F+     +IQ      T+   Y 
Sbjct: 126 PALAQKALLSNPSDPNGLANQLSSTNSQWLSTAQIYQFATKGLSIIQKPSSISTLTNAYA 185

Query: 128 QSHQHKEEVALE----ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
           +    +           + YF +N  K  +  Q+  D  +   V  +  +  +    P L
Sbjct: 186 EVLWRQSLDKQTPGLSNALYFIQNAQKFTNATQILGDSVMRSVVTTALGVPQQIAFQPLL 245

Query: 184 --KDVLTLGLANPKKYFI----ESRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
             +  +T  L +  K+      +S  +RF A+ +       GS S    +    
Sbjct: 246 AQEQAITSRL-DVSKFQNKQFVQSFADRFLAVTQASNMNAYGSSSSLVGLAAQA 298



 Score = 54.8 bits (130), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 39/292 (13%), Positives = 83/292 (28%), Gaps = 48/292 (16%)

Query: 322 NSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSL------IKDYQLPLGKIKSIDNLLS 375
             +++     SQ   +     +  +                I  +   +   K+   LL 
Sbjct: 46  GGATSGTVTSSQNPIIALRIAQQNETKDIQAEAKSPQVQRDIAAFTKAVNSAKTAKQLLQ 105

Query: 376 GKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKS--KDD 433
                            L+  L A  L  Q       +  L SNPSDP+  AN+    + 
Sbjct: 106 N-------------PTVLKVLLTANGLGSQVGFPALAQKALLSNPSDPNGLANQLSSTNS 152

Query: 434 RLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQ 493
           + +     + F   G                  +                   +    + 
Sbjct: 153 QWLSTAQIYQFATKGLSIIQKPSSISTLTNAYAE-------------------VLWRQSL 193

Query: 494 KRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL--CEIFK 551
            +    +++ + Y+  N     +  ++L +  + + +  + G+  Q   +  L   +   
Sbjct: 194 DKQTPGLSNAL-YFIQNAQKFTNATQILGDSVMRSVVTTALGVPQQIAFQPLLAQEQAIT 252

Query: 552 SDLK----DPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHID 599
           S L       K F  ++ D R+  +  + N + +G  S       Q    I 
Sbjct: 253 SRLDVSKFQNKQFVQSFAD-RFLAVTQASNMNAYGSSSSLVGLAAQARSLIA 303


>gi|162147451|ref|YP_001601912.1| hypothetical protein GDI_1667 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545560|ref|YP_002277789.1| hypothetical protein Gdia_3449 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786028|emb|CAP55610.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209533237|gb|ACI53174.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 281

 Score =  145 bits (365), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 41/250 (16%), Positives = 89/250 (35%), Gaps = 17/250 (6%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL--ANKRILNFLLESKGIDSQKVR 542
           +     +   + N  I +EV  +  + ++I S  +L+   N      +L +  + S    
Sbjct: 20  DEETAAANYTKENPTIQNEVTSFEESASSITSAADLMSNKNYTAEQVVLGAYNLSSISGE 79

Query: 543 EDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTC 602
              + ++   D    KS A +  +  +     +F+    G+           +  I    
Sbjct: 80  TALVKDLLTQDPTSSKSVAKSSGNATWLAFADAFS--TWGQNGGSASASPFTSDTISSIV 137

Query: 603 DLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL-SPYFA 661
             ++    E     ++  +  ALYF R + +  +  +I+ ++ L KVV          F 
Sbjct: 138 TKFEESQYESSTANQNSGVGNALYFTRNMTSSMSLADIMSNATLLKVVETVSGFNPDQFG 197

Query: 662 VLPERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNN 721
            L   +++R+L+  + ++DF   + V+ +     AM   +          P     P   
Sbjct: 198 ALDYPEQVRLLQNKVDLSDFSTPEGVQKYAEQYLAMLQIN----------PQTPDTPITM 247

Query: 722 --SFDDPQNN 729
              F    N+
Sbjct: 248 MDLFGGGTNS 257



 Score = 84.5 bits (207), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 66/178 (37%), Gaps = 7/178 (3%)

Query: 128 QSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLL--DYVLQSFSITPKYISLPFLKD 185
            ++  +      E   F ++   I S   L  ++       VL +++++        +KD
Sbjct: 26  ANYTKENPTIQNEVTSFEESASSITSAADLMSNKNYTAEQVVLGAYNLSSISGETALVKD 85

Query: 186 VLTLGLANPKKYFIESRDNRFRAMAENFR-FQPDGSLSKRDKILTDMQIEKIV----SNY 240
           +LT    + K     S +  + A A+ F  +  +G  +      +D     +     S Y
Sbjct: 86  LLTQDPTSSKSVAKSSGNATWLAFADAFSTWGQNGGSASASPFTSDTISSIVTKFEESQY 145

Query: 241 FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLT 298
            ++T +    V +  Y+   + S  S +D + +  L K+++        +  A  +  
Sbjct: 146 ESSTANQNSGVGNALYFTRNMTSSMSLADIMSNATLLKVVETVSGFNPDQFGALDYPE 203



 Score = 78.7 bits (192), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 31/210 (14%), Positives = 75/210 (35%), Gaps = 13/210 (6%)

Query: 12  KDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFI--KDKRLFSYALKAFGLSDMSH 69
           KD ++   +   ++P +  E   + E    I++  + +  K+       L A+ LS +S 
Sbjct: 19  KDEETAAANYTKENPTIQNEVTSFEESASSITSAADLMSNKNYTAEQVVLGAYNLSSISG 78

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSY-----DFSPPPKVIQSDIQHKTIIQ 124
               +K +L  D +  KS+     +  +  FA ++     +         +     +I+ 
Sbjct: 79  ETALVKDLLTQDPTSSKSVAKSSGNATWLAFADAFSTWGQNGGSASASPFTSDTISSIVT 138

Query: 125 DYKQSHQHKEEVALEE----SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSI-TPKYIS 179
            +++S               + YF +N+    S+  +  +  LL  V         ++ +
Sbjct: 139 KFEESQYESSTANQNSGVGNALYFTRNMTSSMSLADIMSNATLLKVVETVSGFNPDQFGA 198

Query: 180 LPFLKDV-LTLGLANPKKYFIESRDNRFRA 208
           L + + V L     +   +       ++  
Sbjct: 199 LDYPEQVRLLQNKVDLSDFSTPEGVQKYAE 228


>gi|58038542|ref|YP_190506.1| hypothetical protein GOX0053 [Gluconobacter oxydans 621H]
 gi|58000956|gb|AAW59850.1| Hypothetical protein GOX0053 [Gluconobacter oxydans 621H]
          Length = 273

 Score =  143 bits (361), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 40/249 (16%), Positives = 88/249 (35%), Gaps = 17/249 (6%)

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
           +     +  ++ ++     V  +  +  +I + E+LL N + L  +L + G+ S   +  
Sbjct: 20  DEDSSANKWEKTSVSAQQAVTAFQKDAASIKTPEQLLKNYKALTVVLGAYGMSSVIGQTA 79

Query: 545 FLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDL 604
            L ++   D    KS A T  ++ +K   ++F+      L+            +      
Sbjct: 80  VLKDLMTQDPTSSKSLAQTSGNSAWKAFANAFSDWSTSPLASSDT--------VQSITQS 131

Query: 605 YKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL-SPYFAVL 663
           Y     E   + + P +  ALYF RT         ++ D KL KV        +  F  L
Sbjct: 132 YLTNSYEDSLQTETPGLGDALYFTRTATTDMTLANVMADPKLLKVAEVVSGFDTTQFGAL 191

Query: 664 PERKKIRILKKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPNQNKDPWNNSF 723
              +++R+L   + ++     + ++ F     A+               +         +
Sbjct: 192 DYDQQVRLLGSKLDMSKLSTKQGIQQFAQQYLALLQIH--------PVTSTTPASMLTLY 243

Query: 724 DDPQNNVSL 732
               ++ S+
Sbjct: 244 GGSGSSTSI 252



 Score = 79.9 bits (195), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 33/166 (19%), Positives = 69/166 (41%), Gaps = 1/166 (0%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
           +     A +    F+K+   I + +QL K+ + L  VL ++ ++        LKD++T  
Sbjct: 29  EKTSVSAQQAVTAFQKDAASIKTPEQLLKNYKALTVVLGAYGMSSVIGQTAVLKDLMTQD 88

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPI 250
             + K     S ++ ++A A  F       L+  D + +  Q     S Y ++     P 
Sbjct: 89  PTSSKSLAQTSGNSAWKAFANAFSDWSTSPLASSDTVQSITQSYLTNS-YEDSLQTETPG 147

Query: 251 VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKF 296
           + D  Y+     +  + ++ + DPKL K+ ++       +  A  +
Sbjct: 148 LGDALYFTRTATTDMTLANVMADPKLLKVAEVVSGFDTTQFGALDY 193



 Score = 79.5 bits (194), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 30/181 (16%), Positives = 67/181 (37%), Gaps = 7/181 (3%)

Query: 2   IPSHVAPFPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKA 61
           IP +V+    +D  +  +   S           +++    I T ++ +K+ +  +  L A
Sbjct: 11  IPQYVSIIKDEDSSANKWEKTSVSA--QQAVTAFQKDAASIKTPEQLLKNYKALTVVLGA 68

Query: 62  FGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDI---- 117
           +G+S +      +K ++  D +  KSL     +  ++ FA ++       +  SD     
Sbjct: 69  YGMSSVIGQTAVLKDLMTQDPTSSKSLAQTSGNSAWKAFANAFSDWSTSPLASSDTVQSI 128

Query: 118 QHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
               +   Y+ S Q +    L ++ YF +      ++  +  D +LL             
Sbjct: 129 TQSYLTNSYEDSLQTETPG-LGDALYFTRTATTDMTLANVMADPKLLKVAEVVSGFDTTQ 187

Query: 178 I 178
            
Sbjct: 188 F 188


>gi|148259125|ref|YP_001233252.1| hypothetical protein Acry_0105 [Acidiphilium cryptum JF-5]
 gi|146400806|gb|ABQ29333.1| protein of unknown function DUF1217 [Acidiphilium cryptum JF-5]
          Length = 290

 Score =  143 bits (359), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/212 (19%), Positives = 90/212 (42%), Gaps = 8/212 (3%)

Query: 492 TQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFK 551
             +  + ++  ++  +T  +N+  + ++LL N  +L  LL + G+ SQ        +   
Sbjct: 62  QAEAKSPQVQRDIAAFTKAVNSAKTAKQLLQNPTVLKVLLTANGLGSQVGFPALAQKALL 121

Query: 552 SDLKDPKSFANTYK--DNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
           S+  DP   AN     ++++      + F   G      +  +Q    I    + Y   +
Sbjct: 122 SNPSDPNGLANQLSSTNSQWLSTAQIYQFATKG------LSIIQKPSSISTLTNAYAEVL 175

Query: 610 IEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKI 669
             +  +++ P ++ ALYF +      N  +ILGDS +  VV+  L +    A  P   + 
Sbjct: 176 WRQSLDKQTPGLSNALYFIQNAQKFTNATQILGDSVMRSVVTTALGVPQQIAFQPLLAQE 235

Query: 670 RILKKHIKINDFKDSKKVEDFLYAAKAMDHQS 701
           + +   + ++ F++ + V+ F     A+   S
Sbjct: 236 QAITSRLDVSKFQNKQFVQSFADRFLAVTQAS 267



 Score =  124 bits (311), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 48/234 (20%), Positives = 89/234 (38%), Gaps = 19/234 (8%)

Query: 11  SKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHA 70
           +KDIQ++     +K P V  +   + + +    T  + +++  +    L A GL      
Sbjct: 58  TKDIQAE-----AKSPQVQRDIAAFTKAVNSAKTAKQLLQNPTVLKVLLTANGLGSQVGF 112

Query: 71  EKFIKKILESDLSDPKSLVNQL--NSLKYQYFARSYDFSPPP-KVIQSDIQHKTIIQDYK 127
               +K L S+ SDP  L NQL   + ++   A+ Y F+     +IQ      T+   Y 
Sbjct: 113 PALAQKALLSNPSDPNGLANQLSSTNSQWLSTAQIYQFATKGLSIIQKPSSISTLTNAYA 172

Query: 128 QSHQHKEEVALE----ESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
           +    +           + YF +N  K  +  Q+  D  +   V  +  +  +    P L
Sbjct: 173 EVLWRQSLDKQTPGLSNALYFIQNAQKFTNATQILGDSVMRSVVTTALGVPQQIAFQPLL 232

Query: 184 --KDVLTLGLANPKKYFI----ESRDNRFRAMAENFRFQPDGSLSKRDKILTDM 231
             +  +T  L +  K+      +S  +RF A+ +       GS S    +    
Sbjct: 233 AQEQAITSRL-DVSKFQNKQFVQSFADRFLAVTQASNMNAYGSSSSLVGLAAQA 285



 Score = 52.9 bits (125), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 39/292 (13%), Positives = 83/292 (28%), Gaps = 48/292 (16%)

Query: 322 NSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSL------IKDYQLPLGKIKSIDNLLS 375
             +++     SQ   +     +  +                I  +   +   K+   LL 
Sbjct: 33  GGATSGTVTSSQNPIIALRIAQQNETKDIQAEAKSPQVQRDIAAFTKAVNSAKTAKQLLQ 92

Query: 376 GKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKS--KDD 433
                            L+  L A  L  Q       +  L SNPSDP+  AN+    + 
Sbjct: 93  N-------------PTVLKVLLTANGLGSQVGFPALAQKALLSNPSDPNGLANQLSSTNS 139

Query: 434 RLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQ 493
           + +     + F   G                  +                   +    + 
Sbjct: 140 QWLSTAQIYQFATKGLSIIQKPSSISTLTNAYAE-------------------VLWRQSL 180

Query: 494 KRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL--CEIFK 551
            +    +++ + Y+  N     +  ++L +  + + +  + G+  Q   +  L   +   
Sbjct: 181 DKQTPGLSNAL-YFIQNAQKFTNATQILGDSVMRSVVTTALGVPQQIAFQPLLAQEQAIT 239

Query: 552 SDLK----DPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHID 599
           S L       K F  ++ D R+  +  + N + +G  S       Q    I 
Sbjct: 240 SRLDVSKFQNKQFVQSFAD-RFLAVTQASNMNAYGSSSSLVGLAAQARSLIA 290


>gi|218512422|ref|ZP_03509262.1| hypothetical protein Retl8_01379 [Rhizobium etli 8C-3]
          Length = 249

 Score =  134 bits (336), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 42/236 (17%), Positives = 83/236 (35%), Gaps = 12/236 (5%)

Query: 242 NNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLM 300
             T   +   +  + Y   + ++++  + + DP +   L+ +         A+ K +   
Sbjct: 1   QTTNTKIAAGARTDDYSSRMATIANVDELIADPAITNFLKSTYNLPFDISDAELKSILTD 60

Query: 301 QENDPIVSQVKYFFQINFHRDNSSS--TKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK 358
                           NF  D S    + +Q   Q Q   D Y        D+ ++ +  
Sbjct: 61  ATAAAAAGHADLNADFNFAADGSLPAVSSVQTADQAQTTNDNYMARYDDERDEAIEEVAD 120

Query: 359 DYQLPLGKIKS---------IDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDR 409
           +Y   +    S         +++ L      +   S ++       AL A+ L  Q++ R
Sbjct: 121 NYSSMMADSTSLLDTAEIKTVNDFLRTNAAADFKKSNDKLPDPYHVALQAFGLTDQEVPR 180

Query: 410 DQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
             +R +LTS+  DP+ Y    KD+R+  L  AF   A  +        +R  +   
Sbjct: 181 SMMRKILTSDAYDPNGYIASLKDERITNLARAFQLRAPTARPQHLCGAARRDLGQI 236



 Score = 81.8 bits (200), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 73/225 (32%), Gaps = 16/225 (7%)

Query: 361 QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP 420
              +      D+  S    +   +          F    YNL   D+   +L+++LT   
Sbjct: 4   NTKIAAGARTDDYSSRMATIANVDELIADPAITNFLKSTYNL-PFDISDAELKSILTDAT 62

Query: 421 SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE 480
           +                LN  FNF ADGS+  +  +Q+    +    +Y  R     D  
Sbjct: 63  AAAA--------AGHADLNADFNFAADGSLPAVSSVQTADQAQTTNDNYMARYDDERDEA 114

Query: 481 NKSFNSMEQISTQKRINLEINSEVDY-----YTLNINTIHSFEELLANKRILNFLLESKG 535
            +              +L   +E+        T          + L +    +  L++ G
Sbjct: 115 IEEVADNYSSMMADSTSLLDTAEIKTVNDFLRTNAAADFKKSNDKLPDP--YHVALQAFG 172

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
           +  Q+V    + +I  SD  DP  +  + KD R   +  +F    
Sbjct: 173 LTDQEVPRSMMRKILTSDAYDPNGYIASLKDERITNLARAFQLRA 217



 Score = 79.1 bits (193), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 43/214 (20%), Positives = 81/214 (37%), Gaps = 31/214 (14%)

Query: 32  ERYYRERIKHISTIDEFIKDKRLFSYALKAFGLS-DMSHAEKFIKKILESDLSDPKSLVN 90
              Y  R+  I+ +DE I D  + ++    + L  D+S AE      L+S L+D  +   
Sbjct: 13  TDDYSSRMATIANVDELIADPAITNFLKSTYNLPFDISDAE------LKSILTDATAAAA 66

Query: 91  QLNSLKYQYFARSYDFS-PPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEES--KYFRKN 147
             ++     F  + D S P    +Q+  Q +T   +Y   +  + + A+EE    Y    
Sbjct: 67  AGHADLNADFNFAADGSLPAVSSVQTADQAQTTNDNYMARYDDERDEAIEEVADNYSSMM 126

Query: 148 IHK--------INSVDQLFKDRRLLD-------------YVLQSFSITPKYISLPFLKDV 186
                      I +V+   +     D               LQ+F +T + +    ++ +
Sbjct: 127 ADSTSLLDTAEIKTVNDFLRTNAAADFKKSNDKLPDPYHVALQAFGLTDQEVPRSMMRKI 186

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGS 220
           LT    +P  Y    +D R   +A  F+ +   +
Sbjct: 187 LTSDAYDPNGYIASLKDERITNLARAFQLRAPTA 220



 Score = 63.3 bits (152), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 13/88 (14%)

Query: 40  KHISTIDEFI----------KDKRL---FSYALKAFGLSDMSHAEKFIKKILESDLSDPK 86
             I T+++F+           + +L   +  AL+AFGL+D       ++KIL SD  DP 
Sbjct: 136 AEIKTVNDFLRTNAAADFKKSNDKLPDPYHVALQAFGLTDQEVPRSMMRKILTSDAYDPN 195

Query: 87  SLVNQLNSLKYQYFARSYDFSPPPKVIQ 114
             +  L   +    AR++    P    Q
Sbjct: 196 GYIASLKDERITNLARAFQLRAPTARPQ 223



 Score = 55.6 bits (132), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 51/149 (34%), Gaps = 11/149 (7%)

Query: 136 VALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPK 195
            A   +  +   +  I +VD+L  D  + +++  ++++     S   LK +LT       
Sbjct: 8   AAGARTDDYSSRMATIANVDELIADPAITNFLKSTYNLPFDI-SDAELKSILTD------ 60

Query: 196 KYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI--DCVPIVSD 253
                +       +  +F F  DGSL     + T  Q +    NY           I   
Sbjct: 61  --ATAAAAAGHADLNADFNFAADGSLPAVSSVQTADQAQTTNDNYMARYDDERDEAIEEV 118

Query: 254 QNYYKLAINSVSSFSDFLKDPKLFKMLQL 282
            + Y   +   +S  D  +   +   L+ 
Sbjct: 119 ADNYSSMMADSTSLLDTAEIKTVNDFLRT 147



 Score = 40.6 bits (93), Expect = 1.1,   Method: Composition-based stats.
 Identities = 25/144 (17%), Positives = 54/144 (37%), Gaps = 14/144 (9%)

Query: 496 INLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLK 555
             +   +  D Y+  + TI + +EL+A+  I NFL  +  +    + +  L  I      
Sbjct: 5   TKIAAGARTDDYSSRMATIANVDELIADPAITNFLKSTYNL-PFDISDAELKSILTDATA 63

Query: 556 DPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEE 615
                        + ++ + FNF   G L    +  VQ       T D Y  +  ++++E
Sbjct: 64  AAA--------AGHADLNADFNFAADGSL--PAVSSVQTADQAQTTNDNYMARYDDERDE 113

Query: 616 EKDPNIALALYFKRTIPNIRNHYE 639
             +    +A  +   + +  +  +
Sbjct: 114 AIEE---VADNYSSMMADSTSLLD 134


>gi|163797864|ref|ZP_02191808.1| hypothetical protein BAL199_20070 [alpha proteobacterium BAL199]
 gi|159176826|gb|EDP61394.1| hypothetical protein BAL199_20070 [alpha proteobacterium BAL199]
          Length = 829

 Score =  131 bits (330), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 50/350 (14%), Positives = 125/350 (35%), Gaps = 21/350 (6%)

Query: 10  PSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
             +D Q    +  ++   V  +   +++ +  +ST+D+ +KD+R  S+ L AFGL    +
Sbjct: 32  YQRD-QVAARTAFAEREDVVRKIDAFKKSVGKLSTVDDLLKDRRTLSFVLSAFGLESEVN 90

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFAR-----SYDF-SPPPKVIQSDIQHKTII 123
               +K +L SD  D  S  N+L+  ++   A      ++   +      QS +  K + 
Sbjct: 91  NPGKLKAVLNSDPDDINSFANRLSDSRFGELAAFVSAPAFGLKNLTVSDKQSQLIDKFLT 150

Query: 124 QDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFL 183
             ++QS   +   A  ++ +F + I+ + +   +  D  L   V  + ++  +       
Sbjct: 151 NGFEQSLAAQN-PAARDALFFLRRINSVENTFDILGDLPLRSIVTTALNLPAEIARQSVD 209

Query: 184 KD-VLTLGLANPKKYFIESRDNRFRAMAENFRFQ------PDGSLSKRDKILTD--MQIE 234
           K   L         +   S  N  R+  +  +         + +++   K+      ++E
Sbjct: 210 KQAALIEAKFKLDSFKTSSSSNTSRSRLDILQDDLTSISTTNKTINAGLKVADSLVAKLE 269

Query: 235 KIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSF----SDFLKDPKLFKMLQLSLFPLNPE 290
            + + Y +      P   + N   +   ++       +         +  + ++  L   
Sbjct: 270 SLRTAYTDYDTFVNPAGVNANEITIQQAAIPDLLRQRTLVASANAAVQDTRSAITELEKL 329

Query: 291 ITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL 340
            +  +  +  ++   I ++           D   ++    D       +L
Sbjct: 330 FSQARNASSEEDFTEIQAKFTALADTVLGDDGLINSATFTDPNTGLTQNL 379


>gi|218662936|ref|ZP_03518866.1| CTP synthetase [Rhizobium etli IE4771]
          Length = 391

 Score =  129 bits (325), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 11/101 (10%)

Query: 620 NIALA-------LYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPERKKIRIL 672
            + +A       LYF+R  P I + Y+ILGDS LF+  +    LS Y + +   K+  ++
Sbjct: 270 GMQMAVIEAARNLYFERKAPEISSAYDILGDSALFEFFTTSFNLSSYVSNMDVEKQAEMV 329

Query: 673 KKHIKINDFKDSKKVEDFLYAAKAMDHQSIDYKKALFSSPN 713
           +  I I D  D  KV+D +    AM     D      ++  
Sbjct: 330 ENFIDIKDLSDPDKVDDLIKRFTAM----YDMANGTGTTST 366



 Score = 49.5 bits (116), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/121 (11%), Positives = 39/121 (32%), Gaps = 19/121 (15%)

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKD-------VLTLGLANP 194
            YF +   +I+S   +  D  L ++   SF+++    ++   K        +    L++P
Sbjct: 282 LYFERKAPEISSAYDILGDSALFEFFTTSFNLSSYVSNMDVEKQAEMVENFIDIKDLSDP 341

Query: 195 KKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQ 254
            K      D+  +     +               T   +  +  +   +    + +   +
Sbjct: 342 DKV-----DDLIKRFTAMYD-------MANGTGTTSTALSILTGSAAISADTLLAVAQLK 389

Query: 255 N 255
           +
Sbjct: 390 S 390



 Score = 41.7 bits (96), Expect = 0.42,   Method: Composition-based stats.
 Identities = 18/110 (16%), Positives = 33/110 (30%), Gaps = 12/110 (10%)

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCE-------IFKSDLKDPK 558
           Y+      I S  ++L +  +  F   S  + S     D   +       I   DL DP 
Sbjct: 283 YFERKAPEISSAYDILGDSALFEFFTTSFNLSSYVSNMDVEKQAEMVENFIDIKDLSDPD 342

Query: 559 SFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQ 608
                  D+  K   + ++       +   +  +  +  I     L   Q
Sbjct: 343 KV-----DDLIKRFTAMYDMANGTGTTSTALSILTGSAAISADTLLAVAQ 387


>gi|218677561|ref|ZP_03525458.1| hypothetical protein RetlC8_01365 [Rhizobium etli CIAT 894]
          Length = 251

 Score =  121 bits (304), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 85/243 (34%), Gaps = 24/243 (9%)

Query: 131 QHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
                 A + + Y++  I  I++VDQL  D RL ++V  +F I P  ++   L+ +LT  
Sbjct: 29  ASTAGKADDAAVYYQATIAGISNVDQLLTDSRLNNFVRNAFGI-PSTVTDVNLRAILTD- 86

Query: 191 LANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPI 250
                    +S    +  +A  F F+ DG+L       T  QI                 
Sbjct: 87  ---------QSGTGTYADVAAAFNFKADGTLKDGMAAQTATQIRDTKF----------AA 127

Query: 251 VSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQ 309
            +  + Y   ++++ +  D L D  +   L+ +         AD K +            
Sbjct: 128 STRTDDYSARMSTIGNVDDLLADDAITNFLKSTYNLPTGISNADLKSILTDATAAAAAGH 187

Query: 310 VKYFFQINFHRDNSSS--TKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKI 367
                  NF  D S    + +Q   Q Q   D Y        D+ +  +  +Y   +   
Sbjct: 188 ADLNADFNFAADGSLPVVSSVQTADQAQTTNDNYMARYDDERDEAIDEVASNYSKMMADS 247

Query: 368 KSI 370
            S+
Sbjct: 248 SSL 250



 Score = 74.9 bits (182), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 33/182 (18%), Positives = 55/182 (30%), Gaps = 28/182 (15%)

Query: 484 FNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRE 543
           F    ++        + +    YY   I  I + ++LL + R+ NF+  + GI    V +
Sbjct: 19  FTPPRRLRKSASTAGKADDAAVYYQATIAGISNVDQLLTDSRLNNFVRNAFGI-PSTVTD 77

Query: 544 DFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
             L  I                   Y ++ ++FNF   G L  K     Q    I DT  
Sbjct: 78  VNLRAILTD----------QSGTGTYADVAAAFNFKADGTL--KDGMAAQTATQIRDTKF 125

Query: 604 LYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVL 663
                           +     Y  R    I N  ++L D  +   +     L    +  
Sbjct: 126 A--------------ASTRTDDYSARM-STIGNVDDLLADDAITNFLKSTYNLPTGISNA 170

Query: 664 PE 665
             
Sbjct: 171 DL 172



 Score = 73.3 bits (178), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 43/240 (17%), Positives = 83/240 (34%), Gaps = 26/240 (10%)

Query: 15  QSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFI 74
             +L  + S          YY+  I  IS +D+ + D RL ++   AFG+          
Sbjct: 22  PRRLRKSASTAGKADDAAVYYQATIAGISNVDQLLTDSRLNNFVRNAFGIPSTV------ 75

Query: 75  KKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKE 134
                +D++    L +Q  +  Y   A +++F     +         +        +  +
Sbjct: 76  -----TDVNLRAILTDQSGTGTYADVAAAFNFKADGTL------KDGMAAQTATQIRDTK 124

Query: 135 EVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANP 194
             A   +  +   +  I +VD L  D  + +++  ++++     S   LK +LT      
Sbjct: 125 FAASTRTDDYSARMSTIGNVDDLLADDAITNFLKSTYNLPTGI-SNADLKSILTD----- 178

Query: 195 KKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQ 254
                 +       +  +F F  DGSL     + T  Q +    NY     D      D+
Sbjct: 179 ---ATAAAAAGHADLNADFNFAADGSLPVVSSVQTADQAQTTNDNYMARYDDERDEAIDE 235



 Score = 67.6 bits (163), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 40/257 (15%), Positives = 73/257 (28%), Gaps = 37/257 (14%)

Query: 243 NTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQE 302
           +            YY+  I  +S+    L D +L   ++ +       +T      ++ +
Sbjct: 28  SASTAGKADDAAVYYQATIAGISNVDQLLTDSRLNNFVRNAFGIP-STVTDVNLRAILTD 86

Query: 303 NDPIVSQVKYFFQINFHRDNS--SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDY 360
                +        NF  D +       Q  +QI+                        Y
Sbjct: 87  QSGTGTYADVAAAFNFKADGTLKDGMAAQTATQIRDTKFAASTRTDD------------Y 134

Query: 361 QLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNP 420
              +  I ++D+LL+                   F    YNL    +    L+++LT   
Sbjct: 135 SARMSTIGNVDDLLADDAIT-------------NFLKSTYNL-PTGISNADLKSILTDAT 180

Query: 421 SDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE 480
           +                LN  FNF ADGS+  +  +Q+    +    +Y  R     D  
Sbjct: 181 AAAA--------AGHADLNADFNFAADGSLPVVSSVQTADQAQTTNDNYMARYDDERDEA 232

Query: 481 NKSFNSMEQISTQKRIN 497
                S          +
Sbjct: 233 IDEVASNYSKMMADSSS 249



 Score = 55.6 bits (132), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 50/276 (18%), Positives = 86/276 (31%), Gaps = 66/276 (23%)

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLN 403
                   K       YQ  +  I ++D LL+                   F  +A+ + 
Sbjct: 26  RKSASTAGKADDAAVYYQATIAGISNVDQLLTDSRLN-------------NFVRNAFGI- 71

Query: 404 MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIR 463
              +    LR +LT           +S       +  AFNF ADG++      Q+   IR
Sbjct: 72  PSTVTDVNLRAILTD----------QSGTGTYADVAAAFNFKADGTLKDGMAAQTATQIR 121

Query: 464 DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
           D                                    ++  D Y+  ++TI + ++LLA+
Sbjct: 122 DT-------------------------------KFAASTRTDDYSARMSTIGNVDDLLAD 150

Query: 524 KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
             I NFL  +  +    +    L  I                   + ++ + FNF   G 
Sbjct: 151 DAITNFLKSTYNL-PTGISNADLKSILTDATAAAA--------AGHADLNADFNFAADGS 201

Query: 584 LSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDP 619
           L    +  VQ       T D Y  +  ++++E  D 
Sbjct: 202 L--PVVSSVQTADQAQTTNDNYMARYDDERDEAIDE 235


>gi|218679039|ref|ZP_03526936.1| hypothetical protein RetlC8_09234 [Rhizobium etli CIAT 894]
          Length = 264

 Score =  111 bits (277), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/239 (14%), Positives = 78/239 (32%), Gaps = 40/239 (16%)

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNT-------- 244
           +P         ++++A+A  F F  DG+++      T  Q   ++  Y  N+        
Sbjct: 1   DPSSVVNTQGGDKYKALAAQFSFNADGTVT--GTAQTAAQKASVIETYTLNSQSVIIDNS 58

Query: 245 -------IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFP-LNPEITADKF 296
                  +       ++ YY   I ++++  D + D +L   +  +     +    A + 
Sbjct: 59  VGSDVYYVGATAAEYNKAYYTAKIGTITNVDDLVADKRLTSYITTAYSMGADFTAAALRT 118

Query: 297 LTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSL 356
           +        ++     +   NF  D S+S+  +  S  Q          ++       + 
Sbjct: 119 VLTDPGYAQLMGFTNVYNAFNFKADGSTSSTARVQSVDQA--------NKLKSAASSTTN 170

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNV 415
                     I ++D+LL+                  ++  DAY L         L+N+
Sbjct: 171 YYSVTSQSSAITNVDDLLADSVMA-------------RYIKDAYGLG-TSFSNADLKNI 215



 Score =  111 bits (277), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 46/257 (17%), Positives = 88/257 (34%), Gaps = 36/257 (14%)

Query: 422 DPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAEN 481
           DP S  N    D+   L   F+FNADG++      Q+       ++ Y    +S+    +
Sbjct: 1   DPSSVVNTQGGDKYKALAAQFSFNADGTVTG--TAQTAAQKASVIETYTLNSQSVIIDNS 58

Query: 482 KSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKV 541
              +     +T    N        YYT  I TI + ++L+A+KR+ +++  +       +
Sbjct: 59  VGSDVYYVGATAAEYNKA------YYTAKIGTITNVDDLVADKRLTSYITTAY-----SM 107

Query: 542 REDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDT 601
             DF     ++ L DP  +A       +  + ++FNF   G  S     +  D  +   +
Sbjct: 108 GADFTAAALRTVLTDPG-YAQLMG---FTNVYNAFNFKADGSTSSTARVQSVDQANKLKS 163

Query: 602 CDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFA 661
                                           I N  ++L DS + + +     L   F+
Sbjct: 164 AASSTTNYY---------------SVTSQSSAITNVDDLLADSVMARYIKDAYGLGTSFS 208

Query: 662 VLPERKKIRILKKHIKI 678
                   + +     +
Sbjct: 209 NADL----KNIPDRFDL 221



 Score =  103 bits (257), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 85/228 (37%), Gaps = 34/228 (14%)

Query: 84  DPKSLVNQLNSLKYQYFARSYDFSPPPK---VIQSDIQHKTIIQDYKQSHQHK------- 133
           DP S+VN     KY+  A  + F+         Q+  Q  ++I+ Y  + Q         
Sbjct: 1   DPSSVVNTQGGDKYKALAAQFSFNADGTVTGTAQTAAQKASVIETYTLNSQSVIIDNSVG 60

Query: 134 -------EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
                     A     Y+   I  I +VD L  D+RL  Y+  ++S+   + +   L+ V
Sbjct: 61  SDVYYVGATAAEYNKAYYTAKIGTITNVDDLVADKRLTSYITTAYSMGADFTAAA-LRTV 119

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID 246
           LT    +P    +    N +      F F+ DGS S   ++ +  Q  K+ S        
Sbjct: 120 LT----DPGYAQLMGFTNVY----NAFNFKADGSTSSTARVQSVDQANKLKSA------- 164

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD 294
                ++        +++++  D L D  + + ++ +         AD
Sbjct: 165 -ASSTTNYYSVTSQSSAITNVDDLLADSVMARYIKDAYGLGTSFSNAD 211



 Score = 69.9 bits (169), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/152 (16%), Positives = 51/152 (33%), Gaps = 17/152 (11%)

Query: 33  RYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQL 92
            YY  +I  I+ +D+ + DKRL SY   A+ +     A    + +L     DP      +
Sbjct: 76  AYYTAKIGTITNVDDLVADKRLTSYITTAYSMGADFTAAAL-RTVLT----DPG-YAQLM 129

Query: 93  NSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYF--RKNIHK 150
               +     +++F        +                  +  A   + Y+        
Sbjct: 130 G---FTNVYNAFNFKADGSTSSTARVQS------VDQANKLKSAASSTTNYYSVTSQSSA 180

Query: 151 INSVDQLFKDRRLLDYVLQSFSITPKYISLPF 182
           I +VD L  D  +  Y+  ++ +   + +   
Sbjct: 181 ITNVDDLLADSVMARYIKDAYGLGTSFSNADL 212



 Score = 57.5 bits (137), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 44/252 (17%), Positives = 82/252 (32%), Gaps = 68/252 (26%)

Query: 309 QVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQI-------------LHDDKMQS 355
                 Q +F+ D + +   Q  +Q   +++ Y  N Q              +     + 
Sbjct: 14  YKALAAQFSFNADGTVTGTAQTAAQKASVIETYTLNSQSVIIDNSVGSDVYYVGATAAEY 73

Query: 356 LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNV 415
               Y   +G I ++D+L++ K                 +   AY++   D     LR V
Sbjct: 74  NKAYYTAKIGTITNVDDLVADKR-------------LTSYITTAYSMG-ADFTAAALRTV 119

Query: 416 LTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRS 475
           LT        YA          + +AFNF ADGS      +QS                 
Sbjct: 120 LT-----DPGYAQLMG---FTNVYNAFNFKADGSTSSTARVQSVDQ-------------- 157

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYY--TLNINTIHSFEELLANKRILNFLLES 533
                              ++    +S  +YY  T   + I + ++LLA+  +  ++ ++
Sbjct: 158 -----------------ANKLKSAASSTTNYYSVTSQSSAITNVDDLLADSVMARYIKDA 200

Query: 534 KGIDSQKVREDF 545
            G+ +     D 
Sbjct: 201 YGLGTSFSNADL 212


>gi|190894704|ref|YP_001984997.1| hypothetical protein RHECIAT_PC0000367 [Rhizobium etli CIAT 652]
 gi|190700365|gb|ACE94447.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 193

 Score =  102 bits (255), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 143 YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESR 202
           YF +NI  I SVD      RL +YVL +F ++ +Y S  F KDVLT  L +   +  +  
Sbjct: 47  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 106

Query: 203 DNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNY 256
           D+ + ++A+ F F  DGS+     +L++ QI  + S Y   +      V    Y
Sbjct: 107 DDVYVSLAKAFNFNEDGSVDGG--LLSEDQISLVTSAYAVASATIASKVILLRY 158



 Score = 97.6 bits (241), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y+ E I  I+++D+F+   RL +Y L AFGLS    +  F K +L SDL D  S VNQL+
Sbjct: 47  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 106

Query: 94  SLKYQYFARSYDFSPPPKV---IQSDIQHKTIIQDY 126
              Y   A++++F+    V   + S+ Q   +   Y
Sbjct: 107 DDVYVSLAKAFNFNEDGSVDGGLLSEDQISLVTSAY 142



 Score = 93.0 bits (229), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 4/104 (3%)

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK 565
           Y+  NI +I S ++ L++ R+ N++L + G+ ++     F  ++  SDL D  SF N   
Sbjct: 47  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 106

Query: 566 DNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
           D+ Y  +  +FNF+  G +     G +     I      Y    
Sbjct: 107 DDVYVSLAKAFNFNEDGSVD----GGLLSEDQISLVTSAYAVAS 146



 Score = 77.2 bits (188), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 50/120 (41%), Gaps = 15/120 (12%)

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
            ++  +  I S+D+ LS                   + L A+ L+ +       ++VLTS
Sbjct: 47  YFEENIASITSVDDFLSSSR-------------LKNYVLTAFGLSTEYTSSSFRKDVLTS 93

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
           +  D DS+ N+  DD  + L  AFNFN DGS+    +  S   I      YA    +I  
Sbjct: 94  DLDDADSFVNQLDDDVYVSLAKAFNFNEDGSVDGGLL--SEDQISLVTSAYAVASATIAS 151



 Score = 51.8 bits (122), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 34/97 (35%), Gaps = 12/97 (12%)

Query: 256 YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND----------- 304
           Y++  I S++S  DFL   +L   +  +      E T+  F   +  +D           
Sbjct: 47  YFEENIASITSVDDFLSSSRLKNYVLTAFGLST-EYTSSSFRKDVLTSDLDDADSFVNQL 105

Query: 305 PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
                V      NF+ D S    +  + QI  +   Y
Sbjct: 106 DDDVYVSLAKAFNFNEDGSVDGGLLSEDQISLVTSAY 142


>gi|218516824|ref|ZP_03513664.1| hypothetical protein Retl8_26089 [Rhizobium etli 8C-3]
          Length = 164

 Score = 96.4 bits (238), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 143 YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESR 202
           YF +NI  I SVD      RL +YVL +F ++ +Y S  F KDVLT  L +   +  +  
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 77

Query: 203 DNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNY 256
           D+ + ++A+ F F  DGS+     +L++ QI  + S Y   +      V    Y
Sbjct: 78  DDVYVSLAKAFNFNEDGSVDGG--LLSEDQISLVTSAYAVASATIASKVILLRY 129



 Score = 91.4 bits (225), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y+ E I  I+++D+F+   RL +Y L AFGLS    +  F K +L SDL D  S VNQL+
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 77

Query: 94  SLKYQYFARSYDFSPPPKV---IQSDIQHKTIIQDY 126
              Y   A++++F+    V   + S+ Q   +   Y
Sbjct: 78  DDVYVSLAKAFNFNEDGSVDGGLLSEDQISLVTSAY 113



 Score = 87.2 bits (214), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 4/104 (3%)

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK 565
           Y+  NI +I S ++ L++ R+ N++L + G+ ++     F  ++  SDL D  SF N   
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQLD 77

Query: 566 DNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQM 609
           D+ Y  +  +FNF+  G +     G +     I      Y    
Sbjct: 78  DDVYVSLAKAFNFNEDGSVD----GGLLSEDQISLVTSAYAVAS 117



 Score = 71.8 bits (174), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 50/120 (41%), Gaps = 15/120 (12%)

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
            ++  +  I S+D+ LS                   + L A+ L+ +       ++VLTS
Sbjct: 18  YFEENIASITSVDDFLSSSR-------------LKNYVLTAFGLSTEYTSSSFRKDVLTS 64

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
           +  D DS+ N+  DD  + L  AFNFN DGS+    +  S   I      YA    +I  
Sbjct: 65  DLDDADSFVNQLDDDVYVSLAKAFNFNEDGSVDGGLL--SEDQISLVTSAYAVASATIAS 122



 Score = 48.3 bits (113), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/97 (20%), Positives = 34/97 (35%), Gaps = 12/97 (12%)

Query: 256 YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND----------- 304
           Y++  I S++S  DFL   +L   +  +      E T+  F   +  +D           
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLST-EYTSSSFRKDVLTSDLDDADSFVNQL 76

Query: 305 PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLY 341
                V      NF+ D S    +  + QI  +   Y
Sbjct: 77  DDDVYVSLAKAFNFNEDGSVDGGLLSEDQISLVTSAY 113


>gi|218506595|ref|ZP_03504473.1| hypothetical protein RetlB5_02794 [Rhizobium etli Brasil 5]
          Length = 235

 Score = 92.6 bits (228), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 40/248 (16%), Positives = 74/248 (29%), Gaps = 35/248 (14%)

Query: 92  LNSLKYQYF------ARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYF- 144
           L    Y           +++F        +                     A   + Y+ 
Sbjct: 14  LTDPSYAQLMGFTNVYNAFNFKADGSTSTTARAQT------IDQANKLASAASSTANYYS 67

Query: 145 -RKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRD 203
                  I +VD L  D  ++ Y+  ++ +     S   LK++LT        Y    R 
Sbjct: 68  VTSQSSGITNVDDLLADSVMVRYIKDAYGL-GVNFSNAELKNILTD-----TSYTAAHRQ 121

Query: 204 NRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINS 263
                +  +F F  DGS++    I T  Q +                 ++  ++   I +
Sbjct: 122 ---AGLNADFNFNADGSIN-GSVIQTAAQRKSTTDK----------SAANAAHFNAMIGN 167

Query: 264 VSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDN 322
           V++  D + DP     L+ S+   +    A  +   +        S        NF  D 
Sbjct: 168 VTNVDDIMSDPVAVNYLRTSMQIADSVSDATLRTFLVDPAAASAQSYSDVHDLFNFKTDG 227

Query: 323 SSSTKIQQ 330
           S +T    
Sbjct: 228 SVATLYAT 235



 Score = 66.8 bits (161), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 46/304 (15%), Positives = 95/304 (31%), Gaps = 71/304 (23%)

Query: 287 LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQ 346
            +    A + +        ++     +   NF  D S+ST  +  +  Q          +
Sbjct: 3   ADFTAPALRMVLTDPSYAQLMGFTNVYNAFNFKADGSTSTTARAQTIDQA--------NK 54

Query: 347 ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQD 406
           +       +           I ++D+LL+    +             ++  DAY L +  
Sbjct: 55  LASAASSTANYYSVTSQSSGITNVDDLLADSVMV-------------RYIKDAYGLGVN- 100

Query: 407 LDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
               +L+N+LT            +   R   LN  FNFNADGSI    +           
Sbjct: 101 FSNAELKNILTDTSY--------TAAHRQAGLNADFNFNADGSINGSVIQ---------- 142

Query: 467 KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
                                   + +K    +  +   ++   I  + + ++++++   
Sbjct: 143 ----------------------TAAQRKSTTDKSAANAAHFNAMIGNVTNVDDIMSDPVA 180

Query: 527 LNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSH 586
           +N+L  S  I              ++ L DP + +       Y ++   FNF   G ++ 
Sbjct: 181 VNYLRTSMQIADSVSDA-----TLRTFLVDPAAASAQS----YSDVHDLFNFKTDGSVAT 231

Query: 587 KKIG 590
               
Sbjct: 232 LYAT 235



 Score = 56.4 bits (134), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 31/184 (16%), Positives = 65/184 (35%), Gaps = 25/184 (13%)

Query: 40  KHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQY 99
             I+ +D+ + D  +  Y   A+GL        F    L++ L+D           +   
Sbjct: 73  SGITNVDDLLADSVMVRYIKDAYGLG-----VNFSNAELKNILTDTSYTAA----HRQAG 123

Query: 100 FARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFK 159
               ++F+    +  S IQ            +   + +   + +F   I  + +VD +  
Sbjct: 124 LNADFNFNADGSINGSVIQTA-------AQRKSTTDKSAANAAHFNAMIGNVTNVDDIMS 176

Query: 160 DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG 219
           D   ++Y+  S  I    +S   L+  L             +    +  + + F F+ DG
Sbjct: 177 DPVAVNYLRTSMQIADS-VSDATLRTFLVD--------PAAASAQSYSDVHDLFNFKTDG 227

Query: 220 SLSK 223
           S++ 
Sbjct: 228 SVAT 231



 Score = 38.7 bits (88), Expect = 4.0,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 36/125 (28%), Gaps = 19/125 (15%)

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
           +  DF     +  L DP S+A       +  + ++FNF   G  S     +  D  +   
Sbjct: 1   MGADFTAPALRMVLTDP-SYAQLMG---FTNVYNAFNFKADGSTSTTARAQTIDQANKLA 56

Query: 601 TCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYF 660
           +                                I N  ++L DS + + +     L   F
Sbjct: 57  SAASSTANYY---------------SVTSQSSGITNVDDLLADSVMVRYIKDAYGLGVNF 101

Query: 661 AVLPE 665
           +    
Sbjct: 102 SNAEL 106


>gi|218513230|ref|ZP_03510070.1| hypothetical protein Retl8_05741 [Rhizobium etli 8C-3]
          Length = 173

 Score = 87.6 bits (215), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/190 (17%), Positives = 61/190 (32%), Gaps = 21/190 (11%)

Query: 144 FRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRD 203
                  I +VD L  D  +  Y+  ++ +     S   LK++LT        Y      
Sbjct: 4   VTSQSSGITNVDDLLADSVMARYIKDAYGL-GVNFSNAELKNILTD-----SSYAAAQGQ 57

Query: 204 NRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINS 263
                +  +F F  DGS++    I T  Q +                 ++  ++   I S
Sbjct: 58  ---AGLNADFNFNADGSIN-GSVIQTAAQRKSTTDK----------SAANAAHFNAMIGS 103

Query: 264 VSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQINFHRDN 322
           V++  D + DP     L+ S+   +    A  +   +                 NF  D 
Sbjct: 104 VTNVDDIMSDPVAVSYLRTSMQIADSVSDATLRTFLVDPAAASAQGYSDVHDLFNFKTDG 163

Query: 323 SSSTKIQQDS 332
           S +T     +
Sbjct: 164 SVATLYATQT 173



 Score = 77.6 bits (189), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 24/180 (13%), Positives = 57/180 (31%), Gaps = 20/180 (11%)

Query: 258 KLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITAD-KFLTLMQENDPIVSQVKYFFQI 316
               + +++  D L D  + + ++ +         A+ K +           Q       
Sbjct: 5   TSQSSGITNVDDLLADSVMARYIKDAYGLGVNFSNAELKNILTDSSYAAAQGQAGLNADF 64

Query: 317 NFHRDNS-SSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLS 375
           NF+ D S + + IQ  +Q +   D            K  +    +   +G + ++D+++S
Sbjct: 65  NFNADGSINGSVIQTAAQRKSTTD------------KSAANAAHFNAMIGSVTNVDDIMS 112

Query: 376 GK-CQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNV-----LTSNPSDPDSYANK 429
                     S +         L  + ++          +V       ++ S    YA +
Sbjct: 113 DPVAVSYLRTSMQIADSVSDATLRTFLVDPAAASAQGYSDVHDLFNFKTDGSVATLYATQ 172



 Score = 59.5 bits (142), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 37/190 (19%), Positives = 67/190 (35%), Gaps = 25/190 (13%)

Query: 40  KHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQY 99
             I+ +D+ + D  +  Y   A+GL        F    L++ L+D      Q  +     
Sbjct: 9   SGITNVDDLLADSVMARYIKDAYGLG-----VNFSNAELKNILTDSSYAAAQGQAGLNAD 63

Query: 100 FARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFK 159
           F  + D S    VIQ+  Q K+               +   + +F   I  + +VD +  
Sbjct: 64  FNFNADGSINGSVIQTAAQRKSTTDK-----------SAANAAHFNAMIGSVTNVDDIMS 112

Query: 160 DRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDG 219
           D   + Y+  S  I    +S   L+  L             +    +  + + F F+ DG
Sbjct: 113 DPVAVSYLRTSMQIADS-VSDATLRTFLVD--------PAAASAQGYSDVHDLFNFKTDG 163

Query: 220 SLSKRDKILT 229
           S++      T
Sbjct: 164 SVATLYATQT 173



 Score = 45.6 bits (106), Expect = 0.029,   Method: Composition-based stats.
 Identities = 24/158 (15%), Positives = 53/158 (33%), Gaps = 27/158 (17%)

Query: 508 TLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDN 567
           T   + I + ++LLA+  +  ++ ++ G+         L  I         S+A      
Sbjct: 5   TSQSSGITNVDDLLADSVMARYIKDAYGLG-VNFSNAELKNILT-----DSSYAAAQGQA 58

Query: 568 RYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYF 627
               + + FNF+  G +       +Q       T D                + A A +F
Sbjct: 59  G---LNADFNFNADGSI---NGSVIQTAAQRKSTTDK---------------SAANAAHF 97

Query: 628 KRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPE 665
              I ++ N  +I+ D      +   ++++   +    
Sbjct: 98  NAMIGSVTNVDDIMSDPVAVSYLRTSMQIADSVSDATL 135



 Score = 42.1 bits (97), Expect = 0.31,   Method: Composition-based stats.
 Identities = 39/236 (16%), Positives = 77/236 (32%), Gaps = 63/236 (26%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
                     I ++D+LL+                  ++  DAY L +      +L+N+L
Sbjct: 1   YYSVTSQSSGITNVDDLLADSVMA-------------RYIKDAYGLGVN-FSNAELKNIL 46

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSI 476
           T       SYA          LN  FNFNADGSI    +                     
Sbjct: 47  T-----DSSYAAAQGQ---AGLNADFNFNADGSINGSVIQ-------------------- 78

Query: 477 HDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGI 536
                         + +K    +  +   ++   I ++ + ++++++   +++L  S  I
Sbjct: 79  ------------TAAQRKSTTDKSAANAAHFNAMIGSVTNVDDIMSDPVAVSYLRTSMQI 126

Query: 537 DSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKV 592
                         ++ L DP + +       Y ++   FNF   G ++     + 
Sbjct: 127 ADSVSDA-----TLRTFLVDPAAASAQG----YSDVHDLFNFKTDGSVATLYATQT 173


>gi|218510514|ref|ZP_03508392.1| hypothetical protein RetlB5_25561 [Rhizobium etli Brasil 5]
          Length = 112

 Score = 82.2 bits (201), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 53/97 (54%), Gaps = 2/97 (2%)

Query: 143 YFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESR 202
           YF +NI  I SVD      RL +YVL +F ++ +Y S  F KDVLT  L +   +  +  
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQFD 77

Query: 203 DNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
           D+ + ++A+ F F  DGS+     +L++ QI  + S 
Sbjct: 78  DDVYVSLAKAFNFNEDGSVDGG--LLSEDQISLVTSA 112



 Score = 80.7 bits (197), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 31/89 (34%), Positives = 47/89 (52%)

Query: 34  YYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLN 93
           Y+ E I  I+++D+F+   RL +Y L AFGLS    +  F K +L SDL D  S VNQ +
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQFD 77

Query: 94  SLKYQYFARSYDFSPPPKVIQSDIQHKTI 122
              Y   A++++F+    V    +    I
Sbjct: 78  DDVYVSLAKAFNFNEDGSVDGGLLSEDQI 106



 Score = 77.6 bits (189), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 48/88 (54%)

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYK 565
           Y+  NI +I S ++ L++ R+ N++L + G+ ++     F  ++  SDL D  SF N + 
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLSTEYTSSSFRKDVLTSDLDDADSFVNQFD 77

Query: 566 DNRYKEIISSFNFDIHGELSHKKIGKVQ 593
           D+ Y  +  +FNF+  G +    + + Q
Sbjct: 78  DDVYVSLAKAFNFNEDGSVDGGLLSEDQ 105



 Score = 62.2 bits (149), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 13/108 (12%)

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
            ++  +  I S+D+ LS                   + L A+ L+ +       ++VLTS
Sbjct: 18  YFEENIASITSVDDFLSSSR-------------LKNYVLTAFGLSTEYTSSSFRKDVLTS 64

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNV 466
           +  D DS+ N+  DD  + L  AFNFN DGS+    + + ++++  + 
Sbjct: 65  DLDDADSFVNQFDDDVYVSLAKAFNFNEDGSVDGGLLSEDQISLVTSA 112



 Score = 40.6 bits (93), Expect = 0.90,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 33/96 (34%), Gaps = 12/96 (12%)

Query: 256 YYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND----------- 304
           Y++  I S++S  DFL   +L   +  +      E T+  F   +  +D           
Sbjct: 18  YFEENIASITSVDDFLSSSRLKNYVLTAFGLST-EYTSSSFRKDVLTSDLDDADSFVNQF 76

Query: 305 PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL 340
                V      NF+ D S    +  + QI  +   
Sbjct: 77  DDDVYVSLAKAFNFNEDGSVDGGLLSEDQISLVTSA 112


>gi|291231666|ref|XP_002735779.1| PREDICTED: celsr-like protein [Saccoglossus kowalevskii]
          Length = 3399

 Score = 51.0 bits (120), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 48/508 (9%), Positives = 117/508 (23%), Gaps = 28/508 (5%)

Query: 107 SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDY 166
                V Q ++Q +        +  ++      +       + K+ S + L  D      
Sbjct: 146 GSSASVFQVNVQDQDTSNTITYAILNQNPGGTLKFTIDSSGLVKVISANSLQADPPSAVT 205

Query: 167 VLQSFSITPKYISLPFLKDVLTLG----LANPKKYFIESRDNRFRAMAENFRFQPDGSLS 222
           +     I     S  F+ DVLT+           +   S             +    ++ 
Sbjct: 206 LYTLL-IRASDGS-TFISDVLTINVLGTFDESPSFARSSYTGSVDEDGTAITWINPPAVE 263

Query: 223 KRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQL 282
            +D        +    +     +               I +           +++     
Sbjct: 264 PKDDFNDADAGDSYTYSISGKYMGAGASKFRVGESTGIITASDDMDIDAGSQQIYTFTLT 323

Query: 283 SLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYK 342
           +    + + +    + +   N+         +  + + +  S   +              
Sbjct: 324 ATDRGDNQGSTLITIQVNPVNEHAPVFNPTVYHESIYENGVSGATVATLGVTDADTGDTM 383

Query: 343 KNCQILHDDKMQSLIKDYQLPL-GKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
                  DD +          +   +   + L+S    L                     
Sbjct: 384 TITITSGDDAINKFAISGNDVITNGVLDYEALISDLYVLNIQAEDSG------------G 431

Query: 402 LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
                +   Q++ V        + Y     D      +   N   + ++ P P +     
Sbjct: 432 KTSDAMVFIQIKGV--------NEYTPSFTDAPYDPFSVLENVAIETTVVPAPAVDDADR 483

Query: 462 IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL 521
             D    Y     S     +K    +   +   + +L    +  Y      +        
Sbjct: 484 GTDGELVYQVISSSPPSGLDKFSVDVRDGAITTKASLNYEDQDTYTLRIKVSDTGIPVKT 543

Query: 522 ANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
           A   I+  ++          +  +   + +SD        N    +      ++FNF I 
Sbjct: 544 ATTDIVINIVNVNDNPPTLDQTVYYATVLESDTAGTV-LVNFVVTDPDDPDTAAFNFAIE 602

Query: 582 GELSHKKIGKVQDNFHIDDTCDLYKHQM 609
                      +      D  D      
Sbjct: 603 SSSDTSATPPPRTTRFTFDVPDKALTLT 630


>gi|242022324|ref|XP_002431590.1| laminin A chain, putative [Pediculus humanus corporis]
 gi|212516898|gb|EEB18852.1| laminin A chain, putative [Pediculus humanus corporis]
          Length = 3650

 Score = 49.5 bits (116), Expect = 0.002,   Method: Composition-based stats.
 Identities = 77/640 (12%), Positives = 183/640 (28%), Gaps = 77/640 (12%)

Query: 136  VALEESKYFRKNIHKINSVDQLFKD-----RRLLDYVLQSFSITPKYISLPFLKDVLTLG 190
              L+ + + R  I  + +  +   D     +RL  +   + +++ +  +L   K  +   
Sbjct: 2077 DLLDTTDHLRNLIDPVMTEFETVADGYFTTQRLRYFNDTANNLSVEVSNLDPTKLQVAPV 2136

Query: 191  LANPKKYFIESRD-NRFRAMAENFRFQP--DGSLSKRDKILTDMQIEKIVSNYFNNTIDC 247
            L        + ++  R    A+    +   +G   +   +  +  I ++     N  ++ 
Sbjct: 2137 LKELDSLEADLKNIYRRAEFAKERGEKSAVEGEDVRVKTLDAEDLIRQVTDESGNAVLEV 2196

Query: 248  VPIVSDQN-----YYKLAINSVSSFSDFLKDPKLFKM-LQLSLFPLNPEITADKFLT-LM 300
              + +  +     + + A++        ++D  L     +      N   T DK     +
Sbjct: 2197 ANLANSLDKGRGPHVESAVSESIKLLQDIQDRILDPYYEKAEYEIGNATFTRDKMRNFTI 2256

Query: 301  QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS--LIK 358
               +      K    I    D     K   +S  +        N     +        IK
Sbjct: 2257 PITNQSKELEKLRKAIQDFDDRLEDLKNHTESAQETSDKSILLNKINKDEKLSSKVNTIK 2316

Query: 359  DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
            +      +  +   +L         ++        +        N  +  +D+L   L S
Sbjct: 2317 NMTKDSNETVANAKILLKNATDALDDARSATAELYREK------NRGNEAKDRLNATLLS 2370

Query: 419  NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
              SD               L+   N      +    + +    + ++            +
Sbjct: 2371 ESSD---------------LSDLLNPVETAKVKAEELFERAKELNESFAESRKSSGLGVE 2415

Query: 479  AENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN--KRILNFLLESKG- 535
            A        + I   ++   + N   D        I    E   N  + +L   +++   
Sbjct: 2416 AARAYATIADDIIDAEKSVEKANELADSAIEQAQGIGETTETAKNLSQSLLEQAMKALQQ 2475

Query: 536  IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHK-------- 587
            ++S    +    +    +++D  +FA +  DN  KE+ +  N       S +        
Sbjct: 2476 VESDLHPQFLTAKNEVQEIEDQNAFAASQNDNIVKELTTISNETNLKTASSRAMKESDLA 2535

Query: 588  KIGKVQDNFHIDDTCDLY-----KHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILG 642
                     +I    D       + + + K     +  ++ A   +  +  + +   IL 
Sbjct: 2536 NSTAQNTLANIKVITDKVPDEVVQAKQLPKDIGAINHEVSQA---QSQLARVNS---ILP 2589

Query: 643  D--SKLFKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFLYA----AKA 696
            D    +  +   + KL      +   K+I  LK+ +         +  D           
Sbjct: 2590 DINQLMTNLKDTQEKLKGK--EMDIDKQIDRLKRQV--------AEARDLASRVNVGITF 2639

Query: 697  MDHQSIDYKKALFSSPNQNKDPWNNSFD-DPQNNVSLQLS 735
              +  ++ K     +        +  F  D  N   L L 
Sbjct: 2640 QPNTFVEVKNPEDLAKQSTSTKVSAYFKSDKPNGALLYLG 2679


>gi|317014331|gb|ADU81767.1| putative toxin-like outer membrane protein/vacuolating cytotoxin
           (VacA)-like protein [Helicobacter pylori Gambia94/24]
          Length = 2529

 Score = 47.9 bits (112), Expect = 0.006,   Method: Composition-based stats.
 Identities = 51/433 (11%), Positives = 120/433 (27%), Gaps = 41/433 (9%)

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPD----GSLSKRDKILTDMQIEKIVSNY-FNNTID 246
           +    +   S +       ++  F  +    G+ +     ++   I  + S+  F +   
Sbjct: 290 SAQSTFENSSFNQGTYNFNDSVSFNNNTFNQGAYNFNTSKVSFSGINTLNSSSPFASLKG 349

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
            V   S+  +      + +   D L      +      +  +             +    
Sbjct: 350 SVSFGSNAIFNLNQTLNNNQTYDILTTNGAIQYGVYQSYLWDLI------NYKGDKAISH 403

Query: 307 VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
           V      + + F  D    T  +  +    +      N Q       Q  + + +  L  
Sbjct: 404 VEVGNNTYDVTFDIDGQDETLQETFNNQSIITQFLGDNLQQQAQQTYQEDLTNSKNALSG 463

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
             S DN ++        +     +       DA NL   +    Q    L  +  +    
Sbjct: 464 ATS-DNTIANNDTSYTQSKNATILK------DAQNLENTNQKIQQDEQDLEKDLENVKQL 516

Query: 427 ANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNS 486
           AN +             FN           Q       N ++  N K+   +   +   +
Sbjct: 517 ANSTT-----------GFNEQAFNQAQKQEQQDEQTLQNDENAFNTKQDSLNKAIQQAQA 565

Query: 487 MEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN------FLLESKGIDSQK 540
            +Q   Q +       +V+     +N + S   +  N              +++G+++  
Sbjct: 566 QQQKQEQAQAQKTYQEDVNNSQNALNDVTSDNTIANNDTSYTQSKNATVAKDAQGLENTN 625

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
            +     +  + DL   K  AN+      +    +       +   +    +Q++ +  +
Sbjct: 626 QQIQQDEKALEKDLAQIKQLANSTTGFNEQAFTQA------QKQEQQDEQALQNDENAFN 679

Query: 601 TCDLYKHQMIEKK 613
           T      Q I   
Sbjct: 680 TEQEGLEQAIANA 692


>gi|168335032|ref|ZP_02693146.1| 5'-nucleotidase/2' 3'-cyclic phosphodiesterase and related
            esterases-like protein [Epulopiscium sp. 'N.t. morphotype
            B']
          Length = 3779

 Score = 46.8 bits (109), Expect = 0.013,   Method: Composition-based stats.
 Identities = 44/512 (8%), Positives = 135/512 (26%), Gaps = 28/512 (5%)

Query: 103  SYDFSPPPKVIQSDIQHKTIIQDYKQS----HQHKEEVALEESKYFRKNIHKINSVDQLF 158
            ++D +    V   D     +I  + Q+     +  ++ A E    F +   ++       
Sbjct: 2335 AFDPATDEVVDAFDPAADEVIDAFDQAADEVDEEADQAADEVVDAFDQAADEVVDAFDPA 2394

Query: 159  KDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNR---FRAMAENFRF 215
             D    +    +  +  +        +       +      +   +       +  +   
Sbjct: 2395 TDEVEDEADPATDEVEDEANPATDEVEDEVDQATDEVVDAFDQATDEVEDEADLIADEVI 2454

Query: 216  QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINS-VSSFSDFLKDP 274
                  +       D   +++V  +     + V              +  +   +   DP
Sbjct: 2455 DAFDPAADEVVDAFDPAADEVVDAFDPAADEVVDAFDLATDEVEDEANPATDEVEDEADP 2514

Query: 275  KLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQI 334
               ++   +    +  I A        E++   +  +     +   D     + + D   
Sbjct: 2515 ATDEVEDEADPIADEVIDAFDPTADEVEDEADPATDEVIDAFDQAADE---VEDEADPIA 2571

Query: 335  QKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQ 394
             +++D +      + D+              +++   + ++ +       + +E      
Sbjct: 2572 DEVIDAFDPTADEVEDEVDPVA--------DEVEDEADPIADEVIDAFDPATDEVEDEAN 2623

Query: 395  FALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIP 454
             A+D    +  D   D++      + ++P +   + + D            A   +    
Sbjct: 2624 PAVDKV-EDEADPATDEV-----EDEANPSTDEVEDEADPATDEVEDEADPATDEVEDEA 2677

Query: 455  MMQSRLTIRDN--VKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNIN 512
               +     +   V      +      E +              +  I+  VD +    +
Sbjct: 2678 NPATDEVEDEANPVTDEVEDEVDPAADEVEDEVDPVADEVVDAFDPAIDEVVDAFDPAAD 2737

Query: 513  TIHSFEELLANKRILNFLLESKGIDSQ-KVREDFLCEIFKSDLKDPKSFANTYKDNRYKE 571
             +    + +A++ +  F   +   D       D + + F     +     +   D    E
Sbjct: 2738 KVEDEADPIADEVVDAFDQAADETDDAFDQAADEVVDAFDQATDEVDEEVDPVADEVEDE 2797

Query: 572  IISSFNFDIHGELSHKKIGKVQDNFHIDDTCD 603
            +  S +                 +   D+  D
Sbjct: 2798 VDPSTDEVEDEADPAADETDDAFDPATDEVED 2829



 Score = 46.4 bits (108), Expect = 0.018,   Method: Composition-based stats.
 Identities = 52/547 (9%), Positives = 138/547 (25%), Gaps = 55/547 (10%)

Query: 99   YFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLF 158
                ++D      V   D     +I  +  +    E+ A   +       +      +  
Sbjct: 2265 EVVDAFDPVADEVVDAFDQATDEVIDAFDPATDEVEDEANPVTDEVEDEANPATDEVEDE 2324

Query: 159  KDRRLLDY----------VLQSFSITPKYISLPFLKDVLTLG--LANPKKYFIESRDNRF 206
             D    +           V+ +F      +   F +    +           +++ D   
Sbjct: 2325 ADPIADEVEDAFDPATDEVVDAFDPAADEVIDAFDQAADEVDEEADQAADEVVDAFDQAA 2384

Query: 207  RAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSS 266
              + + F    D    + D    +++ E   +                + +  A + V  
Sbjct: 2385 DEVVDAFDPATDEVEDEADPATDEVEDEANPATDEVEDEVDQATDEVVDAFDQATDEVED 2444

Query: 267  FSDFLKDPKL------FKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVK-YFFQINFH 319
             +D + D  +         +  +  P   E+         +  D           + N  
Sbjct: 2445 EADLIADEVIDAFDPAADEVVDAFDPAADEVVDAFDPAADEVVDAFDLATDEVEDEANPA 2504

Query: 320  RD--------NSSSTKIQQDSQIQKMLDLYKKNCQ---ILHDDKMQSLIKDYQLPLGKIK 368
             D         +   + + D    +++D +           D     +I  +     +++
Sbjct: 2505 TDEVEDEADPATDEVEDEADPIADEVIDAFDPTADEVEDEADPATDEVIDAFDQAADEVE 2564

Query: 369  SIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYAN 428
               + ++ +       +A+E    +    D        +  + +      +  DP +  +
Sbjct: 2565 DEADPIADEVIDAFDPTADEVEDEVDPVADEVEDEADPIADEVI------DAFDPAT--D 2616

Query: 429  KSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSME 488
            + +D+    ++   +     +              ++    A  +              E
Sbjct: 2617 EVEDEANPAVDKVEDEADPATDEVEDEANPSTDEVEDEADPATDEVEDEADPATDEVEDE 2676

Query: 489  QISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCE 548
                   +  E N   D     ++      E   +      + ++      +V + F   
Sbjct: 2677 ANPATDEVEDEANPVTDEVEDEVDPAADEVEDEVDPVADEVV-DAFDPAIDEVVDAF--- 2732

Query: 549  IFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQ 608
                D    K       D    E++ +F+                     D+  D +   
Sbjct: 2733 ----DPAADK--VEDEADPIADEVVDAFDQAADETDDAFDQAA-------DEVVDAFDQA 2779

Query: 609  MIEKKEE 615
              E  EE
Sbjct: 2780 TDEVDEE 2786


>gi|114767572|ref|ZP_01446321.1| tail fiber protein, putative [Pelagibaca bermudensis HTCC2601]
 gi|114540382|gb|EAU43470.1| tail fiber protein, putative [Roseovarius sp. HTCC2601]
          Length = 1748

 Score = 45.2 bits (105), Expect = 0.043,   Method: Composition-based stats.
 Identities = 55/530 (10%), Positives = 139/530 (26%), Gaps = 52/530 (9%)

Query: 141  SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV------LTLGLANP 194
            +  +  +   + ++         L        +TP  +S      +          L + 
Sbjct: 1118 ATAYEVHASFVTAIADQRTWSAWLPVTTSDLRLTPADLSDDLAGSIDAALSRHDDALDDA 1177

Query: 195  KKYFIESRDNRFRAMAENFRFQP-DGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD 253
            +    + RD    +++    F   D  L           IE  +      T     IV++
Sbjct: 1178 EGAVGDLRDRILASLSGVPTFDVLDAYLDGIGAESLIGAIETSLGPLSAPTSLSSQIVTE 1237

Query: 254  QNYYKLAINSVSSFSDFLKDPK--LFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVK 311
            +    L +  +S   +   D    L +              A  ++        I +   
Sbjct: 1238 RERLDLLLPRISDAEEVTSDIAGLLAQFGAALFATDKRISDAGIYVDPESGTVKIAAYEY 1297

Query: 312  YF----------FQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQ 361
                               D  +S      +    +LD  +       D ++ +  +   
Sbjct: 1298 LEGQVSDVSIELNAARAQIDLKASVAYVNQALSDLVLDPTQIPLLDDLDLRISTAEQTLD 1357

Query: 362  LPLGKIKSIDNLLS-----------------------GKCQLEGPNSAEEPIITLQFALD 398
               G + S+   L+                        +      ++AE  +   +  + 
Sbjct: 1358 AVEGTVTSLTETLTVEGRLVTMTTVTETLDSLQGQITDRVTSATFDAAEARLTAAEQTIS 1417

Query: 399  AYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG--SIGPIPMM 456
            A+  N +     +   VL    SD  +   +   +R           A     +      
Sbjct: 1418 AFPDNAEVSSAVEASRVLPGELSDASALMVQEMGERFASDQAIRVAEAQAREDLRAYIDE 1477

Query: 457  QSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYT-LNINTIH 515
            Q      + ++  +    S+   E+       +         ++ ++++           
Sbjct: 1478 QDGAVAENVIQLRSQVDSSVAQIEDTLRTRATEAEATAEAVTQLQTDIESADGERAAQAD 1537

Query: 516  SFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISS 575
            + ++L              G++S+  R+  L    ++   D    A       + E  +S
Sbjct: 1538 AIDDL-----TTRVTDTEDGLESESARQTILTASVRAIGDDATDLAELAITEMWNEFRAS 1592

Query: 576  FNFDIHGELSHKKIGKVQDNFHIDDTCDLY-KHQMIEKKEEEKDPNIALA 624
             +      ++  ++    +   + +  +       +E    E      LA
Sbjct: 1593 EDLRAGIAVAASELHTYVEEGQLAEASERLQLGAALEDAVAEI-QTERLA 1641


>gi|146308563|ref|YP_001189028.1| aminopeptidase Y [Pseudomonas mendocina ymp]
 gi|145576764|gb|ABP86296.1| Aminopeptidase Y [Pseudomonas mendocina ymp]
          Length = 555

 Score = 44.4 bits (103), Expect = 0.064,   Method: Composition-based stats.
 Identities = 41/362 (11%), Positives = 96/362 (26%), Gaps = 19/362 (5%)

Query: 156 QLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLAN------PKKYFIESRDNRFRAM 209
           Q+F D  L +   ++  ++    SL +++  L            P   F        +++
Sbjct: 94  QMFNDIALANGGNRAAGLSGYERSLDYVQATLESAGYKVTRQAFPFSAFYPQGPGVLQSL 153

Query: 210 A---ENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSS 266
           A     F ++ D +   +            V                +++      S++ 
Sbjct: 154 APTPAQFEWEVDFTYLSQTDAGDVSAPVAAVDIALGEGNQSSSGCEAEDFAAFPAGSIAL 213

Query: 267 FSDFLKD--PKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSS 324
                 +   K           +      D        N  +         + F   +  
Sbjct: 214 LQRGTCNFQIKAENAAAAGAVGVVIFNQGDSEDRKGLLNATLGDAYSGGIPVLFTTYDVG 273

Query: 325 STKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPN 384
            +  Q   Q  +M+    +     H+   +S   +    +     +D++  G    +  +
Sbjct: 274 VSLAQTAEQQVRMVTDVVRERTQTHNLVAESKRGNAGNVVMLGAHLDSVFEGAGINDNGS 333

Query: 385 SAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNF 444
            +   +        A     ++  R        S       Y N+  D+   K+    NF
Sbjct: 334 GSAALLELAVQMAKA---KPKNKLRFAWWGAEESGLVGSTYYVNQLPDEEKAKIKAYLNF 390

Query: 445 NADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEV 504
           +   S        +      +   +  +      A  + F    ++        EI+   
Sbjct: 391 DMIASPN-----FAYFIYDGDGSDFGLQGPPGSAALERLFGEYYRLRGLPFEGDEISFRS 445

Query: 505 DY 506
           DY
Sbjct: 446 DY 447


>gi|254779523|ref|YP_003057629.1| putative toxin-like outer membrane protein/vacuolating cytotoxin
           (VacA) paralogue [Helicobacter pylori B38]
 gi|254001435|emb|CAX29430.1| Putative toxin-like outer membrane protein/vacuolating cytotoxin
           (VacA) paralogue [Helicobacter pylori B38]
          Length = 2524

 Score = 44.4 bits (103), Expect = 0.069,   Method: Composition-based stats.
 Identities = 46/395 (11%), Positives = 108/395 (27%), Gaps = 35/395 (8%)

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPD----GSLSKRDKILTDMQIEKIVSNY-FNNTID 246
           +    +   + +       +N  F  D    G+ S     ++   I  + S+  F +   
Sbjct: 290 SAQSTFENSNFNQGTYNFNDNTSFNNDTFNQGTYSFNTSKVSFSGINTLNSSSPFASLKG 349

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
            V   S   +      + +   D L      +      +  +             +    
Sbjct: 350 SVSFNSGAVFNLNQTLNNNQTYDILTTNGAIQYGVYQSYLWDLI------NYKGDKAISH 403

Query: 307 VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
           V      + + F+ +    T  +  ++   +      + Q       Q  +   Q  L  
Sbjct: 404 VGVGNNTYDVTFNINGQDETLQETFNKQSIITQFLGDDLQQQAQQTYQEDLTHSQNALNN 463

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
           + S DN ++        +           A DA  L   +    Q    L  + +     
Sbjct: 464 VTS-DNTIANNDTSYTQSKNTTV------AKDAQGLENTNQKIQQDEQALEKDLAQIKQL 516

Query: 427 ANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNS 486
           AN               F+           Q       N ++  N K+       +   +
Sbjct: 517 ANSPT-----------GFSEQAFNQAQKQEQQDEQTLQNDENAFNTKQEGLKQAIQQAQA 565

Query: 487 MEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRIL------NFLLESKGIDSQK 540
            +Q   Q++       ++ +    +N + S   +  N              +++G+++  
Sbjct: 566 QQQKQEQQQAQQTYQEDLTHSQNALNNVTSDNTIANNDTSYTQSKNTTVAKDAQGLENTN 625

Query: 541 VREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISS 575
            +     +  + DL   K  AN+      +    +
Sbjct: 626 QKIQQDEQALEKDLAQIKQLANSPTGFSEQAFNQA 660


>gi|290891487|ref|ZP_06554545.1| hypothetical protein AWRIB429_1935 [Oenococcus oeni AWRIB429]
 gi|290478836|gb|EFD87502.1| hypothetical protein AWRIB429_1935 [Oenococcus oeni AWRIB429]
          Length = 1977

 Score = 44.1 bits (102), Expect = 0.086,   Method: Composition-based stats.
 Identities = 66/497 (13%), Positives = 142/497 (28%), Gaps = 30/497 (6%)

Query: 77  ILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTI-IQDYKQSHQHKEE 135
           +++SD++   S    L       F  + D          D+        +Y  S   +  
Sbjct: 149 VVDSDIATQNSTAFTLAD-----FQHASDALAGTTGSILDVWGGEYKFDNYHISLLQRMG 203

Query: 136 VALEESKYFRKNIHKINSVDQLFKDRRLLDYV--LQSFSITPKYISLPFLKDVLTLGLAN 193
             +     + +NI  I     +     + + +    + S      S+  +  +       
Sbjct: 204 KTVNGILSYGRNIQTIEQESDI---STIYNSIIPYATVSQPSGDSSVDIIHVLSGSDYIQ 260

Query: 194 PKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKIL-----TDMQIEKIVSNYFNNTIDCV 248
              Y  +        +  +F  Q   S +  D+       +D Q++ +   Y ++     
Sbjct: 261 AGSYANQY--PYPITLPVDFSDQFYASDASADEKQGKYAYSDAQLKALAQKYLSDNEVGK 318

Query: 249 PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL-MQENDPIV 307
           P  +          S+       +  +L  ++  +  PL    TA+   T+        V
Sbjct: 319 PTANMTVTAIDLSKSLEYQGTNEQPIELGDIVPTNYEPLAISGTAEVTQTIWDDITKQYV 378

Query: 308 SQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKI 367
                  Q       S +       Q Q        N     D         Y       
Sbjct: 379 EYTFGQKQTLTSAMVSIADNAVSGVQKQVTAINTIINGLGQPDSYSGDPTAGYPA----- 433

Query: 368 KSIDNLLSGKCQLEGPNSAEEPIITLQFALDAY--NLNMQDLDRDQLRNVLTSNPSDPDS 425
              D +L  K  L   N+      +   A   Y     +      ++ N ++S  SD  S
Sbjct: 434 ---DPVLGQKFFLTDGNNQYIYQYSYDDATGTYYWKELVSTYTSQEIDNKVSSVVSDAKS 490

Query: 426 YANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAE-NKSF 484
           Y +   D    ++    +  ++  +G      +  ++        ++  S      N++ 
Sbjct: 491 YTDDLNDSLTPQIAAIDSQASNAVVGAQTANNNVNSLSSATDISTSQANSNASQAINQAS 550

Query: 485 NSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVRED 544
            ++   S        ++ E+      I +        A++  +N L    G  S  + + 
Sbjct: 551 EAILAASNANVSVSSLSGELTTNKTAIASNAQVIATKADQTTVNSLGSQVGSQSTLLAQT 610

Query: 545 FLCEIFKSDLKDPKSFA 561
                 K+D     S +
Sbjct: 611 ASEVALKADSAAVSSLS 627


>gi|195109590|ref|XP_001999366.1| GI23104 [Drosophila mojavensis]
 gi|193915960|gb|EDW14827.1| GI23104 [Drosophila mojavensis]
          Length = 2254

 Score = 44.1 bits (102), Expect = 0.099,   Method: Composition-based stats.
 Identities = 35/262 (13%), Positives = 80/262 (30%), Gaps = 27/262 (10%)

Query: 86   KSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFR 145
              L N+    KY   A+ +          +    +   + Y ++     E    +   F+
Sbjct: 1141 DELQNKEKDSKYGSLAKQF-------THLNARWTEVTERVYTKT--ALLEHISTQLGEFK 1191

Query: 146  KNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL----GLANPKKYFIES 201
            K +          +++ + +    +         L  L++VL       L   ++   E 
Sbjct: 1192 KFMVSETGYLDRLENK-IRNTPENAADAEEIIEELDDLENVLRSHSDEWLDKIQEIGNEL 1250

Query: 202  RDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAI 261
             DN F  MA+  R   DG + +  ++    +             +         + +   
Sbjct: 1251 IDNEF--MADAMRKDIDGIVERWTQLQQQAKKR--TELLEEKASEAEQSEKAIVHLESW- 1305

Query: 262  NSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRD 321
              ++   + L D  L   + +   P + +I A +F    Q    I + +          +
Sbjct: 1306 --LTRMDEILSD-HLENDVTIEDLPDDFQILAREFAINEQNFKVISTLIAEHTA-----N 1357

Query: 322  NSSSTKIQQDSQIQKMLDLYKK 343
              +    +   Q+  M   +K 
Sbjct: 1358 GKTGAANRLQEQLNLMETRFKV 1379


>gi|313674528|ref|YP_004052524.1| outer membrane adhesin like proteiin [Marivirga tractuosa DSM 4126]
 gi|312941226|gb|ADR20416.1| outer membrane adhesin like proteiin [Marivirga tractuosa DSM 4126]
          Length = 2246

 Score = 44.1 bits (102), Expect = 0.10,   Method: Composition-based stats.
 Identities = 53/507 (10%), Positives = 130/507 (25%), Gaps = 66/507 (13%)

Query: 101  ARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKD 160
            A   D +     +Q+       +  Y  +   ++      +     +++          D
Sbjct: 1187 AFQIDANTGEISVQTTDLDYETVDAYTLTLTVQDGANTSSAVDLTIDVNN-------LND 1239

Query: 161  RRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGS 220
               +    QSF I         +  V          +   +        A    FQ D +
Sbjct: 1240 NAPIIAANQSFDIDENSAQNTVVGSVSVSDADGATTFENWAITAGNTNEA----FQIDAN 1295

Query: 221  LSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKML 280
              +     TD+  E + S     +++     S      +AIN+++  +  +   +     
Sbjct: 1296 TGEISVQTTDLDYEAVGSYTLTVSVEDGANTSSAVDLTIAINNLNDNAPVIAANQ----- 1350

Query: 281  QLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL 340
              S         +    T+   +    +  + +         +++   Q D+   ++   
Sbjct: 1351 --SFNINENSSQSTVVGTVAVSDADGATTYQNWAI----TAGNTNEAFQIDANSGEIS-- 1402

Query: 341  YKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAY 400
                  +   D     +  Y L +      +   +    +   N  +   +    A  ++
Sbjct: 1403 ------VKTTDLDYEAVGAYTLTVTVQDGANTSSAVDLTITINNLNDNAPVI--AANQSF 1454

Query: 401  NLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRL 460
            N++        +  V  S+     +Y N                 A  +       Q   
Sbjct: 1455 NIDENSAQNAAVGTVAVSDADGATTYQNW----------------AITAGNTNEAFQIDA 1498

Query: 461  TIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEEL 520
               +      +       A   +    +  +T   +++ I+                   
Sbjct: 1499 NSGEISIKTEDLDFEAVAAYTLTVKVEDGANTSDELDVTIDINN---------------- 1542

Query: 521  LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
            L +   +    +S  ID    +   +  +  SD     ++ N            +F  D 
Sbjct: 1543 LNDNAPVIAANQSFDIDENSAQNAVVGFVAVSDADGATTYENWTITAG--NTNEAFQIDA 1600

Query: 581  HGELSHKKIGKVQDNFHIDDTCDLYKH 607
            +      K   +        T  L   
Sbjct: 1601 NTGEISVKTTDLDYEAVGAYTLTLTVE 1627



 Score = 39.1 bits (89), Expect = 2.8,   Method: Composition-based stats.
 Identities = 50/464 (10%), Positives = 123/464 (26%), Gaps = 34/464 (7%)

Query: 58   ALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDI 117
            A ++F + + S     +  +  SD     +  N   +      A   D +     +Q+  
Sbjct: 1246 ANQSFDIDENSAQNTVVGSVSVSDADGATTFENWAITAGNTNEAFQIDANTGEISVQTTD 1305

Query: 118  QHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKY 177
                 +  Y  +   ++      +      I+          D   +    QSF+I    
Sbjct: 1306 LDYEAVGSYTLTVSVEDGANTSSAVDLTIAINN-------LNDNAPVIAANQSFNINENS 1358

Query: 178  ISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIV 237
                 +  V          Y   +        A    FQ D +  +     TD+  E + 
Sbjct: 1359 SQSTVVGTVAVSDADGATTYQNWAITAGNTNEA----FQIDANSGEISVKTTDLDYEAVG 1414

Query: 238  SNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFL 297
            +     T+      S      + IN+++  +  +   +       S              
Sbjct: 1415 AYTLTVTVQDGANTSSAVDLTITINNLNDNAPVIAANQ-------SFNIDENSAQNAAVG 1467

Query: 298  TLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLI 357
            T+   +    +  + +         +++   Q D+   ++         I  +D     +
Sbjct: 1468 TVAVSDADGATTYQNWAI----TAGNTNEAFQIDANSGEIS--------IKTEDLDFEAV 1515

Query: 358  KDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
              Y L +      +        ++  N  +   +    A  +++++        +  V  
Sbjct: 1516 AAYTLTVKVEDGANTSDELDVTIDINNLNDNAPVI--AANQSFDIDENSAQNAVVGFVAV 1573

Query: 418  SNPSDPDSYAN--KSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRS 475
            S+     +Y N   +  +         N             ++       +        S
Sbjct: 1574 SDADGATTYENWTITAGNTNEAFQIDANTGEISVKTTDLDYEAVGAYTLTLTVEDEANTS 1633

Query: 476  IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
                     N++   +     N   + + +     I  I S  +
Sbjct: 1634 ASVDLTIDINNLNDNAPVIATNQSFDIDENSVQNTIVGILSVSD 1677



 Score = 39.1 bits (89), Expect = 3.3,   Method: Composition-based stats.
 Identities = 57/493 (11%), Positives = 127/493 (25%), Gaps = 62/493 (12%)

Query: 158  FKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP 217
              D   +    QSFSI         +  +          Y   +         E F+   
Sbjct: 931  LNDNAPVIAADQSFSIDENSTQNTVVGTISVSDADGATTYENWTITAG--NTNEAFQINA 988

Query: 218  DGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLF 277
            +          TD+  E + +     T+      S      + IN+++  +  +   + F
Sbjct: 989  NTGEISVQT--TDLDFEAVGAYTLTVTVQDGANTSASVDLTITINNLNDNAPVIAANQSF 1046

Query: 278  KMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKM 337
             +          E ++   +  + E         Y           ++    +  QI   
Sbjct: 1047 NI---------NENSSQSTVVGIVEVSDADGATTYGNWTI------TAGNTNEAFQIDAA 1091

Query: 338  LDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFAL 397
                  N   L  +     +  Y L L      +   S    ++  N  +   +      
Sbjct: 1092 TGEILVNTTDLDYEA----VGAYTLTLTVEDGANASASVDLTIDVNNLNDNAPVI--ATN 1145

Query: 398  DAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADG--------- 448
             +++ +        + +V  S+     +Y N S  D       AF  +A+          
Sbjct: 1146 QSFDTDENSGQNTVVGSVSVSDADGSTTYENWSITDGNTN--EAFQIDANTGEISVQTTD 1203

Query: 449  -----------SIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRI- 496
                       ++       +   +   +        +   A N+SF+  E  +    + 
Sbjct: 1204 LDYETVDAYTLTLTVQDGANTSSAVDLTIDVNNLNDNAPIIAANQSFDIDENSAQNTVVG 1263

Query: 497  ---NLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSD 553
                 + +    +    I   ++ E    +       +++  +D + V    L    +  
Sbjct: 1264 SVSVSDADGATTFENWAITAGNTNEAFQIDANTGEISVQTTDLDYEAVGSYTLTVSVEDG 1323

Query: 554  LKDPKS-----FANTYKDNR-YKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKH 607
                 +       N   DN        SFN + +   S         +     T     +
Sbjct: 1324 ANTSSAVDLTIAINNLNDNAPVIAANQSFNINENSSQSTVVGTVAVSDADGATT-----Y 1378

Query: 608  QMIEKKEEEKDPN 620
            Q         +  
Sbjct: 1379 QNWAITAGNTNEA 1391


>gi|208434825|ref|YP_002266491.1| vacuolating cytotoxin (VacA)-like protein [Helicobacter pylori G27]
 gi|208432754|gb|ACI27625.1| vacuolating cytotoxin (VacA)-like protein [Helicobacter pylori G27]
          Length = 2506

 Score = 43.3 bits (100), Expect = 0.15,   Method: Composition-based stats.
 Identities = 45/427 (10%), Positives = 111/427 (25%), Gaps = 29/427 (6%)

Query: 192 ANPKKYFIESRDNRFRAMAENFRFQPD----GSLSKRDKILTDMQIEKIVSNY-FNNTID 246
           +    +   + +        N  F  D    G+ +     ++   I  + S+  F +   
Sbjct: 271 SAQSTFENSNFNQGTYNFNGNASFDNDTFNQGTYNFNTSKVSFSGINTLNSSSPFASLKG 330

Query: 247 CVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPI 306
            V   S+  +      + +   D L      +      +  +             +    
Sbjct: 331 SVSFNSNAVFNLNQTLNNNQTYDILTTNGAIQYGVYQSYLWDLI------NYKGDKAISH 384

Query: 307 VSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGK 366
           V      + + F  +    T  +  ++   +      + Q       Q  +   Q  L  
Sbjct: 385 VGVGNNTYDVTFDINGQDETLQETFNKQSIITQFLGDDLQQQAQKTYQEDLTHSQNALNN 444

Query: 367 IKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSY 426
           + S DN ++        +           A DA  L   +    Q    L  + +     
Sbjct: 445 VTS-DNTIANNDTSYTQSKNATI------AKDAQGLENTNQKIAQDEQALEKDLAQIKQL 497

Query: 427 ANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNS 486
           AN +          A               ++  + ++ +K    + ++    + +    
Sbjct: 498 ANSTTGFSEQAFTQAQKQEQQDEQTLQNEEKTFNSEQEGLKQAIQQAQAQQQKQEQQQAQ 557

Query: 487 MEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFL 546
                        +N+        I    S  +   NK       +++ +++   +    
Sbjct: 558 QTYQQDLSNSQSALNNAAS--DSKIAN--SDTDYTKNKN-TAIATDAQNLENTNQQIAQD 612

Query: 547 CEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYK 606
            +  + DL   K  AN      + E      F+       +    +Q+     +      
Sbjct: 613 EQALEKDLAQIKQLAN--STTGFSEQA----FNQAQSTEQQDEQTLQNEEKTFNAEQEGL 666

Query: 607 HQMIEKK 613
            Q +   
Sbjct: 667 KQALANA 673


>gi|153829529|ref|ZP_01982196.1| AAA ATPase [Vibrio cholerae 623-39]
 gi|148874989|gb|EDL73124.1| AAA ATPase [Vibrio cholerae 623-39]
          Length = 782

 Score = 43.3 bits (100), Expect = 0.16,   Method: Composition-based stats.
 Identities = 55/451 (12%), Positives = 128/451 (28%), Gaps = 28/451 (6%)

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKD----RRLLDYVLQ---SFSITPKYISLPF 182
              +     E  +  R+  +    +D L         LL+ VL    +F+    +   P 
Sbjct: 2   LNEQHPEPAESLRSARRXXNSDTFIDDLLNSAPAKDPLLEPVLDENEAFAQADDFDFNPE 61

Query: 183 LKDVLTLGLANPKKY-FIESRDNRFRAMAENFRFQPDGSLSK--RDKILTDMQIEKIVSN 239
           ++  L   L  P      E    +         F  D S      +  L     E  +  
Sbjct: 62  IEGGLEDDLPQPSALPANEFGTPQDEDWV----FDEDDSSPTLEGNAELELSSAEDDLPE 117

Query: 240 YFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT--ADKFL 297
               T +    +      +   N+V +  D L    + + ++ SL   + E+    D+  
Sbjct: 118 QTTATNETADELLADLAAQPQSNTVDTSDDALAPDAISQSVEESLTLNDLELPEENDEPQ 177

Query: 298 TLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLI 357
                   +  + +   +I    +  ++     +S +  + +L               L 
Sbjct: 178 LAEVTPSSVFDEQQVETEIEPESEPLAAEASNDESDLTALNELDLPEYTEEDALADAQLE 237

Query: 358 KDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLT 417
              +  +     + +    +      +  + P  T + AL    L        +    L 
Sbjct: 238 PATESEVEPELKLASEPVEEEAFTELDELDLPEYTEEDALADAQLEPAVESEVEPELELA 297

Query: 418 SNPSDPDSYA--NKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRS 475
           S+  + +++   N+       + +      AD  + P    +    +    +       +
Sbjct: 298 SDLDEEEAFTELNELDLPEYTEEDAL----ADAQLEPAAESEVEPELELASEPAEEEAFT 353

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEEL--LANKRILNF---- 529
             D  +    + E      ++     SEV+      + +   E    L    +  +    
Sbjct: 354 ELDELDLPEYTEEDALADAQLEPAAESEVEPELELASDLEEEEAFTELNELDLPEYTEED 413

Query: 530 LLESKGIDSQKVREDFLCEIFKSDLKDPKSF 560
            L    +D     E        S+  + ++F
Sbjct: 414 ALADAQLDPAAESEVEPELELASEPAEEEAF 444


>gi|171060409|ref|YP_001792758.1| outer membrane adhesin-like protein [Leptothrix cholodnii SP-6]
 gi|170777854|gb|ACB35993.1| outer membrane adhesin like proteiin [Leptothrix cholodnii SP-6]
          Length = 4231

 Score = 43.3 bits (100), Expect = 0.16,   Method: Composition-based stats.
 Identities = 36/452 (7%), Positives = 98/452 (21%), Gaps = 37/452 (8%)

Query: 81   DLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
            D+ D +S    L          S+D +               I     +       A + 
Sbjct: 2605 DVGDSRSYAATLADGSALPAWLSFDATTRTFSGTPANADVGTISVKLTAFDGALVSADDS 2664

Query: 141  SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
                  N++   ++     D+   +    S ++     +           + + + Y   
Sbjct: 2665 FDIVVANVNDAPTLAHAIADQAATEDSPFSLTVPADAFADV--------DVGDSRSYAAT 2716

Query: 201  SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLA 260
              D    A+     F              +  +  +   +              +     
Sbjct: 2717 LADG--SALPAWLSFDAATRTFSGTPA--NADVGTLSVKFTATDDSNASADDSFDIVVAN 2772

Query: 261  INSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHR 320
            +N   +  + + D    +       P +  + AD F  +   +    +            
Sbjct: 2773 VNDAPTLMNEIADQAATED-----SPFSLTVPADAFADVDVGDSRSYAATL--------A 2819

Query: 321  DNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQL 380
            D S+           +       N  +       +                N+ +     
Sbjct: 2820 DGSALPAWLSFDAATRTFSGTPANGDVGTISVKVTA-----------TDGSNVSADDSFD 2868

Query: 381  EGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS-NPSDPDSYANKSKDDRLIKLN 439
                +  +         D               +V    +  D  +Y     D   +   
Sbjct: 2869 IVVANVNDAPTVANPIADQAATEDSPFSFTVPADVFADVDVGDTRAYTATLADGSALPAW 2928

Query: 440  HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
             +F+       G                   +   +    +    N  +  +    +  +
Sbjct: 2929 LSFDATTRTFSGTPANGDVGTLSVKVTATDGSNASADDSFDIVVANVNDAPTLMNEVADQ 2988

Query: 500  INSEVDYYTLNINTIHSFEELLANKRILNFLL 531
              +E   ++  +      +  + + R     L
Sbjct: 2989 AATEDSLFSFTVPADAFADVDVGDTRAYTATL 3020



 Score = 41.0 bits (94), Expect = 0.83,   Method: Composition-based stats.
 Identities = 39/452 (8%), Positives = 98/452 (21%), Gaps = 37/452 (8%)

Query: 81   DLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEE 140
            D+ D ++    L          S+D +               I     +       A + 
Sbjct: 3312 DVGDTRAYTATLADGSALPAWLSFDATTRTFSGTPANGDVGTISVKVTATDGALASADDS 3371

Query: 141  SKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE 200
                  N++   ++     D+   +    SF++     +           + + + Y   
Sbjct: 3372 FDIVVANVNDAPTLAHAIADQAATEDSAFSFTVPADAFADV--------DVGDSRSYAAT 3423

Query: 201  SRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLA 260
              D    A+     F              D     + +     T     + S  + + + 
Sbjct: 3424 LADGS--ALPAWLSFDAATRTFSGTPANAD-----VGTLSVKVTATDGALASADDSFDIV 3476

Query: 261  INSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHR 320
            + +V+          +           +  + AD F  +   +    +            
Sbjct: 3477 VANVNDAPTL--AHAIADQAATEDSAFSFTVPADAFADVDVGDSRSYAATL--------A 3526

Query: 321  DNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQL 380
            D S+           +       N  +       +                N  +     
Sbjct: 3527 DGSALPAWLSFDAATRTFSGTPANADVGTISVKVTA-----------TDGSNAFADDSFD 3575

Query: 381  EGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS-NPSDPDSYANKSKDDRLIKLN 439
                   +         D               +V    +  D  SY     D   +   
Sbjct: 3576 IVVADVNDAPAVANPIADQAATEDSAFSFTVPADVFADVDVGDTRSYVATLADGSALPAW 3635

Query: 440  HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
             +FN       G                   +   +    +    +  +  +    I  +
Sbjct: 3636 LSFNPATRTFSGTPANADVGTISVKVTATDGSNASADDSFDIVVADVNDAPAVANPIADQ 3695

Query: 500  INSEVDYYTLNINTIHSFEELLANKRILNFLL 531
              +E   ++  +      +  + + R     L
Sbjct: 3696 AATEDSPFSFTVPADAFADVDVGDTRSYAATL 3727


>gi|331244633|ref|XP_003334956.1| stamen loss [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|309313946|gb|EFP90537.1| stamen loss [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 735

 Score = 42.9 bits (99), Expect = 0.19,   Method: Composition-based stats.
 Identities = 27/271 (9%), Positives = 71/271 (26%), Gaps = 33/271 (12%)

Query: 175 PKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIE 234
           P   S   +K+      A P  +  ++ D   +A+        + + S    +  +    
Sbjct: 116 PTKASTDTIKN---DDSAQPDDHQPQASDPTPQALIHREPLNQEPNQSSTAPVSPNTTSP 172

Query: 235 KIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE---- 290
           +  S+     +     + D      + +S+++  D  +    F  +  +     P     
Sbjct: 173 QNPSSDQEPGLTLQAHLPDLKDPSKSRSSLTTTEDLPQSIPDFNSVTEAHSAGPPTPPAI 232

Query: 291 -----ITADKFLTLMQEND-----PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL 340
                  +D+  +     D     P+     +    +F  D S     + +++ +     
Sbjct: 233 EFSSASVSDRRASAPPSADLLLPPPMKKFKPWEALKSFQTDGSDVVPPRSEARSEAPKAG 292

Query: 341 YKKNCQILHDDKMQSLIKDYQ---------------LPLGKIKSIDNLLSG-KCQLEGPN 384
              +       + +      +                 +     +  L S      E   
Sbjct: 293 GSTSTTEEGKSRSEKSKGKKREGTGSGAESAGLKRGRDVFSSSDLTELSSSLTDLSEEEF 352

Query: 385 SAEEPIITLQFALDAYNLNMQDLDRDQLRNV 415
           S ++             +    L    +R V
Sbjct: 353 SEQQRSSASSVIYSEVEIEDDCLPDVLVRKV 383


>gi|145478469|ref|XP_001425257.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124392326|emb|CAK57859.1| unnamed protein product [Paramecium tetraurelia]
          Length = 547

 Score = 42.9 bits (99), Expect = 0.20,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 48/122 (39%), Gaps = 5/122 (4%)

Query: 11  SKDIQSKLFS-TVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSH 69
           S+DIQSK  +  V            Y ++I    T    I D++L  Y  K   L +  +
Sbjct: 33  SRDIQSKHKNCNVLPYKEFVESIENYTDQIFPSETFK--IYDQKLKQYLKKINKLQEEVN 90

Query: 70  AEKFIKKILESDLSDPKSLVNQLNS--LKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYK 127
            +  +   ++ +L++     N+L     +++      +F    K  QS  Q KTI    +
Sbjct: 91  DKSLMFNKIKKELNNANVQKNKLQQLLQQFKDKTTQLNFELLEKTYQSSKQQKTIDNVQR 150

Query: 128 QS 129
             
Sbjct: 151 NQ 152


>gi|308178435|ref|YP_003917841.1| cell surface protein [Arthrobacter arilaitensis Re117]
 gi|307745898|emb|CBT76870.1| putative cell surface protein [Arthrobacter arilaitensis Re117]
          Length = 1584

 Score = 42.5 bits (98), Expect = 0.24,   Method: Composition-based stats.
 Identities = 39/374 (10%), Positives = 87/374 (23%), Gaps = 10/374 (2%)

Query: 146  KNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIE---SR 202
             N       +         D      +      +     DV T   A+          + 
Sbjct: 638  DNADANTDANTDANTDANTDVNTADNADANTDANTDVNTDVNTADNADANTDANTDVNTA 697

Query: 203  DNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAIN 262
            DN       N     D + +      TD   +       ++  D     ++ +    A  
Sbjct: 698  DNADANTDANTDANTDVNTADNADANTDANTDANTDVNTDDNADANT-DANTDANTDANT 756

Query: 263  SVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDN 322
             V++  +   +                        T    +    +        N   + 
Sbjct: 757  DVNTDDNTDANTDANTDANTDANTDVNTDDNTDANTDANTDANTDANTDVNTDDNTDANT 816

Query: 323  SSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEG 382
             ++T    D+      D         + D       D         + D           
Sbjct: 817  DANTDANTDANTDVNTDDNTDANTDANTDANTDANTDVNTDENTDANTDANTDANTDANT 876

Query: 383  PNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAF 442
              + +        A    N +          +V T + +D ++  N    D     N   
Sbjct: 877  DVNTDVNTDENTDANTDANTDANTDANT---DVNTDDNTDANTDVNT---DDNTDANTDA 930

Query: 443  NFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINS 502
            N +A+  +       +      +V    N   +  D  + + ++    +T    ++    
Sbjct: 931  NTDANTDVNTADNADANTDANTDVNTDVNTDVNTADNADANTDANTDANTDANTDVNTAD 990

Query: 503  EVDYYTLNINTIHS 516
              D  T      ++
Sbjct: 991  NADANTDANTDANT 1004


>gi|212536536|ref|XP_002148424.1| presequence translocase-associated motor subunit Pam17, putative
           [Penicillium marneffei ATCC 18224]
 gi|210070823|gb|EEA24913.1| presequence translocase-associated motor subunit Pam17, putative
           [Penicillium marneffei ATCC 18224]
          Length = 264

 Score = 42.5 bits (98), Expect = 0.26,   Method: Composition-based stats.
 Identities = 31/235 (13%), Positives = 70/235 (29%), Gaps = 8/235 (3%)

Query: 296 FLTLMQENDPIVSQVKYFFQINFHRDNSSST--KIQQDSQIQKMLDLYKKNCQILHDDKM 353
           F      +     Q        F    S+               +   K+         +
Sbjct: 28  FHLTGSSSAAAPQQAMKRSVNRFSTKCSAPNQKSPISSFARANRVSFNKETKLTNSQVII 87

Query: 354 QSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLR 413
            SL +++   +G      + +S    L+     +      +++L +  L         ++
Sbjct: 88  TSLRRNFSSSVGLRAKQSSNISNTALLDWNTFFKLRASRRRYSLVSSILASIATTAVGVQ 147

Query: 414 NVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRK 473
            + T +     +         ++ L  A    A G +    +  +   +      Y   +
Sbjct: 148 VLSTQDLDTLGAQVMGLDPFIVLGLATAAC-GALGWLIGPVLGNTVWGLV-----YRQYR 201

Query: 474 RSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN 528
             I   E + FN +++       N   N   DYY   I ++  + + L ++R  N
Sbjct: 202 GGIAIKEKEFFNRIKRFRVDPSANSIANPVPDYYGEKIGSVQGYRQWLKDQRAYN 256


>gi|307204486|gb|EFN83174.1| Protein translocase subunit secA [Harpegnathos saltator]
          Length = 3680

 Score = 42.5 bits (98), Expect = 0.26,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 28/69 (40%), Gaps = 8/69 (11%)

Query: 27   IVSCEERYYRERIKH--ISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSD 84
            IVS   +     I    +  ID+ ++D  + +    A+ +    +A+  I      DL++
Sbjct: 3013 IVSRYIQKMCRNIGSSMVQEIDKAVEDHIISNTLKTAYQMLGQQNAKAMI-----EDLTN 3067

Query: 85   PKSLVNQLN 93
                 N+L 
Sbjct: 3068 DN-FANRLT 3075


>gi|291008395|ref|ZP_06566368.1| LuxR family transcriptional regulator [Saccharopolyspora erythraea
           NRRL 2338]
          Length = 340

 Score = 42.5 bits (98), Expect = 0.28,   Method: Composition-based stats.
 Identities = 39/312 (12%), Positives = 77/312 (24%), Gaps = 24/312 (7%)

Query: 355 SLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRN 414
           +     +     +  + +L+     +    S           L A            LR 
Sbjct: 21  ASASVLERAEQLVHLLRDLVRCDAVM-LTASNPFAPTPQHELLAADG-----YSDAALRR 74

Query: 415 VLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKR 474
           +L     D ++ A     +R+       +   D +I       +   +     H      
Sbjct: 75  LLDDFVPDTENPAFHLVRNRVRSALRWSDLARDWNIRFAVTSIAEQHLIPAGFHEGLTSS 134

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILN------ 528
                 +         ST +    +    V+ +   +       +LL   R+L       
Sbjct: 135 LSLPDGSHVGAVHMNWSTSRAATDDRRRTVEQFRPLLAG---TSDLLQPYRVLADEVYGD 191

Query: 529 --FLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTY-KDNRYKEIISSFNFDIHGELS 585
               L   G++ +    D    +       P    +   +D RY  I  +  F       
Sbjct: 192 AHVALIGAGLEQRIPGRDVGPILRSEGPLWPLLLTSVPHRDGRYIWIDEAGTFHRIDLTR 251

Query: 586 HKKIGKVQDNFHIDDTCDLYKHQ----MIEKKEEEKDPNIALALYFKRTIPNIRNHYEIL 641
                 +          DL   +     +       +P IA AL   R   +  +   IL
Sbjct: 252 CAGATVLVAERETPAPYDLTVRELQIVTL-LAVGASNPEIADALVVSRRTVS-THVEHIL 309

Query: 642 GDSKLFKVVSKK 653
               +       
Sbjct: 310 AKLAVASRAEVA 321


>gi|325105127|ref|YP_004274781.1| Fibronectin type III domain protein [Pedobacter saltans DSM 12145]
 gi|324973975|gb|ADY52959.1| Fibronectin type III domain protein [Pedobacter saltans DSM 12145]
          Length = 2560

 Score = 42.1 bits (97), Expect = 0.31,   Method: Composition-based stats.
 Identities = 29/307 (9%), Positives = 70/307 (22%), Gaps = 19/307 (6%)

Query: 88   LVNQLNSLKYQYFARSYDFSPPPKVIQS------DIQHKTIIQDYKQSHQHKEEVALEES 141
            L + L    Y   A++ D +       S      D    ++      S   K+E A    
Sbjct: 1409 LASALTDGAYSITAKATDIAGNVSSASSAIAITIDTTKPSVAITSSVSTLKKDETATITF 1468

Query: 142  KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
             +         S D +     L        + T  +     + +           Y   +
Sbjct: 1469 TFSEDPGSSFTSADIIISGGTLSALSGTGTTRTATFTPTANVDEGTVSITIAAGSYTDIA 1528

Query: 202  RDNRFRAMAENFRFQPD-GSLSKRDKILTDMQIEKIVSNYFNNTI-------DCVPIVSD 253
             +        +  +     ++      + D Q   +       T                
Sbjct: 1529 GNTGLAGTTPSLTYDTKAPAVPTGLTAIFDNQQSVLNWTANTETDLSSYKIYSGTSANPT 1588

Query: 254  QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYF 313
                 +   +V+     L +   +     ++     E T    +T + E    ++     
Sbjct: 1589 TLLATVTKPTVTYTDTGLTNGTTYYYRITAVDQAGNESTYSTEVTAIPEAAQTITFNALT 1648

Query: 314  FQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS-LIKDYQLPLGKIKSIDN 372
                      +       +     +     N  +      +  ++      +   +S DN
Sbjct: 1649 A----KTYGDADFDAGAATTSGLTISYNSDNTSVATIVSGKIHIVGAGTANITASQSGDN 1704

Query: 373  LLSGKCQ 379
                   
Sbjct: 1705 FYKAAAD 1711


>gi|311106246|ref|YP_003979099.1| major facilitator protein [Achromobacter xylosoxidans A8]
 gi|310760935|gb|ADP16384.1| major facilitator superfamily protein 26 [Achromobacter
           xylosoxidans A8]
          Length = 396

 Score = 42.1 bits (97), Expect = 0.34,   Method: Composition-based stats.
 Identities = 17/98 (17%), Positives = 32/98 (32%), Gaps = 14/98 (14%)

Query: 564 YKDNRYKEIISSFN--FDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNI 621
             D R+  +  +F+  F   G L       + +   + +T   Y    +          +
Sbjct: 201 LADRRFAALAIAFSLIFAAQGFLIGAAPDFIANVLSLPETDFAYLFVPLVIGA------M 254

Query: 622 ALALYFKRTIPNIRN------HYEILGDSKLFKVVSKK 653
           A AL+  R      +       Y ++G S L  V+   
Sbjct: 255 AGALFAARKAGRWSDHRITWLAYALMGGSCLASVIYAA 292


>gi|300173313|ref|YP_003772479.1| dextransucrase [Leuconostoc gasicomitatum LMG 18811]
 gi|299887692|emb|CBL91660.1| Dextransucrase [Leuconostoc gasicomitatum LMG 18811]
          Length = 1526

 Score = 42.1 bits (97), Expect = 0.36,   Method: Composition-based stats.
 Identities = 42/410 (10%), Positives = 105/410 (25%), Gaps = 31/410 (7%)

Query: 104 YDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRL 163
           +D         +D Q K  +     S      V       F +    +        D   
Sbjct: 261 FDKETGLLSATNDYQFKQGLTSQNNSFTAHNAVENTTKDSFTEIDGYLT------ADSWY 314

Query: 164 LDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSK 223
               +          S    + +L     +           +   ++ +       +  +
Sbjct: 315 RPKDILVNGKDWTTSSDKDFRPLLMSWWPDKMTQVNYLNYMKTLGLSNS-SVNFSANDDQ 373

Query: 224 RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLS 283
                    I+  +    +       +  D + +  + ++ +  S+              
Sbjct: 374 SILNQASQDIQVKIEQKISQEGQTNWLQHDISDFVDSQSNWNINSE---------YQTTG 424

Query: 284 LFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKK 343
               + +  A +++   +  D               +  SS +          +L     
Sbjct: 425 NDKDHLQGGALRYVNSDKTPDANSDYRLLNRTPTNQKGYSSYSIDPTQGGYDFLLANDVD 484

Query: 344 NCQILHDDKMQSLIKDYQLPLGKIKSID---NLLSGKCQLEGPNSAEEPIITLQFALDAY 400
           N   +     Q     Y L  G I + D   N    +        A+   I   +   AY
Sbjct: 485 NSNPVVQ-AEQLNWMYYLLNFGSITNQDADANFDGIRVDAVDNVDADLLQIASDYMKAAY 543

Query: 401 NLNMQDLDRDQLRNVLTSNPSDPDSYA-----NKSKDDRLIKLNHAFNFNADGSIGPIPM 455
            ++  D   +Q  ++L     +  +Y      N+   D  ++L   ++      +     
Sbjct: 544 GVDKNDATANQHLSILEDWSDNDAAYVKDQGNNQLSMDNKLRLALKYS------LTMPLT 597

Query: 456 MQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVD 505
            Q    IR  ++            ++    +    S  +  + E+ + + 
Sbjct: 598 DQKGTAIRSGLEPLITNSLVDRTTDSTDNIAQPNYSFVRAHDSEVQTVIA 647


>gi|259147510|emb|CAY80762.1| Tah11p [Saccharomyces cerevisiae EC1118]
          Length = 604

 Score = 42.1 bits (97), Expect = 0.38,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 57/150 (38%), Gaps = 14/150 (9%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
            P +D  + L +       V   E +Y++ I    + DE + D   F    +       S
Sbjct: 385 LPKRDNLTTLTNKSRTLAFVERAESWYQQVIA---SKDEIMTDVPAFKINKR----RSSS 437

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ 128
           +++     +L S +    S  N LN+ +Y   ++  +F    K    D Q   + +  ++
Sbjct: 438 NSKT----VLSSKVQAKSSNANALNNSRYLANSKE-NFMYKEK--MPDSQANLMDRLRER 490

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             +    ++  + +Y +    K+  V  + 
Sbjct: 491 ERRSAALLSQRQKRYQQFLAMKMTQVFDIL 520


>gi|71733491|ref|YP_273779.1| hypothetical protein PSPPH_1525 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71554044|gb|AAZ33255.1| hypothetical protein PSPPH_1525 [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 2571

 Score = 41.7 bits (96), Expect = 0.41,   Method: Composition-based stats.
 Identities = 44/519 (8%), Positives = 111/519 (21%), Gaps = 51/519 (9%)

Query: 83  SDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ-SHQHKEEVALEES 141
               +L ++L   +      + D              + +       S         + +
Sbjct: 464 DAANALASRLADER--GLRNALD-------------PQGVANALNALSKWPDTPHCADAA 508

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
                 +     +      + L +  L + S  P         + L   L + +      
Sbjct: 509 NALASRLADERGLRNALNPQELTN-ALNALSKWPDTPDCADAANALASRLIDNRDLRNAL 567

Query: 202 RDNRFRAMAENFRF---QPDGSLSKRDKILTDMQIEKIVSNYFNN--------------T 244
                  +          PD   +             + +                   T
Sbjct: 568 NPQGVANVLNALSKWHGTPDCEAAASALASRLANDRDLRNALNPQELAKTLNALSKWPDT 627

Query: 245 IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND 304
            DC    +          S+ +  D          L       +    A+   + +  + 
Sbjct: 628 RDCADAANALASRLANERSLRNALDPQGVANALNALSKWPGTPDCADAANALASRLANDH 687

Query: 305 PIV------SQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK 358
            +               ++   D             +   +   +N             +
Sbjct: 688 ELRNALNPQGVANVLNALSKWPDTPDCADAANALASRLADERSLRNALTPQGVVNVLNAQ 747

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
                     ++   L+ +               L  AL+A +      D     N L S
Sbjct: 748 SKWPDTPDCAAVACALASRLANNRDLRNALTPQELANALNALSKWPDTPDCADAANALAS 807

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
             ++     N        +L +A N                  ++      AN +  ++ 
Sbjct: 808 RRANERDLRNALTPQ---ELANALN----AMSKWPDTPDCTAAVKTLASQLANDRHLLNA 860

Query: 479 AENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDS 538
              +   +     ++     +     +     +         L  + + N  L +     
Sbjct: 861 LTPQHMTNALNALSKWPGTPDCADAANALASRLAKDRELRNALNPQELAN-ALNALSKWP 919

Query: 539 QKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
                        S L + +   N       +E+ ++ N
Sbjct: 920 DTPDCADAANALASRLANDRELRNALNP---QELANALN 955


>gi|151945114|gb|EDN63365.1| conserved protein [Saccharomyces cerevisiae YJM789]
          Length = 604

 Score = 41.7 bits (96), Expect = 0.42,   Method: Composition-based stats.
 Identities = 27/150 (18%), Positives = 57/150 (38%), Gaps = 14/150 (9%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
            P +D  + L +       V   E +Y++ I    + DE + D   F    +       S
Sbjct: 385 LPKRDNLTTLTNKSRTLAFVERAESWYQQVIA---SKDEIMTDVPAFKINKR----RSSS 437

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ 128
           +++     +L S +    S  N LN+ +Y   ++  +F    K    D Q   I +  ++
Sbjct: 438 NSKT----VLSSKVQTKSSNANALNNSRYLANSKE-NFMYKEK--MPDSQANLIDRLRER 490

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             +    ++  + +Y +    K+  V  + 
Sbjct: 491 ERRSAALLSQRQKRYQQFLAMKMTQVFDIL 520


>gi|190409523|gb|EDV12788.1| hypothetical protein SCRG_03698 [Saccharomyces cerevisiae RM11-1a]
 gi|256270800|gb|EEU05951.1| Tah11p [Saccharomyces cerevisiae JAY291]
          Length = 604

 Score = 41.7 bits (96), Expect = 0.46,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 57/150 (38%), Gaps = 14/150 (9%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
            P +D  + L +       V   E +Y++ I    + DE + D   F    +       S
Sbjct: 385 LPKRDNLTTLTNKSRTLAFVERAESWYQQVIA---SKDEIMTDVPAFKINKR----RSSS 437

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ 128
           +++     +L S +    S  N LN+ +Y   ++  +F    K    D Q   + +  ++
Sbjct: 438 NSKT----VLSSKVQTKSSNANALNNSRYLANSKE-NFMYKEK--MPDSQANLMDRLRER 490

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             +    ++  + +Y +    K+  V  + 
Sbjct: 491 ERRSAALLSQRQKRYQQFLAMKMTQVFDIL 520


>gi|6322506|ref|NP_012580.1| Tah11p [Saccharomyces cerevisiae S288c]
 gi|1352882|sp|P47112|YJ16_YEAST RecName: Full=Uncharacterized protein YJR046W
 gi|1015703|emb|CAA89574.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|1197074|gb|AAA88748.1| ORF; putative [Saccharomyces cerevisiae]
 gi|285812935|tpg|DAA08833.1| TPA: Tah11p [Saccharomyces cerevisiae S288c]
          Length = 604

 Score = 41.7 bits (96), Expect = 0.47,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 57/150 (38%), Gaps = 14/150 (9%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
            P +D  + L +       V   E +Y++ I    + DE + D   F    +       S
Sbjct: 385 LPKRDNLTTLTNKSRTLAFVERAESWYQQVIA---SKDEIMTDVPAFKINKR----RSSS 437

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ 128
           +++     +L S +    S  N LN+ +Y   ++  +F    K    D Q   + +  ++
Sbjct: 438 NSKT----VLSSKVQTKSSNANALNNSRYLANSKE-NFMYKEK--MPDSQANLMDRLRER 490

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             +    ++  + +Y +    K+  V  + 
Sbjct: 491 ERRSAALLSQRQKRYQQFLAMKMTQVFDIL 520


>gi|323354242|gb|EGA86085.1| Tah11p [Saccharomyces cerevisiae VL3]
          Length = 604

 Score = 41.7 bits (96), Expect = 0.48,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 57/150 (38%), Gaps = 14/150 (9%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
            P +D  + L +       V   E +Y++ I    + DE + D   F    +       S
Sbjct: 385 LPKRDNLTTLTNKSRTLAFVERAESWYQQVIA---SKDEIMTDVPAFKINKR----RSSS 437

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ 128
           +++     +L S +    S  N LN+ +Y   ++  +F    K    D Q   + +  ++
Sbjct: 438 NSKT----VLSSKVQTKSSNANALNNSRYLANSKE-NFMYKEK--MPDSQANLMDRLRER 490

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             +    ++  + +Y +    K+  V  + 
Sbjct: 491 ERRSAALLSQRQKRYQQFLAMKMTQVFDIL 520


>gi|323347854|gb|EGA82115.1| Tah11p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 604

 Score = 41.7 bits (96), Expect = 0.49,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 57/150 (38%), Gaps = 14/150 (9%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
            P +D  + L +       V   E +Y++ I    + DE + D   F    +       S
Sbjct: 385 LPKRDNLTTLTNKSRTLAFVERAESWYQQVIA---SKDEIMTDVPAFKINKR----RSSS 437

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ 128
           +++     +L S +    S  N LN+ +Y   ++  +F    K    D Q   + +  ++
Sbjct: 438 NSKT----VLSSKVQXKSSNANALNNSRYLANSKE-NFMYKEK--MPDSQANLMDRLRER 490

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             +    ++  + +Y +    K+  V  + 
Sbjct: 491 ERRSAALLSQRQKRYQQFLAMKMTQVFDIL 520


>gi|309389689|gb|ADO77569.1| ErfK/YbiS/YcfS/YnhG family protein [Halanaerobium praevalens DSM
           2228]
          Length = 546

 Score = 41.7 bits (96), Expect = 0.52,   Method: Composition-based stats.
 Identities = 23/139 (16%), Positives = 51/139 (36%), Gaps = 14/139 (10%)

Query: 524 KRILNFLLESK--GIDSQKVREDFLCEIFKSDLK----DPKSFANTYKDNRYKEIISSF- 576
           K +L  +  S   G+D +     ++ + F+SDL       K+  +    + Y ++ S + 
Sbjct: 81  KALLTAIQNSYQEGLDPEVYHLAYIKKAFESDLNTNSIAKKALLDILLTDAYLDLASDYL 140

Query: 577 ----NFDIHGELSHKKIGKVQDNFHIDDTCDL-YKHQMIEKKE--EEKDPNIALALYFKR 629
               N +I  E ++ +   +Q    ++         + +       +    +   L++ R
Sbjct: 141 NGKINAEIIIEDNNYQADSLQSKKLLNALLAKENIEESLNSNLPKTKAYQKLREKLFYYR 200

Query: 630 TIPNIRNHYEILGDSKLFK 648
               I    +I G   L K
Sbjct: 201 DSGQINAWPQIKGKQILTK 219


>gi|320325195|gb|EFW81262.1| hypothetical protein PsgB076_07207 [Pseudomonas syringae pv.
           glycinea str. B076]
          Length = 2422

 Score = 41.4 bits (95), Expect = 0.53,   Method: Composition-based stats.
 Identities = 44/519 (8%), Positives = 111/519 (21%), Gaps = 51/519 (9%)

Query: 83  SDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ-SHQHKEEVALEES 141
               +L ++L   +      + D              + +       S         + +
Sbjct: 320 DAANALASRLADER--GLRNALD-------------PQGVANALNALSKWPDTPHCADAA 364

Query: 142 KYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIES 201
                 +     +      + L +  L + S  P         + L   L + +      
Sbjct: 365 NALASRLADERGLRNALNPQELTN-ALNALSKWPDTPDCADAANALASRLIDNRDLRNAL 423

Query: 202 RDNRFRAMAENFRF---QPDGSLSKRDKILTDMQIEKIVSNYFNN--------------T 244
                  +          PD   +             + +                   T
Sbjct: 424 NPQGVANVLNALSKWHGTPDCEAAASALASRLANDRDLRNALNPQELAKTLNALSKWPDT 483

Query: 245 IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND 304
            DC    +          S+ +  D          L       +    A+   + +  + 
Sbjct: 484 RDCADAANALASRLANERSLRNALDPQGVANALNALSKWPGTPDCADAANALASRLANDH 543

Query: 305 PIV------SQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIK 358
            +               ++   D             +   +   +N             +
Sbjct: 544 ELRNALNPQGVANVLNALSKWPDTPDCADAANALASRLADERSLRNALTPQGVVNVLNAQ 603

Query: 359 DYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTS 418
                     ++   L+ +               L  AL+A +      D     N L S
Sbjct: 604 SKWPDTPDCAAVACALASRLANNRDLRNALTPQELANALNALSKWPDTPDCADAANALAS 663

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHD 478
             ++     N        +L +A N                  ++      AN +  ++ 
Sbjct: 664 RRANERDLRNALTPQ---ELANALN----AMSKWPDTPDCTAAVKTLASQLANDRHLLNA 716

Query: 479 AENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDS 538
              +   +     ++     +     +     +         L  + + N  L +     
Sbjct: 717 LTPQHMTNALNALSKWPGTPDCADAANALASRLAKDRELRNALNPQELAN-ALNALSKWP 775

Query: 539 QKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFN 577
                        S L + +   N       +E+ ++ N
Sbjct: 776 DTPDCADAANALASRLANDRELRNALNP---QELANALN 811


>gi|323332857|gb|EGA74260.1| Tah11p [Saccharomyces cerevisiae AWRI796]
          Length = 298

 Score = 41.4 bits (95), Expect = 0.65,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 55/150 (36%), Gaps = 14/150 (9%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
            P +D  + L +       V   E +Y++ I    + DE + D   F    +        
Sbjct: 143 LPKRDNLTTLTNKSRTLAFVERAESWYQQVIA---SKDEIMTDVPAFKINKR-------- 191

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ 128
            +    K +L S +    S  N LN+ +Y   ++  +F    K    D Q   + +  ++
Sbjct: 192 RSSSNSKTVLSSKVQTKSSNANALNNSRYLANSKE-NFMYKEK--MPDSQANLMDRLRER 248

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             +    ++  + +Y +    K+  V  + 
Sbjct: 249 ERRSAALLSQRQKRYQQFLAMKMTQVFDIL 278


>gi|323304244|gb|EGA58018.1| Tah11p [Saccharomyces cerevisiae FostersB]
          Length = 604

 Score = 41.4 bits (95), Expect = 0.66,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 56/150 (37%), Gaps = 14/150 (9%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
            P +D  + L +       V   E +Y++ I    + DE + D   F    +       S
Sbjct: 385 LPKRDNLTTLTNKSRTLAFVERAESWYQQVIA---SKDEIMTDVPAFKINKR----RSSS 437

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ 128
           +++     +L S +    S  N LN+ +Y   ++  +F    K    D Q     +  ++
Sbjct: 438 NSKT----VLSSKVQTKSSNANALNNSRYLANSKE-NFMYKEK--MPDSQANLXDRLRER 490

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             +    ++  + +Y +    K+  V  + 
Sbjct: 491 ERRSAALLSQRQKRYQQFLAMKMTQVFDIL 520


>gi|157123386|ref|XP_001660147.1| cadherin [Aedes aegypti]
 gi|108884540|gb|EAT48765.1| cadherin [Aedes aegypti]
          Length = 3478

 Score = 41.0 bits (94), Expect = 0.69,   Method: Composition-based stats.
 Identities = 33/300 (11%), Positives = 83/300 (27%), Gaps = 15/300 (5%)

Query: 261 INSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHR 320
           + + +S    L D   F+++           T    + ++  ND   S     F  +   
Sbjct: 420 VTTAASLDRELMDVHYFRVIATDDSFPPRSGTTTLQVNVLDCNDHTPSFESEEFLASIRE 479

Query: 321 DNSSSTKIQQDSQIQKMLD-LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQ 379
             S  + +       + +         IL  +   S          +I +    +S +  
Sbjct: 480 GVSVGSTVITIRATDQDIGKNADIEYAILSINGDGSATNGQDEQAFRIDARSGTISTRSA 539

Query: 380 LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
           L+   S    +I     +       +      +  +L     D D+Y   S+    ++++
Sbjct: 540 LDRETSEMYKLIVSASDMATLQTERRSATATVIVKIL----DDNDNYPQFSERTYTVQVS 595

Query: 440 HAFNFNADGSIGPIPMMQSRLTIRDNVKHYA---NRKRSIHDAENKSFNSMEQISTQKRI 496
               +  + ++             +    YA      +S    ++ S +           
Sbjct: 596 ED-QWTNENNVITHIQATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYES 654

Query: 497 NLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKD 556
                  +        +  +  +LL N      +L++     +     F   + +S    
Sbjct: 655 VRSYRLVIRAQDGGSPSRSNTTQLLVN------VLDANDNAPRFYTSQFQEAVLESVPVG 708


>gi|229529908|ref|ZP_04419298.1| AAA ATPase [Vibrio cholerae 12129(1)]
 gi|229333682|gb|EEN99168.1| AAA ATPase [Vibrio cholerae 12129(1)]
          Length = 1690

 Score = 41.0 bits (94), Expect = 0.73,   Method: Composition-based stats.
 Identities = 62/519 (11%), Positives = 150/519 (28%), Gaps = 33/519 (6%)

Query: 107  SPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINS---VDQLFKD--- 160
            +    V    +  +   + + +  + ++     ES        + NS   +D L      
Sbjct: 656  ATEFSVAPEKLSVEDGTELFDELLEIEQHPEPAESLPELATEDEFNSDTFIDDLLNSAPA 715

Query: 161  -RRLLDYVLQ---SFSITPKYISLPFLKDVLTLGLANPKKY-FIESRDNRFRAMAENFRF 215
               LL+ VL    +F+    +   P ++  L   L  P      E    +         F
Sbjct: 716  KDPLLEPVLDENEAFAQADDFDFNPEIEGGLEDDLPQPSALPANEFGTPQDEDWV----F 771

Query: 216  QPDGSLSK--RDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKD 273
              D S      +  L     E  +      T +    +      +   N+V +  D L  
Sbjct: 772  DEDDSSPTLEGNAELELSSAEDDLPEQTTATNETADELLADLAAQPQSNTVDTSDDALAP 831

Query: 274  PKLFKMLQLSLFPLNPEIT--ADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQD 331
              L + ++ SL   + E+    D+             + +   +I    +  ++     +
Sbjct: 832  DALSQSVEESLTLNDLELPEENDEPQLAEVTPSSAFDEQQVETEIEPESEPLAAEASNDE 891

Query: 332  SQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPII 391
            S +  + +L               L    +  +     + +    +      +  + P  
Sbjct: 892  SDLTALNELDLPEYTEEDALADAQLEPATESEVEPELELASEPVEEEAFTELDELDLPEY 951

Query: 392  TLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYA--NKSKDDRLIKLNHAFNFNADGS 449
            T + AL    L        +    L S+  + +++   N+       + +      AD  
Sbjct: 952  TEEDALADAQLEPAVESEVEPELELASDLDEEEAFTELNELDLPEYTEEDAL----ADAQ 1007

Query: 450  IGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTL 509
            + P    +    +    +       +  D  +    + E      ++     SEV+    
Sbjct: 1008 LEPAAESEVEPELELASEPAEEEAFTELDELDLPEYTEEDALADAQLEPAAESEVEPELE 1067

Query: 510  NINTIHSFEEL--LANKRILNF----LLESKGIDSQKVREDFLCEIFKSDLKDPKSF--A 561
              + +   E    L    +  +     L    ++     E        S L++ ++F   
Sbjct: 1068 LASDLEEEEAFTELNELDLPEYTEEDALADAQLEPAAESEVEPELELASVLEEEEAFTEL 1127

Query: 562  NTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
            N      Y E  +  +  +      +   +++    +++
Sbjct: 1128 NKLDLPEYTEEDALADAQLEPAAESEVESELELASDLEE 1166


>gi|134291167|ref|YP_001114936.1| diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF
           sensor(s) [Burkholderia vietnamiensis G4]
 gi|134134356|gb|ABO58681.1| diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF
           sensor(s) [Burkholderia vietnamiensis G4]
          Length = 913

 Score = 41.0 bits (94), Expect = 0.82,   Method: Composition-based stats.
 Identities = 32/203 (15%), Positives = 68/203 (33%), Gaps = 25/203 (12%)

Query: 500 INSEVDYYTLNINT----IHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLK 555
           +  ++ Y+   I+     I S ++L+  ++     L   G+         L E+ +  + 
Sbjct: 461 VRDDLTYHICVISDLTELIDSRDQLV--RQARRDALT--GL----PNRATLRELIEQAVA 512

Query: 556 DPKSFANTYKD-NRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKE 614
           + ++FA  + D +R K+I  S        L  +   ++      D T   Y         
Sbjct: 513 ERRAFALLFMDVDRLKDINDSLGHGAGDRLLREVAQRLSGCVGEDGTVTRYGGDEFVAML 572

Query: 615 EEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKL---SPYFAVLPERKKIRI 671
              D    LA   +R    +    +I GD++    V   + +         L        
Sbjct: 573 GRPDDGDRLAALLRRIARALERPVQI-GDAQSR--VQLSIGVACYPAD--GLD----AET 623

Query: 672 LKKHIKINDFKDSKKVEDFLYAA 694
           L KH  +  ++   +  + +   
Sbjct: 624 LLKHADLAMYQAKARGRNTVELF 646


>gi|207343865|gb|EDZ71193.1| YJR046Wp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 294

 Score = 41.0 bits (94), Expect = 0.87,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 55/150 (36%), Gaps = 14/150 (9%)

Query: 9   FPSKDIQSKLFSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMS 68
            P +D  + L +       V   E +Y++ I    + DE + D   F    +        
Sbjct: 75  LPKRDNLTTLTNKSRTLAFVERAESWYQQVIA---SKDEIMTDVPAFKINKR-------- 123

Query: 69  HAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQ 128
            +    K +L S +    S  N LN+ +Y   ++  +F    K    D Q   + +  ++
Sbjct: 124 RSSSNSKTVLSSKVQTKSSNANALNNSRYLANSKE-NFMYKEK--MPDSQANLMDRLRER 180

Query: 129 SHQHKEEVALEESKYFRKNIHKINSVDQLF 158
             +    ++  + +Y +    K+  V  + 
Sbjct: 181 ERRSAALLSQRQKRYQQFLAMKMTQVFDIL 210


>gi|291455903|ref|ZP_06595293.1| hypothetical membrane protein [Bifidobacterium breve DSM 20213]
 gi|291382312|gb|EFE89830.1| hypothetical membrane protein [Bifidobacterium breve DSM 20213]
          Length = 720

 Score = 40.6 bits (93), Expect = 0.90,   Method: Composition-based stats.
 Identities = 39/382 (10%), Positives = 101/382 (26%), Gaps = 28/382 (7%)

Query: 73  FIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQH 132
           F K I  + L    SL +QL++   +    +++ +      Q +     +      +   
Sbjct: 166 FAKTITSAGLEIASSLADQLSTPAVKEQLNTFNTNIAGFATQLESTADLLGTYGSLTDSA 225

Query: 133 KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA 192
              +    +   + +         L   ++ +  V  + S T + +S        +   A
Sbjct: 226 GALLDTANALITQASSAAQQGSTDLKGAKQGVSDVAGALSTTTEAMSNALDTSA-SSFGA 284

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVS 252
                     D    A       +   +   +       +I   ++    +    V  + 
Sbjct: 285 VSDSIDKLYADANSGATTTADELEHQATAVGKQTAQY-TEIRNTLAGLLGDDSSIVKALD 343

Query: 253 DQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKY 312
                              +  +L + L  +   +       +      +N     +   
Sbjct: 344 R---------------SITRQTRLQQALNTTASDI-------RQGNQDAQNQRAQVKDLA 381

Query: 313 FFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDN 372
               N     ++        QI+ +         +L     +       L        D+
Sbjct: 382 KQAQNSIASITADYASNVQPQIESLSATVADASSVLDTSAAKLNTTLGDLRSTS-SDADS 440

Query: 373 LLSGKCQLEGPNSAEEPIITLQFALDAY-NLNMQDLDRDQLRNVLTSNPSDPDSYANKSK 431
           +L+         + +    + +  L ++     + L+   +  V     +DP++ A+   
Sbjct: 441 MLADAHATLDKVANKLRSASSE--LTSFNGKLSEALNSGDMSMVKEVLGNDPETLASTLA 498

Query: 432 DDRLIKLNHAFNFNADGSIGPI 453
               +K    F     GS    
Sbjct: 499 APVQLKRKAVFPVANFGSSMAP 520


>gi|310789542|gb|EFQ25075.1| eukaryotic translation initiation factor 3 subunit 8 [Glomerella
           graminicola M1.001]
          Length = 865

 Score = 40.6 bits (93), Expect = 0.97,   Method: Composition-based stats.
 Identities = 19/163 (11%), Positives = 47/163 (28%), Gaps = 6/163 (3%)

Query: 393 LQFALDAYNLN-MQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIG 451
            ++ L   +L   Q+     +   L      P       +D+    +      + +  I 
Sbjct: 414 YEYLLKDADLEIPQESINRIVTRRLEHVYFKPAQVVKILEDNCWKNVPS----DVESVIT 469

Query: 452 PIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINS-EVDYYTLN 510
           P    Q    + + + +Y                 +  ++         +   + +   N
Sbjct: 470 PRDQAQDASNLVNVLCNYLFTHAEGILRARAMLCQVYFLALHDEYYKARDMMLMSHLQEN 529

Query: 511 INTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSD 553
           I       ++L N+ ++   L +         ++ L EI  S 
Sbjct: 530 IPNFDVLSQILYNRTLVQVGLCAFRQGLVYDAQNTLQEICGSG 572


>gi|116074127|ref|ZP_01471389.1| cell wall surface anchor family protein [Synechococcus sp. RS9916]
 gi|116069432|gb|EAU75184.1| cell wall surface anchor family protein [Synechococcus sp. RS9916]
          Length = 7750

 Score = 40.6 bits (93), Expect = 1.0,   Method: Composition-based stats.
 Identities = 50/445 (11%), Positives = 113/445 (25%), Gaps = 26/445 (5%)

Query: 134  EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLAN 193
               A   + Y    I  + +      D  L   VL +                LT   A+
Sbjct: 1908 GAAADLNTAYDSSGISGLANEAVTLSDTTLAVSVLNTLDGNTSGTVNANTVTTLTGTAAD 1967

Query: 194  PKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD 253
                +  +  +     A       D +L+       D      V+    NT+       +
Sbjct: 1968 LNTAYDSAGISNLGNEAITLS---DTTLAVSVLNTLDGNTSGTVNASSINTLTGAAADLN 2024

Query: 254  QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNP-EITADKFLTLMQENDPIVSQVKY 312
              Y    I+ +++ +  L D  L   +  +L       + A+   TL      + +    
Sbjct: 2025 TAYASAGISGLANEAVTLSDTTLAVSVLNTLDGNTSGTVNANTVTTLTGTAADLNTAYDS 2084

Query: 313  FFQINFHR------------------DNSSSTKIQQDSQIQKMLDLYK--KNCQILHDDK 352
                N                     D ++S  +  ++                      
Sbjct: 2085 AGISNLGNEAITLSDTTLAVSVLNTLDGNTSGTVNANTVTTLTGAAADLNTAYASAGISN 2144

Query: 353  MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQL 412
            + +           +  ++ L          N+           + AY      +     
Sbjct: 2145 LGNEAVTLSDTTLAVSVLNTLDGNTSGTVNANTVTTLTGAAADLITAYASGG--ISNLGN 2202

Query: 413  RNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANR 472
              V  S+ +   S AN         +    +     ++  +    +  TI          
Sbjct: 2203 EAVSVSSGTASTSQANTLAAATSGVVTATLSDGDLSTLAGLTETGNAYTITITDTSVDAA 2262

Query: 473  KRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
              +  D +     +   I+T      ++N+       +I  + +    L++  +   +L 
Sbjct: 2263 ALNTLDGKTTVAINANNITTLTGAAADLNTAYAANGSSITGLGNEAATLSDTTLAVSVLN 2322

Query: 533  SKGIDSQKVREDFLCEIFKSDLKDP 557
            +   ++  +          SD  D 
Sbjct: 2323 TLDGNTSGIVNASNITTLTSDDYDS 2347



 Score = 39.8 bits (91), Expect = 1.9,   Method: Composition-based stats.
 Identities = 49/451 (10%), Positives = 105/451 (23%), Gaps = 29/451 (6%)

Query: 102  RSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDR 161
             +   S                     +     +++         N + I   D      
Sbjct: 5069 EAVSVSSGTASTSQANTLAAATSGVVTATLSDGDLSTLAGLTETGNAYTITITDTSVDAA 5128

Query: 162  RL------LDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRF 215
             L          + + +IT    +   L        ++      E+       +A +   
Sbjct: 5129 ALNTLDGKTTVAINANNITTLTGAAADLNTAYAANGSSITGLGNEAATLSDTTLAVSVLN 5188

Query: 216  QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPK 275
              DG+ S      T              T+       +  +    I+++ + +  L D  
Sbjct: 5189 TLDGNTSGIVNANTVT------------TLTGAAADLNTAFDSAGISNLGNEAATLSDTT 5236

Query: 276  LFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDN----SSSTKIQQD 331
            L   +  +L            +T +  +   +        I+   D     SS T     
Sbjct: 5237 LAVSVLNTLDGNTSGTVNANTVTTLTGSASDLITAYASGGISNLGDEAVSVSSGTASTSQ 5296

Query: 332  SQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPII 391
            +              I   D               I   D  +                 
Sbjct: 5297 ANTLAAATSGVVTATISDGDLATLAGLTETGNAYTITITDTSVDAAALNTLDGKTTV--- 5353

Query: 392  TLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIG 451
                A++A N+         L    ++N S      N++       L  +     DG+  
Sbjct: 5354 ----AINAANITTLTGAAADLNTAYSANGSSLTGLGNEAATLSDTTLAVSVLNTLDGNTS 5409

Query: 452  PIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNI 511
                  +  T+            S   +   +       +T     L         T++ 
Sbjct: 5410 GTVNASNITTLTGEAADLNTAYDSASISGLANEAVTLSDTTLAASVLNTLDGHTSGTIDA 5469

Query: 512  NTIHSFEELLANKRILNFLLESKGIDSQKVR 542
            + I +     A+       L   G+ ++ + 
Sbjct: 5470 SNITTLTGSTADLITAYASLTITGLGNEAIT 5500



 Score = 37.1 bits (84), Expect = 9.9,   Method: Composition-based stats.
 Identities = 47/497 (9%), Positives = 114/497 (22%), Gaps = 32/497 (6%)

Query: 134  EEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLAN 193
               A   + Y    I  + +      D  L   VL +                LT   A+
Sbjct: 993  GAAADLNTAYDSSGISGLANEAVTLSDTTLAVSVLNTLDGNTSGTVNANTVTTLTGTAAD 1052

Query: 194  PKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSD 253
                +  +  +     A       D +L+       D      V+    NT+       +
Sbjct: 1053 LNTAYDSAGISNLGNEAITLS---DTTLAVSVLNTLDGNTSGTVNASSINTLTGAAADLN 1109

Query: 254  QNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYF 313
              Y    I+ +++ +  L D  L   +  +L            +T +       +     
Sbjct: 1110 TAYASAGISGLANEAVTLSDTTLAVSVLNTLDGNTSGTVNASNITTLTGAAAEANTAYAS 1169

Query: 314  FQINFHR-------------------DNSSSTKIQQDSQIQKMLDLYK--KNCQILHDDK 352
              I+                      D ++S  +  ++                      
Sbjct: 1170 AGISNLGNEAVTLSDTTLAVSVLNTLDGNTSGTVNANTVTTLTGTAADLNTAYDSAGISN 1229

Query: 353  MQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQL 412
            + +           +  ++ L          N+           + AY      +     
Sbjct: 1230 LGNEAVTLSDTTLAVSVLNTLDGNTSGTVNANTVTTLTGAAADLITAYASGG--ISNLGD 1287

Query: 413  RNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTI------RDNV 466
              V  S+ S   S  N    +    +N        G+   +    +   I         +
Sbjct: 1288 EAVTLSDTSLAVSVLNSLDGNTSGTVNANTVTTLTGAAADLNTAYASGGINGLGNEAATL 1347

Query: 467  KHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRI 526
                     ++  +  +  ++   S         +    Y +  I+ + +    L++  +
Sbjct: 1348 SDTTLAVSVLNTLDGHTSGTVNASSITTLTGAAADLNTAYDSSGISGLANEAVTLSDTTL 1407

Query: 527  LNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSH 586
               +L +   ++                 D  +   +   +       S +         
Sbjct: 1408 AVSVLITLDGNTSGTVNANTVTTLTGSASDLITAYASGGISNLGNEAVSVSSGTASTSQA 1467

Query: 587  KKIGKVQDNFHIDDTCD 603
              +             D
Sbjct: 1468 NTLAAATSGVVTATLSD 1484


>gi|23465044|ref|NP_695647.1| hypothetical protein BL0447 [Bifidobacterium longum NCC2705]
 gi|23325651|gb|AAN24283.1| hypothetical membrane protein with similarity to phage infection
           protein [Bifidobacterium longum NCC2705]
          Length = 720

 Score = 40.6 bits (93), Expect = 1.0,   Method: Composition-based stats.
 Identities = 49/381 (12%), Positives = 105/381 (27%), Gaps = 29/381 (7%)

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQS 129
              F K I  + L    SL +QL+  + +    +++ +      Q D     +      +
Sbjct: 163 NTTFAKTITSAGLEIASSLADQLSKPEAKEQLNTFNANIANFATQLDDTADLLGTYSALT 222

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
                 +    S   + +         L   ++ +  V  +   T   +S        + 
Sbjct: 223 DTAGALLDTSNSLITQVSSAAKQGGKDLASAKQEVTDVAGALGTTADAMSSALDASASSF 282

Query: 190 GLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP 249
           G            D                + +  +       I K    Y         
Sbjct: 283 GAV-SDSIDKLYSDA-----------NAGATTAADESDRQATAIGKQTEKYTEIRNTLAG 330

Query: 250 IVSDQNYYKLAINSVSSFSDFLK-DPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVS 308
           I+ + +      + +++    +    +L + L  +   +       +      +N    +
Sbjct: 331 ILGNDS------SIITAIDRSIARQNRLRQALNTAATDIRQGNQDAQDQHAQVKNLADQA 384

Query: 309 QVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIK 368
           Q       N   D S++ K Q DS    + D            ++ S + D +   G   
Sbjct: 385 QNSIA---NIKSDFSATVKPQIDSLSSTVSDA--SGILSSGATQLDSTLGDLK---GTSD 436

Query: 369 SIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD--QLRNVLTSNPSDPDSY 426
              ++LS         S +      + A     L+      D   ++ VL ++P    S 
Sbjct: 437 DASDMLSDARTTLDKVSGKLRSAGAELASFNSTLSDALNSGDMGMVKEVLGNDPETLAST 496

Query: 427 ANKSKDDRLIKLNHAFNFNAD 447
                  R   +    NF + 
Sbjct: 497 LAAPVQLRRKAVFPVANFGSS 517


>gi|84515378|ref|ZP_01002740.1| DNA primase [Loktanella vestfoldensis SKA53]
 gi|84510661|gb|EAQ07116.1| DNA primase [Loktanella vestfoldensis SKA53]
          Length = 654

 Score = 40.2 bits (92), Expect = 1.3,   Method: Composition-based stats.
 Identities = 30/216 (13%), Positives = 54/216 (25%), Gaps = 15/216 (6%)

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFN----ADGSIGPIPMMQSRLTIRDNVKHYANRKR 474
           +P+ P  Y N  +     K    FN      A G   P+ + +  + +    +       
Sbjct: 225 DPNAPAKYYNSPETPLFDKGRSLFNHGPAREAAGKGKPLIVAEGYMDVIALAEAGFTATV 284

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           +                      + ++ +       +  I     LL + + L F L   
Sbjct: 285 APLGTAITEDQLRLLWRIAPEPIIALDGDTAGLRAAMRLIDIALPLLESGQSLRFALMPP 344

Query: 535 GIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQD 594
           G+D   V +       +  L              ++      NFD       K       
Sbjct: 345 GLDPDDVIKTQGAGAMQKLLDAAIPMVQLL----WQRETEGKNFD---SPERKAALDKAL 397

Query: 595 NFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRT 630
              I    D            E    +  AL+  R 
Sbjct: 398 RDKIKLIADPSIRSHY----GEAIKEMRWALFSTRR 429


>gi|86357010|ref|YP_468902.1| hypothetical protein RHE_CH01372 [Rhizobium etli CFN 42]
 gi|86281112|gb|ABC90175.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 1709

 Score = 40.2 bits (92), Expect = 1.4,   Method: Composition-based stats.
 Identities = 45/387 (11%), Positives = 103/387 (26%), Gaps = 23/387 (5%)

Query: 115  SDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSIT 174
            +     T+ Q Y  S+          + YF  N+           +  +  Y   S   T
Sbjct: 1018 TSPVALTVGQTYTASYHTNSGHYSTTTNYFTSNVTSGPLTAPASGNG-VYRYGSNSLFPT 1076

Query: 175  PKYISLPFLKDVL--TLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDM- 231
              Y S  +  DV+  T G         ++ D   +           G+++  + +  D  
Sbjct: 1077 STYQSTNYWVDVMFTTSGSNTTPTAVADAGDATEKGGVA---NGSGGAVASGNVLTNDTD 1133

Query: 232  ----QIEKIVSNYFNNTIDCVPIVSDQNYYKLAI-NSVSSFSDFLKDPKLFKMLQLSLFP 286
                  + + +  F  T   +    +  Y  L +  S +      +     + L+ S   
Sbjct: 1134 PDSGDTKTVTAVKFGATSGTLGSALNGTYGSLVLNASGAYTYTINESNATVQALRQSTNT 1193

Query: 287  LNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNC- 345
            L     +D F   M+++    +       I+   D +    +Q  +Q   +   +     
Sbjct: 1194 L-----SDVFSYTMRDSAGATATANLTVTIHGAND-APVLAVQTTTQNATVGSAFSFTLP 1247

Query: 346  QILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQ 405
                 D        Y        ++ + LS        +       T    + A +L   
Sbjct: 1248 TTTFSDVDSGDTLAYAATSADGTALPSWLSFNASTRTFSGTPTAGGTYGVKVTATDLGGL 1307

Query: 406  DLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDN 465
              +      V     + P + A+         + +     + G++    ++ +       
Sbjct: 1308 AANETFNIAVSVPGNTTPTAVADTGDATEKGGVAN----GSGGAVASGNVLTNDTDPDSG 1363

Query: 466  VKHYANRKRSIHDAENKSFNSMEQIST 492
                    +                 +
Sbjct: 1364 DTKTVTAVKFGATPGTLGSALNGTYGS 1390


>gi|229824706|ref|ZP_04450775.1| hypothetical protein GCWU000182_00054 [Abiotrophia defectiva ATCC
           49176]
 gi|229791035|gb|EEP27149.1| hypothetical protein GCWU000182_00054 [Abiotrophia defectiva ATCC
           49176]
          Length = 264

 Score = 39.8 bits (91), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/70 (18%), Positives = 28/70 (40%), Gaps = 8/70 (11%)

Query: 636 NHYEILGDSKL--FKVVSKKLKLSPYFAVLPERKKIRILKKHIKINDFKD-----SKKVE 688
           +  +IL +  L   +V+   L +     V     K  I+  +I+   F+       +K++
Sbjct: 46  SMADIL-NEALNQARVMETGLNIPKLHGVTEIDGKTAIVLDYIEGKTFEQIMNDHPEKMD 104

Query: 689 DFLYAAKAMD 698
           + L    A+ 
Sbjct: 105 ELLDRFIAIQ 114


>gi|322795706|gb|EFZ18385.1| hypothetical protein SINV_07022 [Solenopsis invicta]
          Length = 1354

 Score = 39.8 bits (91), Expect = 1.6,   Method: Composition-based stats.
 Identities = 54/470 (11%), Positives = 127/470 (27%), Gaps = 42/470 (8%)

Query: 102 RSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDR 161
           RS+D+     V Q++      I  Y+      + +     +   + +    ++ +L  + 
Sbjct: 476 RSFDWGCAADVSQAEDNLDNEIDLYRPRLDDLDSILHANDRKIERIVRGTRNLSELLSEC 535

Query: 162 RLL----DYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAEN--FRF 215
           RL          +        S       L    ++          N    ++E      
Sbjct: 536 RLNEEEERKSRDADREKLGRDSSADKNRELASKRSDRSSVLEIELRNEELTVSETRRTSD 595

Query: 216 QPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDP- 274
                 +  +        +  V +            SD+     A   +S  S    D  
Sbjct: 596 DEPLGTNATENGSRSNYSKNSVESSVFPASGGTSRDSDEAQRSAAKARLSETSMDGSDAT 655

Query: 275 KLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQI 334
             F  L  +L   + E +  +   + ++N   +S  +      +  D  S          
Sbjct: 656 TTFSNLVPALSSTHTETSRQREEKIARDNASKLSGREIRSGKGYIDDGGSVFAQLFQKNA 715

Query: 335 QKMLDLYKK--------------------------------NCQILHDDKMQSLIKDYQL 362
            ++ D                                      + + D +    +   Q 
Sbjct: 716 SQVADQLVTYILQDEKRRSVGGRSLREATPAAVQKLLNHLREAESIRDARQTETMDILQN 775

Query: 363 PLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSD 422
            L  +KS  +        E  +         +    +  ++++   RD+    + +    
Sbjct: 776 ILINVKSQSD-RGNTNDRETRSRDTADSSVARTNAPSTAIDVRGTSRDEKAREIQAKIDV 834

Query: 423 PDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENK 482
            DSY  +  D+R+   +       DG         +R +  ++ K      R       K
Sbjct: 835 KDSYELEGLDERVSNFSECRETARDGDRSTARCESTRRSENNDEKD--AGLRRESADVAK 892

Query: 483 SFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLE 532
              S  +    + ++    +  +  + N+  I   E  ++  R  +   +
Sbjct: 893 IVLSDAKNQADQGVDENSTAREETLSRNVADISRLEGTISRTRAKDHASD 942


>gi|319787066|ref|YP_004146541.1| methyl-accepting chemotaxis sensory transducer [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465578|gb|ADV27310.1| methyl-accepting chemotaxis sensory transducer [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 730

 Score = 39.4 bits (90), Expect = 2.2,   Method: Composition-based stats.
 Identities = 35/308 (11%), Positives = 87/308 (28%), Gaps = 22/308 (7%)

Query: 375 SGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDR 434
                L    +  E + TL  +    ++ ++ L R  L   +  +           +DD 
Sbjct: 391 KRDFALALSRNLNELLETLSGSARQVSMVLRALARGDLTVRMEGDFQ---GVFAGMRDDA 447

Query: 435 LIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQK 494
              ++H  +  +        +      I       + R         ++  SME++++  
Sbjct: 448 NATVDHLASIVSRIQAASSAINSGATEIASGNNDLSRRTEQQAANLEETAASMEELTSTV 507

Query: 495 RINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDL 554
           + N +   + +   L I       E    + +   +     I +   R   +  +     
Sbjct: 508 KQNADHARQAN--QLAIGAASVASE--GGQVVGQVVTTMADIQASSRRIADIISVIDGIA 563

Query: 555 KDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKE 614
                 A           + +      G        +V+       T      Q+IE   
Sbjct: 564 FQTNILA-------LNAAVEAARAGEQGRGFAVVATEVRSLAQRSATAAKEIKQLIEDST 616

Query: 615 EEKDPNIALALYFKRTIPNIRN----HYEILG--DSKLFKVVSKKLKLSPYFAVLPERKK 668
            +      LA    RT+  I        +I+    +   +      +++     + E  +
Sbjct: 617 GKVADGARLAEQAGRTMGEIVTSVQRVTDIMAEISAASQEQAEGIAQVNRTIVQMDETTQ 676

Query: 669 --IRILKK 674
               ++++
Sbjct: 677 QNAALVEE 684


>gi|222148654|ref|YP_002549611.1| hypothetical protein Avi_2239 [Agrobacterium vitis S4]
 gi|221735640|gb|ACM36603.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 2252

 Score = 39.4 bits (90), Expect = 2.2,   Method: Composition-based stats.
 Identities = 59/606 (9%), Positives = 168/606 (27%), Gaps = 39/606 (6%)

Query: 50   KDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPP 109
             ++   + AL +     ++ A +  ++ L+  +S+ +S ++Q+ + +      + + S  
Sbjct: 570  GNQEALTEALSSHSRE-LADALERRRRELDETISNAQSRIDQIMAERGTALTEALNTSQT 628

Query: 110  PKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQ 169
                    + + +I     SH    ++    S      +  + S +    +  L      
Sbjct: 629  RFDETLGSRSEAVINQLTGSHDRISDLLQNAS---SGIVEAVTSSETRLAN-TLDRKAQT 684

Query: 170  SFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGS---LSKRDK 226
               I     +   ++  L    A+  +   E+   R  ++ +    Q + +   +  R +
Sbjct: 685  I--IEAADGADARIEAAL-SDKADAIRAAYETNHERLTSVLDAKVEQLEQTALAVDSRVE 741

Query: 227  ILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFP 286
                 + + I + Y  +       +  +        + +     L        ++     
Sbjct: 742  AAFGNKADAIRAAYEESEARLTRTLDGKVDQITDAATEADMRIELALGNRMDTIRAVYED 801

Query: 287  LNPEITADKFLTLM-QENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNC 345
                + +     L         +  +         D   S   Q ++++ + LD      
Sbjct: 802  SESRLASTIDAKLGALTETLGNADNRIEQAFGTKADQVLSAYEQSEARLARTLDSKIDQI 861

Query: 346  QILHDDKMQSLIKDYQLPLGKIKSI----DNLLSGKCQLEGPNSAEEPIITLQFALDAYN 401
                 D    +       +  I+++    ++ LS     +     E           A+ 
Sbjct: 862  SDAASDADMRIELALGNRMDTIRAVYEESESRLSNTIDAKLGALTETLGNADVRIEQAFG 921

Query: 402  LNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLT 461
                 +     ++      +        S       +                  +S   
Sbjct: 922  TKADQVLSAYEQSEARLARTLDSKIEQISDAASDADMRIELALGNRMDTIRAVYEESETR 981

Query: 462  IRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELL 521
            +   +              +            +   +    +        + +    ++ 
Sbjct: 982  LSGTIDAKLGALTETLGTADSRIEQAFGSKADQLRAVYEEGQARLTQTLDSKVDQLSDVA 1041

Query: 522  ANKRIL-NFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDI 580
            A   +   F L SK         D +  +++    D ++      D +  ++I +  F  
Sbjct: 1042 AEADMRIEFALGSK--------VDSIRSVYE----DSEARLAGTIDAKLGQLIETVGFAD 1089

Query: 581  HGELSHKKIGKVQ-------DNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPN 633
                        Q       ++  + +  D   +Q+++   E    ++ +AL F     +
Sbjct: 1090 SRVQQALGSKADQIREAYEANHGRLAEMLDSRINQVMDTATEA---DLRMALAFGNKADD 1146

Query: 634  IRNHYE 639
            IR  YE
Sbjct: 1147 IRAAYE 1152


>gi|227545673|ref|ZP_03975722.1| phage infection protein [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|227213789|gb|EEI81628.1| phage infection protein [Bifidobacterium longum subsp. infantis
           ATCC 55813]
          Length = 720

 Score = 39.4 bits (90), Expect = 2.3,   Method: Composition-based stats.
 Identities = 49/381 (12%), Positives = 105/381 (27%), Gaps = 29/381 (7%)

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQS 129
              F K I  + L    SL +QL+  + +    +++ +      Q D     +      +
Sbjct: 163 NTTFAKTITSAGLEIASSLADQLSKPETKEQLNTFNANIANFATQLDDTADLLGTYSALT 222

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
                 +    S   + +         L   ++ +  V  +   T   +S        + 
Sbjct: 223 DTAGALLDTSNSLITQVSSAAKQGGKDLASAKQEVTDVAGALGTTADAMSSALDASASSF 282

Query: 190 GLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP 249
           G            D                + +  +       I K    Y         
Sbjct: 283 GAV-SDSIDKLYSDA-----------NAGATTAADELDRQATAIGKQTEKYTEIRNTLAG 330

Query: 250 IVSDQNYYKLAINSVSSFSDFLK-DPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVS 308
           I+ + +      + +++    +    +L + L  +   +       +      +N    +
Sbjct: 331 ILGNDS------SIITAIDRSIARQNRLRQALNTAATDIRQGNQDAQDQHAQVKNLADQA 384

Query: 309 QVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIK 368
           Q       N   D S++ K Q DS    + D            ++ S + D +   G   
Sbjct: 385 QNSIA---NIKSDFSATVKPQIDSLSSTVADA--SGILSSGATQLDSTLGDLK---GTSD 436

Query: 369 SIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD--QLRNVLTSNPSDPDSY 426
              ++LS         S +      + A     L+      D   ++ VL ++P    S 
Sbjct: 437 DASDMLSDARTTLDKVSGKLRSAGAELASFNSTLSDALNSGDMGMVKEVLGNDPETLAST 496

Query: 427 ANKSKDDRLIKLNHAFNFNAD 447
                  R   +    NF + 
Sbjct: 497 LAAPVQLRRKAVFPVANFGSS 517


>gi|312133454|ref|YP_004000793.1| membrane protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|311772687|gb|ADQ02175.1| Hypothetical Membrane protein [Bifidobacterium longum subsp. longum
           BBMN68]
          Length = 720

 Score = 39.4 bits (90), Expect = 2.4,   Method: Composition-based stats.
 Identities = 49/381 (12%), Positives = 105/381 (27%), Gaps = 29/381 (7%)

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQS 129
              F K I  + L    SL +QL+  + +    +++ +      Q D     +      +
Sbjct: 163 NTTFAKTITSAGLEIASSLADQLSKPETKEQLNTFNANIANFATQLDDTADLLGTYSALT 222

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
                 +    S   + +         L   ++ +  V  +   T   +S        + 
Sbjct: 223 DTAGALLDTSNSLITQVSSAAKQGGKDLASAKQEVTDVAGALGTTADAMSSALDASASSF 282

Query: 190 GLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVP 249
           G            D                + +  +       I K    Y         
Sbjct: 283 GAV-SDSIDKLYSDA-----------NAGATTAADELDRQATAIGKQTEKYTEIRNTLAG 330

Query: 250 IVSDQNYYKLAINSVSSFSDFLK-DPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVS 308
           I+ + +      + +++    +    +L + L  +   +       +      +N    +
Sbjct: 331 ILGNDS------SIITAIDRSIARQNRLRQALNTAATDIRQGNQDAQDQHAQVKNLADQA 384

Query: 309 QVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIK 368
           Q       N   D S++ K Q DS    + D            ++ S + D +   G   
Sbjct: 385 QNSIA---NIKSDFSATVKPQIDSLSSTVADA--SGILSSGATQLDSTLGDLK---GTSD 436

Query: 369 SIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD--QLRNVLTSNPSDPDSY 426
              ++LS         S +      + A     L+      D   ++ VL ++P    S 
Sbjct: 437 DASDMLSDARTTLDKVSGKLRSAGAELASFNSTLSDALNSGDMGMVKEVLGNDPETLAST 496

Query: 427 ANKSKDDRLIKLNHAFNFNAD 447
                  R   +    NF + 
Sbjct: 497 LAAPVQLRRKAVFPVANFGSS 517


>gi|87310260|ref|ZP_01092391.1| hypothetical protein DSM3645_27568 [Blastopirellula marina DSM
           3645]
 gi|87287009|gb|EAQ78912.1| hypothetical protein DSM3645_27568 [Blastopirellula marina DSM
           3645]
          Length = 825

 Score = 39.4 bits (90), Expect = 2.6,   Method: Composition-based stats.
 Identities = 29/299 (9%), Positives = 79/299 (26%), Gaps = 7/299 (2%)

Query: 267 FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSST 326
             + L    L +             T         +     +   +   I    D   + 
Sbjct: 129 AHNLLAASSLKQAEAQVAGSYQSNGTQLADAIAAYQIAEAQALRDHRIAIE-QADRRFAD 187

Query: 327 KIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSA 386
                +    + D      + L   +       Y+  +G   +  + ++        N  
Sbjct: 188 NGDTTAHNTSLTDA----NKALRAARETFTEAYYKAAIGAQGAHQSTVAKSEADYENNVG 243

Query: 387 EEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNA 446
           +    + +   DA  ++    +    R    +  +    +A    D+    L  A     
Sbjct: 244 QSRAQSTKAIADA-QVDYVTTEAAAYRTQQETIAARDKQFAEFDVDNDYDSLVDALAALT 302

Query: 447 DGSI-GPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVD 505
             +     P     L I   V   A    +     + S  +  + +       + +  V 
Sbjct: 303 AANNDTADPWTTKALAIAAVVHDAATDIAAAIHDYDVSQAAASEANDVANAQADRDRTVG 362

Query: 506 YYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTY 564
               ++  + +  +++A++      +  +  +S  +          S  +   ++AN  
Sbjct: 363 EVKADVGKVVTERDIVADRVAKEAAVHEQNANSTPITNAVTGNSDDSAGEGESAYANLP 421


>gi|194748381|ref|XP_001956624.1| GF24494 [Drosophila ananassae]
 gi|190623906|gb|EDV39430.1| GF24494 [Drosophila ananassae]
          Length = 1254

 Score = 39.1 bits (89), Expect = 2.7,   Method: Composition-based stats.
 Identities = 30/409 (7%), Positives = 96/409 (23%), Gaps = 11/409 (2%)

Query: 111 KVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQS 170
           +   S  +  TI    + +    ++   E+      +     + +   +          +
Sbjct: 150 ESTTSPPEESTIGDPEESTTSAPDDTTTEDPDESTTSAPDETTAEDPDESTTSAPDETTA 209

Query: 171 FSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTD 230
                   S P  ++  T    +   +  E         +     +   +    +   + 
Sbjct: 210 VDPDESTTSAP--EETTTEDPDDSTTFAPEETTTEDPDESTTSAPEETTTEDPNESTTSP 267

Query: 231 MQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPE 290
            +         + T       ++            + ++   +       + +    +  
Sbjct: 268 SEESTTGEPDESTTSAPNDTTTEDPDESTTSAPDETTAEDPDESTTSAPEETTTEDPDES 327

Query: 291 ITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHD 350
            T+    T  ++ D   +            ++++        +     D  +       +
Sbjct: 328 TTSAPDETTAEDPDASTTSAPDGTTAEDPDESTT-----SAPEETTTEDPDESTTSAPEE 382

Query: 351 DKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
              +   +       +  + D   S     E   + +    T     +    +  +    
Sbjct: 383 TTTEDPDESTTSAPDETTAEDPDESTTSAPEETTTEDPDESTTSAPEETTTEDPDESTTS 442

Query: 411 QLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYA 470
              +  T +P D       S  D     +   +  +              T   +     
Sbjct: 443 APNDTTTEDPDDST----TSAPDETTAEDPDESTTSAPEETTTEDTDESTTSAPDETTAE 498

Query: 471 NRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
           +   S   A  ++       ST    +     + D  T +     + E+
Sbjct: 499 DPDESTTSAPEETTTEDPDESTTSAPDETTADDPDESTTSAPDGTTAED 547


>gi|302875529|ref|YP_003844162.1| methyl-accepting chemotaxis sensory transducer [Clostridium
           cellulovorans 743B]
 gi|307687983|ref|ZP_07630429.1| methyl-accepting chemotaxis sensory transducer [Clostridium
           cellulovorans 743B]
 gi|302578386|gb|ADL52398.1| methyl-accepting chemotaxis sensory transducer [Clostridium
           cellulovorans 743B]
          Length = 600

 Score = 39.1 bits (89), Expect = 2.7,   Method: Composition-based stats.
 Identities = 55/461 (11%), Positives = 134/461 (29%), Gaps = 33/461 (7%)

Query: 75  KKILESDLSD--PKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQH 132
           K +L  D+ D  P    N+     Y  F  +++       I +      I   Y  + + 
Sbjct: 131 KLVLYKDIYDRMPDEYSNKTIDELYADFENNFNLWLKTFDINNGGIKDKI--QYGSTFKI 188

Query: 133 KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA 192
            ++      + F      +    Q    + ++ YV  +         + FL  +L   L 
Sbjct: 189 AQDSVDGIVRIFDGTASSVQEFTQAETRKVIVQYVTIAI--------ISFLLTILFGTLI 240

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSL--------SKRDKILTDMQIEKIV------S 238
                    +   F     N+ F  D +L        + +        + K+V      S
Sbjct: 241 ALDSTNALLKIKDFAERLSNYDFSVDLNLQRKDEYGQTAKTLNTAQDNVRKLVRNIIEDS 300

Query: 239 NYFNNTIDCVPIV---SDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADK 295
            Y NN+ + V         N+  +  ++    +   ++  + + +  S+  +N       
Sbjct: 301 EYINNSSENVFSTIKVVSSNFEVINESTKQINTSMQENNAIAEEISASVEEVNASTVVLS 360

Query: 296 FLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS 355
                  N+ I    +     N  +D   STK     +  +++   +    +     M +
Sbjct: 361 SKATDGTNNAIEIMNRADIVKNRSKDALVSTKKIYSEKEVEIVKAIEAGKVVDEISIMAN 420

Query: 356 LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALD-AYNLNMQDLDRDQLRN 414
            I         +     + + +    G   A       + A   +  +    +  ++++ 
Sbjct: 421 TIASIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRKLAEQSSSAVESVKVTIEKVKK 480

Query: 415 VLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKR 474
              +  S+ +   +  ++          NFN  G               +          
Sbjct: 481 AFDNLSSNSNELIHFMQNGVNSHF---ENFNKIGVQYHEDANFVNTMSMELAAMSEEINA 537

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIH 515
           +I +  +   +  +          +I   ++  +  IN + 
Sbjct: 538 TIDEVTDAVQHMAQMTQESSEKTSDIEKTIEQSSTIINKLS 578


>gi|256395538|ref|YP_003117102.1| hypothetical protein Caci_6407 [Catenulispora acidiphila DSM 44928]
 gi|256361764|gb|ACU75261.1| YD repeat protein [Catenulispora acidiphila DSM 44928]
          Length = 2194

 Score = 39.1 bits (89), Expect = 2.8,   Method: Composition-based stats.
 Identities = 55/500 (11%), Positives = 113/500 (22%), Gaps = 38/500 (7%)

Query: 130  HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLD--YVLQSFSITPKYISLPFLKDVL 187
                      ES Y      ++ +V  L       D      +++       L     V 
Sbjct: 911  PTSTGGTRATESDYTYDGYGRVTAVSSLGDTSTGADDSCTRTAYAQDTSRWLLDLPSRVS 970

Query: 188  TLG---LANPKKYFIESRDN-RFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNN 243
            TL     A P        D      ++       +GS         D      V +Y   
Sbjct: 971  TLNVACTATPSYPANLVTDTQNLYDLSATVG-TANGSGDITTSQKADTVAASGVPHYATQ 1029

Query: 244  TIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTL---- 299
                V            +  V++ S           +  +      + +A          
Sbjct: 1030 ATTTVDEYGRPTSSTDGLGRVTTTSYTPATGAAPTSVTTTAPTPAGQTSAFTTTKTYDPA 1089

Query: 300  --MQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLI 357
              +Q      +  K +   +     ++S   Q ++     L   K   Q+ +      + 
Sbjct: 1090 RGLQLTATDAAGHKGYQTYDPLGRLTASWAAQTNATPTTTLPNAKFTYQVSNGTTPSVVT 1149

Query: 358  KDYQLPLG-----KIKSIDNLL--SGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
                   G          D+L+            +      T                  
Sbjct: 1150 TSLLNDAGTGYQASETLYDSLMRQRETQSPTPDGNRVVADTTYDSHGRKLLTTDGYYATG 1209

Query: 411  QLRNVLTSNPSDP----DSYANKSKDDRLIKL---NHAFNFNADGSIGPIPMMQSRLTIR 463
             +   L           + +A    D +L  +     +  +  D +   +    S     
Sbjct: 1210 AVGPALVKAAQGTILTQNGFAYDGADRQLKDITYYAASEKWENDTTYNGVDETTSTPPGG 1269

Query: 464  DNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLAN 523
                  A+          K        ST       + +   Y         S  +   +
Sbjct: 1270 AGGDTAASTYTDALGHTVKVVQYNGSSSTDP-----VATTTSYGYTRDGKTASVADTSGD 1324

Query: 524  KRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGE 583
                 + L   G    +   D     F  D    +  A    D R K++ ++++  +  +
Sbjct: 1325 TWTYGYNL--LGEQVSQSDPDTAGSTFTYDAAGQQITA---TDARGKQVTTAYD-ALGRK 1378

Query: 584  LSHKKIGKVQDNFHIDDTCD 603
             +             + T  
Sbjct: 1379 TATYDTTGGATPAAGNKTAS 1398


>gi|331003652|ref|ZP_08327147.1| hypothetical protein HMPREF0491_02009 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330412279|gb|EGG91672.1| hypothetical protein HMPREF0491_02009 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 572

 Score = 39.1 bits (89), Expect = 2.9,   Method: Composition-based stats.
 Identities = 39/284 (13%), Positives = 84/284 (29%), Gaps = 36/284 (12%)

Query: 19  FSTVSKDPIVSCEERYYRERIKHISTIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKK-I 77
           ++      + S E   +  R   I +  + +KD   F      F L D        KK  
Sbjct: 168 YNYTGAKTMYSRESCNFDTRTGKILSFLDVVKDDESF------FELVD-----ALAKKDY 216

Query: 78  LESDLSDPKSLVNQLNSLKYQYFARSYD-------FSPPPKVIQSDIQHKTIIQDYKQSH 130
            ES+++ P   V  L    Y+    +         F        +D      +  Y+   
Sbjct: 217 QESNITKPSEYVKGLKENDYKDLVWTVSPEGVTVYFDTGTLGSFTDGPQVITVCFYEDDD 276

Query: 131 QHKEEVALEESKY-FRKNIHKINSVDQLFKD-RRLLDYVLQSFSITPKYIS-LPFLKDVL 187
             + +   +E  Y F      +     +  D  R   YV   +    + +       +V 
Sbjct: 277 LFESKYINKEKDYVFPILADNMTLHIDIDGDGERESVYVENKYEQDKESLDIYTTGLEVF 336

Query: 188 TLGLANP------KKYFIESRDNRFRAMAENFRFQPDGSLSKRDK-ILTDMQIEKIVSNY 240
               +          Y ++   N +      + F  +  +S      L+D++ +    +Y
Sbjct: 337 VGDESKSFEGSEGSAYIVKKSGNYYI-----YVFGGEAEVSILTSLNLSDLKKDDDKFSY 391

Query: 241 FN--NTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQL 282
            +  +         +   Y     + +    F+ D   + +  +
Sbjct: 392 LSLLSRDHSFEAEDNVEIYTYIEETFTDTDTFMADEVGYILGTI 435


>gi|255713064|ref|XP_002552814.1| KLTH0D02068p [Lachancea thermotolerans]
 gi|238934194|emb|CAR22376.1| KLTH0D02068p [Lachancea thermotolerans]
          Length = 1556

 Score = 39.1 bits (89), Expect = 3.0,   Method: Composition-based stats.
 Identities = 53/456 (11%), Positives = 135/456 (29%), Gaps = 44/456 (9%)

Query: 155  DQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFR 214
              +         +  S +           K +L + + +  KY + +    F+A    + 
Sbjct: 714  YHILIPSENWTKIFTSEATEDDI--RDLCKQILDVTVKDSTKYQLGNTKIFFKAGMLAYL 771

Query: 215  FQPDGSLSKRDKILTDMQIEKIVSN----------YFNNTIDCVPIVSDQNYYKLAINSV 264
             +  G+      ++   +I+ +             + +       +   +  Y++   + 
Sbjct: 772  EKLRGTKMHNACVMIQKKIKGVYYRNKYLAIQSAIHKSQAAVAGALCRQRVDYEIKTLAA 831

Query: 265  SSFSDFLKDPKLFKMLQLSL-------FPLNPEITADKFLTLMQENDPIVSQVKYFFQIN 317
            +S    L+     K L+ +          +   IT  + L   + +  I  Q K      
Sbjct: 832  TSLQSLLRAHTQRKHLKNTFCSIIRVQSLVRRRITQKELLERREFDAAIAIQKKIRG--- 888

Query: 318  FHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGK 377
            F      +T      +IQ ++       Q+         +   Q    K       L  K
Sbjct: 889  FVPRKHFNTTRGSSVRIQSLVRRKLAQKQLKQLKADAKSVNHLQEVSYK-------LENK 941

Query: 378  CQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIK 437
                  + A++     +       L     +   ++ +L S   +        ++ +   
Sbjct: 942  VIQLTQSLADKVKENREMTSRIEELQKSLSESANIKTLLESQKEEHS---RDLQEQKNSH 998

Query: 438  LNHAFNFNADGSIGPIPMMQSRLTIRDNVK-------HYANRKRSIHDAENKSFNSMEQI 490
                 N  A+       +  ++  I   +            +  +++ A+ +  ++  Q 
Sbjct: 999  DAELANKRAELEQAKEEIAAAKQEIDSLMTKQEELRNDVRLKIENLNKAQQEYADAQTQN 1058

Query: 491  STQKRINLEINSEVDYYTLNINTIHSFEELLA-----NKRILNFLLESKGIDSQKVREDF 545
            S  K     +  E+      I +  S    LA     N+R       + G+  +++    
Sbjct: 1059 SDLKNEVKSLKDEISRLQATIRSGVSANTALAHTPTKNRRFSTHSSLADGMSPRQLNVIS 1118

Query: 546  LCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIH 581
            +    + D++   S  +   D  YK +  + + +  
Sbjct: 1119 MNNGMEDDVRSTASALSQINDELYKILEDTKSLNTE 1154


>gi|283786611|ref|YP_003366476.1| large repetitive protein [Citrobacter rodentium ICC168]
 gi|282950065|emb|CBG89697.1| large repetitive protein [Citrobacter rodentium ICC168]
          Length = 1637

 Score = 39.1 bits (89), Expect = 3.0,   Method: Composition-based stats.
 Identities = 46/451 (10%), Positives = 121/451 (26%), Gaps = 36/451 (7%)

Query: 174 TPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQP-DGSLSKRDKILTDMQ 232
                +L  +K   +  + +        +DN  +A+         + +++   K      
Sbjct: 168 DTTNDNLAGVKGDASKAIDDMSHLSDAQKDNAHKAVDNATDVAAVEQAVADAAKDNLAGA 227

Query: 233 IEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEIT 292
                    + +        + +        V+     + D     +          E T
Sbjct: 228 KSDASKAIDDMSHLSDEQKDNAHNTVDNATDVAVVEQAVADAAAQNLES-----AKSEAT 282

Query: 293 ADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDK 352
                     +D      +        +D   +        I+       +    +    
Sbjct: 283 QTVNDMAYLSDDQKTQAKEAIQAATTVQDVEKTVANAAAQNIESAKSEAAQAVDDMAYLS 342

Query: 353 MQSLIKDYQL--PLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD 410
            +   +  +       +  ++  ++        ++  E    +     AY  + Q  +  
Sbjct: 343 GEQKTQAKETIQAATTVPDVEKTVANAAAQNLESTKSEATQAVDDM--AYLSDEQKDNVQ 400

Query: 411 QLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYA 470
           +  N  T   +   + A  + D     L  A N +AD +I  +  +      + +  H A
Sbjct: 401 KAVNDATDVATVEQAVAGAAND----NLQAAKN-DADKAIDEMSHLSDE---QKDNAHQA 452

Query: 471 NRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFL 530
               +      ++       S Q        +  +   L+     S  + + +       
Sbjct: 453 VNDATDVATVEQTVADAAGDSLQTAKVDADKAIDEMSHLSDEQKDSAHQAVND------A 506

Query: 531 LESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIG 590
            ++ G++   +           DL+  KS A    D+       ++  D     + + I 
Sbjct: 507 TDAGGVEEAVINAA------AQDLESAKSEALQAVDD------MAYLSDEQKTQAKETIQ 554

Query: 591 KVQDNFHIDDTCDLYKHQMIEKKEEEKDPNI 621
                  ++ T      Q +E  + E +  +
Sbjct: 555 TATTVPDVEKTVTDAVAQNLENAKSETNQAV 585


>gi|254440883|ref|ZP_05054376.1| DNA primase catalytic core, N-terminal domain family
           [Octadecabacter antarcticus 307]
 gi|198250961|gb|EDY75276.1| DNA primase catalytic core, N-terminal domain family
           [Octadecabacter antarcticus 307]
          Length = 654

 Score = 39.1 bits (89), Expect = 3.3,   Method: Composition-based stats.
 Identities = 20/142 (14%), Positives = 42/142 (29%), Gaps = 4/142 (2%)

Query: 419 NPSDPDSYANKSKDDRLIKLNHAFNFN----ADGSIGPIPMMQSRLTIRDNVKHYANRKR 474
           +PSD   Y N  + +   K    FNF     A G   P+ + +  + +   V+       
Sbjct: 226 DPSDNAKYLNSPETELFDKGRSLFNFGPAREAAGKGLPLLVAEGYMDVIALVEAGFGAAV 285

Query: 475 SIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESK 534
           +                      + ++ +V      +  I     LL   + + F +   
Sbjct: 286 APLGTAVTETQLQMMWRIAPEPVITLDGDVAGQRAAMRVIDLALPLLEAGQSVRFAMMPD 345

Query: 535 GIDSQKVREDFLCEIFKSDLKD 556
           G D   + +       +  +  
Sbjct: 346 GQDPDDLLKSAGAGAMRERVDG 367


>gi|240047147|ref|YP_002960535.1| hypothetical protein MCJ_000120 [Mycoplasma conjunctivae HRC/581]
 gi|239984719|emb|CAT04691.1| HYPOTHETICAL Uncharacterized lipoprotein MPN_200 [Mycoplasma
           conjunctivae]
          Length = 712

 Score = 38.7 bits (88), Expect = 3.7,   Method: Composition-based stats.
 Identities = 31/211 (14%), Positives = 73/211 (34%), Gaps = 26/211 (12%)

Query: 44  TIDEFIKDKRLFSYALKAFGLSDMSHAEKFIKKILESDLSDPKSLVNQLNSLKYQ----Y 99
           T D F  + +LF +AL+          + F  KI      D    V  ++          
Sbjct: 241 TSDIFKYNYKLFDFALR--------VKKSF-SKISSRGGKDSAQFVMGVDDSANLFYLSN 291

Query: 100 FARS--------YDFSPPPKVI-QSDIQHKTIIQDY---KQSHQHKEEVALEESKYFRKN 147
           FA++        +        I  S +        Y   K   +H + +   ++ ++   
Sbjct: 292 FAKAGGKFDDFLFGLKKDGSQIDYSTLFKDKNSSRYKNAKDVFEHIKPLIETDTLFYSGR 351

Query: 148 IHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKK-YFIESRDNRF 206
           I    + + L  + +L   +  S +   ++++   +   L + + N        S+D  +
Sbjct: 352 IGGDLNSNTLLNNHQLAFAIQTSSNYPKRFVANDKITTSLEISVDNTTSPIIANSKDQVY 411

Query: 207 RAMAENFRFQPDGSLSKRDKILTDMQIEKIV 237
           +    +     +  ++    ++T+ QI+ I 
Sbjct: 412 KLSKASQTNSTNILVNLDSVLVTNKQIQIIT 442


>gi|90422916|ref|YP_531286.1| TonB-dependent receptor [Rhodopseudomonas palustris BisB18]
 gi|90104930|gb|ABD86967.1| TonB-dependent receptor [Rhodopseudomonas palustris BisB18]
          Length = 783

 Score = 38.7 bits (88), Expect = 4.0,   Method: Composition-based stats.
 Identities = 17/142 (11%), Positives = 40/142 (28%), Gaps = 22/142 (15%)

Query: 439 NHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINL 498
                F A G   P       +        Y + +  + D  + + + + Q  T K    
Sbjct: 346 ARQTKFTAKGEYRPDSAAIEAIRFWAGATDYKHNEIGLADTSDPTTDGVRQTFTNKEQEA 405

Query: 499 EINSEVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
            +  ++  +     T+ +                + G+           E+      DP 
Sbjct: 406 RVELQMMPFNARFATVTT----------------AFGLQ------AGHQELTAPSPDDPG 443

Query: 559 SFANTYKDNRYKEIISSFNFDI 580
           +  N   +  +   I+ + F+ 
Sbjct: 444 ALYNGLWNPNHNSRIAGYVFNE 465


>gi|227486965|ref|ZP_03917281.1| transcriptional regulator [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227093039|gb|EEI28351.1| transcriptional regulator [Corynebacterium glucuronolyticum ATCC
           51867]
          Length = 491

 Score = 38.7 bits (88), Expect = 4.1,   Method: Composition-based stats.
 Identities = 12/104 (11%), Positives = 31/104 (29%), Gaps = 13/104 (12%)

Query: 610 IEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER--- 666
                   D  +  A Y + +  +    Y+ LG  +    V ++  L             
Sbjct: 190 FTDAVGGVDVCLNEATYDEYSGADFTAGYQTLGGPQALAFVRQRHGLPRG----DLDRIV 245

Query: 667 -KK---IRILKKHIKINDFKDSKKVEDFLY--AAKAMDHQSIDY 704
            ++     +++K +  N   +  K+ +         +  +  D 
Sbjct: 246 RQQAFMASLVQKVLSSNTLTNPSKLTELAEAARRSVIIDKDWDI 289


>gi|227541874|ref|ZP_03971923.1| transcriptional regulator [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227182317|gb|EEI63289.1| transcriptional regulator [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 491

 Score = 38.7 bits (88), Expect = 4.2,   Method: Composition-based stats.
 Identities = 12/104 (11%), Positives = 31/104 (29%), Gaps = 13/104 (12%)

Query: 610 IEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLKLSPYFAVLPER--- 666
                   D  +  A Y + +  +    Y+ LG  +    V ++  L             
Sbjct: 190 FTDAVGGVDVCLNEATYDEYSGADFTAGYQTLGGPQALAFVRQRHGLPRG----DLDRIV 245

Query: 667 -KK---IRILKKHIKINDFKDSKKVEDFLY--AAKAMDHQSIDY 704
            ++     +++K +  N   +  K+ +         +  +  D 
Sbjct: 246 RQQAFMASLVQKVLSSNTLTNPSKLTELAEAARRSVIIDKDWDI 289


>gi|156058053|ref|XP_001594950.1| hypothetical protein SS1G_04758 [Sclerotinia sclerotiorum 1980]
 gi|154702543|gb|EDO02282.1| hypothetical protein SS1G_04758 [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 6771

 Score = 38.7 bits (88), Expect = 4.3,   Method: Composition-based stats.
 Identities = 46/386 (11%), Positives = 104/386 (26%), Gaps = 47/386 (12%)

Query: 173  ITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQ 232
            +  +   +  LK  L+      K+    +      A+    +      + +     T  +
Sbjct: 6336 LVERDAEIDLLKRTLSSMQDEVKRLTEVNAGLTSAAVTLGQQHNARYGILESQHAQTSRE 6395

Query: 233  IEKIVSNYFNNTIDCVPIVSDQNYYKLA-INSVSSFSDFLKDPKLFKMLQLSLFPLNPEI 291
            +++    + N   +   I+ +    +   I S+ S  D  K                   
Sbjct: 6396 LQQAREAHHNLQNEVDGIIHNAIQERDQEIASLRSQLDVAK---------------EQIR 6440

Query: 292  TADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLY--KKNCQILH 349
               + +   +  D     ++         D +     Q   Q       +   + C++  
Sbjct: 6441 AMQREILAAKAGDAQFLTIRDEDYF----DGACQQLCQHVQQWVLRFSKFSDMRACRLTR 6496

Query: 350  DDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDR 409
            +      I      +     +DN L+ + +      +    +  +F    Y   M    R
Sbjct: 6497 EINNDKTIDRLDNAILDGSDVDNYLADRVRRRDVFMSMTMTMVWEFIFTRYLFGMDREQR 6556

Query: 410  DQLRNVLTSNPSD--PDSYANKSKDDRLIKLNHAFNFNAD----------------GSIG 451
             +L++ L    SD  P S  ++ +   L  L+   +F                     I 
Sbjct: 6557 QKLKS-LEKLLSDVGPSSAVHQWRATTLTLLSKRASFAKQREQDTLAVVHAILETLTEIL 6615

Query: 452  PIPMMQSRL------TIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVD 505
            P P             +       +   R+             +      +  +++    
Sbjct: 6616 PPPSHLEDQIEEQLKRVVKAAVDLSIEMRTQRAEYMMLPPLQPEYDANGDLASKVSFNAA 6675

Query: 506  YYTLNINTIHSFEELLANKRILNFLL 531
                      S EEL A K ++  +L
Sbjct: 6676 LMNERSGDTVSNEELEAQKAVVRVVL 6701


>gi|71909699|ref|YP_287286.1| TonB-dependent receptor [Dechloromonas aromatica RCB]
 gi|71849320|gb|AAZ48816.1| TonB-dependent receptor [Dechloromonas aromatica RCB]
          Length = 705

 Score = 38.7 bits (88), Expect = 4.3,   Method: Composition-based stats.
 Identities = 49/369 (13%), Positives = 102/369 (27%), Gaps = 28/369 (7%)

Query: 169 QSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRF---------RAMAENFRFQPDG 219
            +F     +     L    T G  +   Y  +S   R+               F  + D 
Sbjct: 185 SAFG---DHAFRADLNLSHTDGWRDKTAYDRQSGTLRWDSAIGDDATLKTVATFS-KIDQ 240

Query: 220 SLSKRDKILTDMQIEKIVSNYFNNTIDCVPI-VSDQNYYKLAINSVSSFSDFLKDPKLFK 278
             +    I  +       +NY   ++  V        Y K   NS+ S + + ++  +  
Sbjct: 241 QTAGSSAISKNDYDNNPKANYTPISLRKVDAFRLSTAYEKEWGNSLLSITPYYRNDSMDL 300

Query: 279 MLQLSLFPLNPEITADK-FLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKM 337
           +   SL       T +        +       ++  F +    D+S  ++I+        
Sbjct: 301 LANWSLSYDPTIYTTENQSFGAQIKYRHDFEPLRTRFIVGIDLDHSPGSRIENRINTTST 360

Query: 338 LDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFAL 397
              Y K            +        G    +   +S   +L       +  ++ +F  
Sbjct: 361 GSGYTKIYT--GYTTGARVYDYDVTYQGISPYVHGEISPIEKLRITAGLRQDHVSYRFDN 418

Query: 398 DAYNLNMQDLDRDQLRNVLTSNPS----DPD---SYANKSKDDRLIKLNHAFNFNADGSI 450
             Y  +   +       V   + S     P    +YA     +     NHAF   ++G +
Sbjct: 419 R-YGTSPVVVGSAYYGQVADGDLSFNHLSPKLGATYAFSDSLNAFAAYNHAFRAPSEGQL 477

Query: 451 GPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINL---EINSEVDYY 507
               +  S           +N K    D+           S    +++       ++  Y
Sbjct: 478 FRPSVAASAAAANAAAIAASNLKPIKVDSVETGLRGNINRSVNYEVSVYYMTKTDDILSY 537

Query: 508 TLNINTIHS 516
              +  I +
Sbjct: 538 RDPVTNITT 546


>gi|126733566|ref|ZP_01749313.1| DNA topoisomerase I, putative [Roseobacter sp. CCS2]
 gi|126716432|gb|EBA13296.1| DNA topoisomerase I, putative [Roseobacter sp. CCS2]
          Length = 866

 Score = 38.3 bits (87), Expect = 4.5,   Method: Composition-based stats.
 Identities = 45/416 (10%), Positives = 107/416 (25%), Gaps = 49/416 (11%)

Query: 104 YDFSPPPKV---IQSDIQHKTIIQDYKQSHQHKEEV--------ALEESKYFRKNIHKIN 152
           +D     +    +Q+      +I+  +     +             E S+ F     +  
Sbjct: 223 FDLGNETQAEMAVQAISSRDLVIKSVEAKPATRNPSPPFMTSTLQQEASRKFGMGAKQTM 282

Query: 153 SVDQLFKDRRLLDYVLQSFSIT----PKYISLPFLKDVLTLG--LANPKKYFIESRDNRF 206
           SV Q   +  L+ Y+     I         +   +K           P+ Y  ++++ + 
Sbjct: 283 SVAQRLYEAGLITYMRTD-GIDMAPEAVTGARDAIKAKFGDKYLPDQPRMYKNKAKNAQE 341

Query: 207 RAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSS 266
              A       + S+S  D  + D    K+   Y       +         +  +  ++S
Sbjct: 342 ---AHECIRPTEMSVSTEDAKIADADQRKL---YDLIYKRTMASQMAAAKLERTVVDITS 395

Query: 267 FSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSST 326
             + +    L    Q+ +F        D F+ + +E            ++    +   + 
Sbjct: 396 ADEQV---VLRANGQVMVF--------DGFIAIYEEGKDDSVVDDDDKRLPQLTEGEKAD 444

Query: 327 KIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNL----LSGKCQLEG 382
           K   + +        +     L     +  I         + +I +           +  
Sbjct: 445 KKSVNPEQHFTQPPPRYTEATLVKRMEELGIGRPSTYASIVTTIQDRGYVEKDKNRLIPQ 504

Query: 383 PNSAEEPIITLQFALDAYN----------LNMQDLDRDQLRNVLTSNPSDPDSYANKSKD 432
                       +                L+         + VL     D  +   ++ D
Sbjct: 505 DKGRLVTAFLTNYFRKYIGYDFTADLENQLDEVSAGDADYKKVLGQFWRDFSAAIAETAD 564

Query: 433 DRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSME 488
            R+ ++    N   +  + P     S   +  N        R+          S  
Sbjct: 565 LRITEVLEKINEVLEPHLFPPTEGGSDPRLCPNCGAGRLSMRTARSGGAFIGCSNY 620


>gi|224093192|ref|XP_002309827.1| predicted protein [Populus trichocarpa]
 gi|222852730|gb|EEE90277.1| predicted protein [Populus trichocarpa]
          Length = 520

 Score = 38.3 bits (87), Expect = 4.6,   Method: Composition-based stats.
 Identities = 36/311 (11%), Positives = 82/311 (26%), Gaps = 13/311 (4%)

Query: 174 TPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQI 233
             +  +     +V+    ++         +   +  +++F  Q   ++          + 
Sbjct: 172 PSEVGTQAAASEVIEENKSHEPTAEKTITNLGDKTSSKSFNVQKSQTVGDERSTCPTEED 231

Query: 234 EKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLS----LFPLNP 289
           +K  S+   +T + +   +        +    S S+    P     L  +    +     
Sbjct: 232 KKSPSSSVTSTDNIIADHTSSAAEDGLLAQEKSVSNHTGVPTGGSELSTTEIKEVGDKKA 291

Query: 290 EITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILH 349
           E   D     +  N  +         I    D  S  +    +   + +  Y    Q   
Sbjct: 292 ESMDDMVPGTLNNNKKVNVSSDVHLNIRLP-DGVSLQEKFSVTSTLRTVKDYVDRNQASG 350

Query: 350 DDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDR 409
                  I  Y       + ++  LS    L        P           +L+ +    
Sbjct: 351 IGAYDLAI-PYPRKTFSDQDLNKSLSELSLLNRQALIVVPRQRATSYHQRGSLSDRATTT 409

Query: 410 DQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHY 469
               +V   N +D   +A   +    +     F     GS  P    Q++  I +     
Sbjct: 410 TSSGSV---NANDGGYFAYVKRILSYVNPLSYFG----GSANPSSSGQAQSAIGEYEWTD 462

Query: 470 ANRKRSIHDAE 480
            N   +  +  
Sbjct: 463 QNSSSTGRNDS 473


>gi|21654700|gb|AAG61158.1| dextransucrase DsrD [Leuconostoc mesenteroides]
          Length = 1527

 Score = 38.3 bits (87), Expect = 4.7,   Method: Composition-based stats.
 Identities = 49/473 (10%), Positives = 132/473 (27%), Gaps = 42/473 (8%)

Query: 103 SYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRR 162
           ++D     +V  +  + K  +      +         +++ F      + +         
Sbjct: 293 TFDQETGQEVSNTTSEIKEGLTTQNTDYSEHNAAHGTDAEDFENIDGYLTASSWYRPTDI 352

Query: 163 LLDYVLQSFSITPKYISLPFLKDVLTLGLANPKK---YFIESRDNRFRAMAENFRFQPDG 219
           L +          +  +    + +L++   +      Y     D  F + A++F      
Sbjct: 353 LRN------GTDWEPSTDTDFRPILSVWWPDKNTQVNYLNYMADLGFISNADSFETGDSQ 406

Query: 220 SLSKRDKILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKM 279
           SL           ++K +    +       +      + +     +  S+ + +  L   
Sbjct: 407 SL----LNEASNYVQKSIEMKISAQQSTEWLKDAMAAFIVTQPQWNETSEDMSNDHLQNG 462

Query: 280 LQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLD 339
               +           F  L +       +  Y        DNS        +       
Sbjct: 463 ALTYVNSPLTPDANSNFRLLNRTPTNQTGEQAYNL------DNSKGGFELLLAN------ 510

Query: 340 LYKKNCQILHDDKMQSLIKDYQLPLGKIKSID---NLLSGKCQLEGPNSAEEPIITLQFA 396
               +         Q     Y +  G I + D   N    +        A+   I   + 
Sbjct: 511 --DVDNSNPVVQAEQLNWLYYLMNFGTITANDADANFDGIRVDAVDNVDADLLQIAADYF 568

Query: 397 LDAYNLNMQDLDRDQLRNVLTSNPSDPDSYA-----NKSKDDRLIKLNHAFNFNADGSIG 451
             AY ++  D   +Q  ++L     +   Y      ++   D  +     ++      I 
Sbjct: 569 KLAYGVDQNDSTANQHLSILEDWSHNDPLYVTDQGSDQLTMDDYVHTQLIWSLTKSSDIR 628

Query: 452 PIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINL---EINSEVDYYT 508
                     + D        +   + +  ++ +S  Q    + ++    ++ + +   T
Sbjct: 629 GTMQRFVDYYMVDRSNDSTENEAIPNYSFVRAHDSEVQTVIAQIVSDLYPDVENSLAPTT 688

Query: 509 LNIN---TIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPK 558
             +     +++ +E LA+K+   + + +         +D +  ++  DL    
Sbjct: 689 EQLAAAFKVYNEDEKLADKKYTQYNM-ASAYAMLLTNKDTVPRVYYGDLYTDD 740


>gi|282900548|ref|ZP_06308491.1| hypothetical protein CRC_01910 [Cylindrospermopsis raciborskii
            CS-505]
 gi|281194562|gb|EFA69516.1| hypothetical protein CRC_01910 [Cylindrospermopsis raciborskii
            CS-505]
          Length = 3886

 Score = 38.3 bits (87), Expect = 5.3,   Method: Composition-based stats.
 Identities = 29/275 (10%), Positives = 67/275 (24%), Gaps = 24/275 (8%)

Query: 101  ARSYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKD 160
            A +++F                   + +          E             S   + ++
Sbjct: 803  AAAFNFETKNSYSIRVRSTDQGGLFFDKELIINVTNVNEAPT------DLTLSATTIAEN 856

Query: 161  RRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGS 220
            + +   V    +  P   +      V   G  +   + I+    +    A  F F+   S
Sbjct: 857  QAIGTVVGNLSTTDPDTGNTFTYSLVTGTGSIDNSSFTIDGGQLK---TAAAFNFETKNS 913

Query: 221  LSKRDKILTD-----MQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPK 275
             S R +          +   I     N T   + + +       AI +V           
Sbjct: 914  YSIRVRSTDQGGLFFDKELIINVTNVNETPTDLTLSATSIAENQAIGTVVGNFSTTDPDA 973

Query: 276  LFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQ 335
                   +   +    + D     +  N     Q++     +F   NS S +++   Q  
Sbjct: 974  GNTF---TYSLVTGTGSIDNSSFTIVGN-----QLRTAAAFDFETKNSYSIRVRSTDQGG 1025

Query: 336  KMLDLYKKNCQILHDDK--MQSLIKDYQLPLGKIK 368
               +          ++     +    +        
Sbjct: 1026 LSFEKQLTINVTNVNEAPSFANATATFSRAENSTT 1060


>gi|23335681|ref|ZP_00120915.1| COG1511: Predicted membrane protein [Bifidobacterium longum DJO10A]
 gi|189440109|ref|YP_001955190.1| hypothetical protein BLD_1247 [Bifidobacterium longum DJO10A]
 gi|239622652|ref|ZP_04665683.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|322688359|ref|YP_004208093.1| hypothetical protein BLIF_0168 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|322690379|ref|YP_004219949.1| hypothetical protein BLLJ_0187 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|189428544|gb|ACD98692.1| Hypothetical membrane protein [Bifidobacterium longum DJO10A]
 gi|239514649|gb|EEQ54516.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|291517577|emb|CBK71193.1| YhgE/Pip N-terminal domain/YhgE/Pip C-terminal domain
           [Bifidobacterium longum subsp. longum F8]
 gi|320455235|dbj|BAJ65857.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320459695|dbj|BAJ70315.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 720

 Score = 38.3 bits (87), Expect = 5.6,   Method: Composition-based stats.
 Identities = 51/382 (13%), Positives = 111/382 (29%), Gaps = 31/382 (8%)

Query: 70  AEKFIKKILESDLSDPKSLVNQLNSLKYQYFARSYDFSPPPKVIQSDIQHKTIIQDYKQS 129
              F K I  + L    SL +QL+  + +    +++ +      Q D     +      +
Sbjct: 163 NTTFAKTITSAGLEIASSLADQLSKPEAKEQLNTFNANIANFATQLDDTADLLGTYSALT 222

Query: 130 HQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTL 189
                 +    S   + +         L   ++ +  V  +   T   +S          
Sbjct: 223 DTAGALLDTSNSLITQVSSAAKQGGKDLASAKQEVTDVAGALGTTADAMSSA-------- 274

Query: 190 GLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKI-LTDMQIEKIVSNYFNNTIDCV 248
                      S      ++ + +    DG+ +  D++      I K    Y        
Sbjct: 275 -----LDASASSFGAVSDSIDKLYSDANDGATTVADELDRQATAIGKQTEKYTEIRNTLA 329

Query: 249 PIVSDQNYYKLAINSVSSFSDFLK-DPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIV 307
            I+ + +      + +++    +    +L + L  +   +       +      +N    
Sbjct: 330 GILGNDS------SIITAIDRSIARQNRLRQALNTAATDIRQGNQDAQDQHAQVKNLADQ 383

Query: 308 SQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKI 367
           +Q       N   D S++ K Q DS    + D            ++ S + D +   G  
Sbjct: 384 AQNSIA---NIKSDFSATVKPQIDSLSSTVADA--SGILSSGATQLDSTLGDLK---GTS 435

Query: 368 KSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRD--QLRNVLTSNPSDPDS 425
               ++LS         S +      + A     L+      D   ++ VL ++P    S
Sbjct: 436 DDASDMLSDARTTLDKVSGKLRSAGAELASFNSTLSDALNSGDMGMVKEVLGNDPETLAS 495

Query: 426 YANKSKDDRLIKLNHAFNFNAD 447
                   R   +    NF + 
Sbjct: 496 TLAAPVQLRRKAVFPVANFGSS 517


>gi|194899231|ref|XP_001979164.1| GG13930 [Drosophila erecta]
 gi|190650867|gb|EDV48122.1| GG13930 [Drosophila erecta]
          Length = 1128

 Score = 38.3 bits (87), Expect = 5.7,   Method: Composition-based stats.
 Identities = 34/293 (11%), Positives = 75/293 (25%), Gaps = 18/293 (6%)

Query: 127 KQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDV 186
           K S         E       N   I     L  D  +  Y    F +           D+
Sbjct: 615 KPSDTTALLTTSENPPAISDNADDIKK--SLLSDTTVKKYS-NLFGLKSAQGRGASEADI 671

Query: 187 LTLGLANPKKYFIESRDNRFRAMAENFRFQPD-GSLSKRDKILTDMQI-EKIVSNYFNNT 244
            T  L+N           +++   +        G+L+ + +     QI    +S+Y  N 
Sbjct: 672 STGLLSNQANGTQSEAGPKYQQFPQIGSTGSTIGALADKPETRKIAQIFSNALSSYLENP 731

Query: 245 IDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQEND 304
                 ++ + +     ++ +       DP LF       +     +      T      
Sbjct: 732 ATFRAELAARAHPTEPPSTPNFKPVTTTDPSLFSDGTAKYYLPTKGLPDATTPTPNSIAA 791

Query: 305 PIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDL---YKKNCQILHDDKMQSLIKDYQ 361
            I  +        F                +   +    +         D  +  ++  Q
Sbjct: 792 EINHKFDSTLAPEFST---------TTELYEGSTNRGLEFSGELSPPSQDSGEEFLQQQQ 842

Query: 362 LPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRN 414
                +KS ++LL      +   + +              L+   ++   ++ 
Sbjct: 843 TQSF-VKSRNDLLKDARPQKLVTTHKPTEHPWALKSQTDFLDPLTINDGLMKE 894


>gi|262190866|ref|ZP_06049085.1| AAA ATPase [Vibrio cholerae CT 5369-93]
 gi|262033257|gb|EEY51776.1| AAA ATPase [Vibrio cholerae CT 5369-93]
          Length = 1398

 Score = 37.9 bits (86), Expect = 6.1,   Method: Composition-based stats.
 Identities = 51/417 (12%), Positives = 117/417 (28%), Gaps = 23/417 (5%)

Query: 170 SFSITPKYISLPFLKDVLTLGLANPKKY-FIESRDNRFRAMAENFRFQPDGSLSK--RDK 226
           +F+    +   P ++  L   L  P      E    +         F  D S      + 
Sbjct: 527 AFAQADDFDFNPEIEGGLEDDLPQPSALPANEFGTPQDEDWV----FDEDDSSPTLEGNA 582

Query: 227 ILTDMQIEKIVSNYFNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSLFP 286
            L     E  +      T +    +      +   N+V +  D L    L + ++ SL  
Sbjct: 583 ELELSSAEDDLPEQTTATNETADELLADLAAQPQSNTVDTSDDALAPDALSQSVEESLTL 642

Query: 287 LNPEIT--ADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLDLYKKN 344
            + E+    D+             + +   +I    +  ++     +S +  + +L    
Sbjct: 643 NDLELPEENDEPQLAEVTPSSAFDEQQVETEIEPESEPLAAEASNDESDLTALNELDLPE 702

Query: 345 CQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNM 404
                      L    +  +     + +    +      +  + P  T + AL    L  
Sbjct: 703 YTEEDALADAQLEPATESEVDPELELASEPVEEEAFTELDELDLPEYTEEDALADAQLEP 762

Query: 405 QDLDRDQLRNVLTSNPSDPDSYA--NKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTI 462
                 +    L S+  + +++   N+       + +      AD  + P    +    +
Sbjct: 763 AVESEVEPELELASDLDEEEAFTELNELDLPEYTEEDAL----ADAQLEPAAESEVEPEL 818

Query: 463 RDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEEL-- 520
               +       +  D  +    + E      ++     SEV+      + +   E    
Sbjct: 819 ELASEPAEEEAFTELDELDLPEYTEEDALADAQLEPAAKSEVEPELELASDLEEEEAFTE 878

Query: 521 LANKRILNF----LLESKGIDSQKVREDFLCEIFKSDLKDPKSF--ANTYKDNRYKE 571
           L    +  +     L    ++     E        S L++ ++F   N      Y E
Sbjct: 879 LNELDLPEYTEEDALADAQLEPAAESEVEPELELASVLEEEEAFTELNKLDLPEYTE 935


>gi|327537829|gb|EGF24533.1| protein containing Cadherin domain [Rhodopirellula baltica WH47]
          Length = 7436

 Score = 37.9 bits (86), Expect = 6.7,   Method: Composition-based stats.
 Identities = 45/443 (10%), Positives = 117/443 (26%), Gaps = 19/443 (4%)

Query: 103  SYDFSPPPKVIQSDIQHKTIIQDYKQSHQHKEEVALEESKYFRKNIHKINSVDQLFKDRR 162
            +++F+   +        +T+I  Y  S        L +++        I   +       
Sbjct: 6509 TWNFNSGSEAFDFLADGETLILTYVVSATDDSGSLLSDTETVTV---TITGTNDGPTASV 6565

Query: 163  LLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLS 222
                  +S  I    +       VL+            S       +A   +    GS++
Sbjct: 6566 DTGTATESGGIANATVGSDATGSVLSNDTD-----VDVSDSLSVVGVAAGSQGSASGSVA 6620

Query: 223  KRDKILTDMQIEKIVSNY---FNNTIDCVPIVSDQNYYKLAINSVSSFSDFLKDPKLFKM 279
                            +Y    + T   V  +   +     + + +   D   +    ++
Sbjct: 6621 SNVAGTFGTIQIASNGSYTYVIDETNSTVQALRTTSDTLQDVFTYT-IEDSNGENSTAEI 6679

Query: 280  LQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQINFHRDNSSSTKIQQDSQIQKMLD 339
                    +           + E     + +      +    ++++  +  D+  +  +D
Sbjct: 6680 TITIQGANDNPHDLATTGLTVIETANNGTSIGTITHSDVDSGDTATFTLTDDANGRFTID 6739

Query: 340  LYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDA 399
                   +    ++            ++         +  +     A E  ++     DA
Sbjct: 6740 PNTGEVTVADTSQLDHETDTTHNITVRVTDTAGATYDETFVVMITDANEHPVSTPTDSDA 6799

Query: 400  YNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSR 459
               ++ +   + +   +T++  D DS  N          +  F  +           +  
Sbjct: 6800 AANDVNENSAEGISVGITADAFDLDSTNNTVTYSLTSNPDGLFQID-------PNTGEVT 6852

Query: 460  LTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEE 519
             +     +      RSI      S  S    +    IN      V   T N    +  +E
Sbjct: 6853 TSANAIDRETHGPSRSITVQATSSDGSTATATFNIAINDLNEFNVSTPTDNDLGTNEVDE 6912

Query: 520  LLANKRILNFLLESKGIDSQKVR 542
             +A    +    ++  +D+    
Sbjct: 6913 NVAAGTTVGVTADAFDLDATNNT 6935


>gi|300790338|ref|YP_003770629.1| two-component system sensor kinase [Amycolatopsis mediterranei U32]
 gi|299799852|gb|ADJ50227.1| two-component system sensor kinase [Amycolatopsis mediterranei U32]
          Length = 1046

 Score = 37.9 bits (86), Expect = 6.8,   Method: Composition-based stats.
 Identities = 34/278 (12%), Positives = 81/278 (29%), Gaps = 32/278 (11%)

Query: 326 TKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPNS 385
              +Q ++ Q+  D  +    +     +  L  +  L + +I S + LL      +    
Sbjct: 83  DDARQAAEFQRTAD--QVAFAVKVTTVVHELQNERSLSVARISSQNQLLQTGLDSQIAKV 140

Query: 386 AEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNFN 445
             E       A    N + Q       R +   +   P              L  AFN  
Sbjct: 141 DREVQDLRGAAF-TLNYDDQATKDRYTRGLQRLDALRP--------------LRAAFN-T 184

Query: 446 ADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQI---STQKRINLEINS 502
           ++       +      I   ++       ++ D +     +  Q    + +     +   
Sbjct: 185 SNSLPDITVLTAYSGVIDSLIELGREVTTAVTDRDVLRLGTSTQAISEAKEFTTRSDAEL 244

Query: 503 EVDYYTLNINTIHSFEELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFAN 562
           ++  +  N        +LL   R      ++         +D   +++      P+    
Sbjct: 245 QIAAFRGNFPG-----DLLDQTRASASSADASVASFLANADDDQRQLYNDTYSGPE---- 295

Query: 563 TYKDNRYKEIISSFNFDIHGELSHKKIGKVQDNFHIDD 600
              D+R +   S+F+F   G+  +     +  +  +  
Sbjct: 296 --VDDRRRIQTSAFSFAQLGDPPNIDTTALSKDSTVSA 331


>gi|330448376|ref|ZP_08312024.1| HAMP domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328492567|dbj|GAA06521.1| HAMP domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 768

 Score = 37.9 bits (86), Expect = 7.1,   Method: Composition-based stats.
 Identities = 52/411 (12%), Positives = 128/411 (31%), Gaps = 54/411 (13%)

Query: 259 LAINSVSSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQIN- 317
            AIN++ +F        L K  ++ L  ++  + +     +  +   + +        N 
Sbjct: 277 DAINNIMTFDQNWNKAGLGKSGEIYLVGMDSTLRSQSRFFIEDKQAYLQTLQANNISSNV 336

Query: 318 ----------------------FHRDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQS 355
                                 F RD  + +    D +   +L  Y     +        
Sbjct: 337 IDNISKKDTAIGFQPVNTSSVQFARDGKTGSHAITDYRDIAVLSAYAPITLLNQH----- 391

Query: 356 LIKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNV 415
                   + K +++ ++ + K QL    +    ++ L  A  +Y +        ++ + 
Sbjct: 392 --WMIISEIDKAEALADVSALKTQLYKAVAICSVLLLLLAAFFSYFIGESIAKPIKILSK 449

Query: 416 LTSNPSDPDSYANKSK----DDRLIKLNHAFN-FNADGSIGPIPMMQSRLTIRDNVKHYA 470
                SD  + + +         +  L+ +FN F A           +  T+++     +
Sbjct: 450 KIIAISDNKNLSARLTIRNGGSEVNDLSTSFNQFIATLEDSFNQFSHASQTLKNQSSTIS 509

Query: 471 NRKRSIHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINT------------IHSFE 518
           N   ++  + +K   + E I+          +E+  YT N +T            I S +
Sbjct: 510 NNAVTMSQSASKQSANCENIAAAVTEMTTSVNEIARYTDNASTHVLEANSKSTVSIKSAD 569

Query: 519 ELLANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDPKSFANTYKDN-RYKEIISSFN 577
           +L+ +   L   +       + +      +    ++ D  +  NT  +      + ++  
Sbjct: 570 QLMNDIDGLMAQMN------EALTIINQLKTESEEIADVLNVINTVAEKTNLLALNAAIE 623

Query: 578 FDIHGELSHKKIGKVQDNFHIDDTCDLYKHQMIEKKEEEKDPNIALALYFK 628
               GE          +   +          + EK E  ++ +  +AL  +
Sbjct: 624 AARAGEHGRGFAVVADEVRTLASMTKDSTENIKEKIERLQNESSKVALSVE 674


>gi|149177009|ref|ZP_01855617.1| probable extracellular nuclease [Planctomyces maris DSM 8797]
 gi|148844074|gb|EDL58429.1| probable extracellular nuclease [Planctomyces maris DSM 8797]
          Length = 1076

 Score = 37.9 bits (86), Expect = 7.2,   Method: Composition-based stats.
 Identities = 38/294 (12%), Positives = 85/294 (28%), Gaps = 15/294 (5%)

Query: 215  FQPDGSLSKRDKILTDMQIEKIVSNYF---NNTIDCVPIVSDQNYYKLAINSVSSFSDFL 271
            F  + ++     +  +      +       N T      +S+     +A +++S  S   
Sbjct: 773  FSVNTAVDSGGGVYNNSSGSMTIDASTFVKNVTSGNGGAISNSGELLVANSTISENSALD 832

Query: 272  KDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKYFFQI--NFHRDNSSSTKIQ 329
                ++     +   +N  I  +   + +     I       F I  +   +NSS   +Q
Sbjct: 833  LGAGIYSSTTATFEIVNSTIVLNYTRSALSRGAAIYGSNSNSFSITNSIIAENSSGQSVQ 892

Query: 330  QDSQIQKMLDLYKKNCQ-----ILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQLEGPN 384
                 +   ++   +       +L D+  ++           I + DN  S    L    
Sbjct: 893  ISGLYEDQNNIILDSIDGLIDPVLRDNGGETETHALLPGSAAINAGDNSFSTHAGLISDQ 952

Query: 385  SAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLNHAFNF 444
                         +  ++   +     L    TS+ +D D  A        I+L +AF+ 
Sbjct: 953  RGAGFPRVFD---ETVDVGAVEFQTAYLLVDTTSDLNDGDYSAGNLSLREAIELANAFSA 1009

Query: 445  NADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINL 498
                S       Q+     + +    +    I    ++        S    I+ 
Sbjct: 1010 VDTISFSNALAGQTITLSDELL--ITDDVTIIGLGADQLTLDGNGNSRIFTIDD 1061


>gi|260459101|ref|ZP_05807356.1| kinesin-like protein [Mesorhizobium opportunistum WSM2075]
 gi|259034655|gb|EEW35911.1| kinesin-like protein [Mesorhizobium opportunistum WSM2075]
          Length = 873

 Score = 37.5 bits (85), Expect = 9.0,   Method: Composition-based stats.
 Identities = 49/428 (11%), Positives = 119/428 (27%), Gaps = 16/428 (3%)

Query: 150 KINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLANPKKYFIESRD--NRFR 207
           +I +   + +D  L        S+T        +  +    ++             +R  
Sbjct: 314 EIGAASDIIRDSILN--ASTKLSMTITNSGDTLIDRINESSMSIFDSVEGRLDTITDRLS 371

Query: 208 AMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTID-----CVPIVSDQNYYKLAIN 262
              E F    D  ++K     TD     +     + T            +  + ++ ++N
Sbjct: 372 TSGEAFASLLDTRIAKLTD-TTDGLTRSLTDLLDDRTTGMVSLLGGAARTLNSEFEASLN 430

Query: 263 SV--SSFSDFLKDPKLFKMLQLSLFPLNPEITADKFLTLMQENDPIVSQVKY-FFQINFH 319
            +  +           F+    +L     ++ A       Q N+ +V + +         
Sbjct: 431 GIERTLAERGQALISEFQTRAEALDTGTQKLNAALEARARQINETLVERAREIAHTFAES 490

Query: 320 RDNSSSTKIQQDSQIQKMLDLYKKNCQILHDDKMQSLIKDYQLPLGKIKSIDNLLSGKCQ 379
           +D  S+   Q  +QI   +     +   + + +        +     +    +    +  
Sbjct: 491 KDTLSAMIDQGKTQIGADMADIVNSTSTMLEARASDFAGRMEAARHVVSRSFD-SDIQRL 549

Query: 380 LEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVLTSNPSDPDSYANKSKDDRLIKLN 439
            +     EE +      L      M       L     S      +  N+ +     +  
Sbjct: 550 SDARVGIEEAVENHSRKLSESRERMAAAMEADLAKFDESRAGIDAAVTNQVQKLAEGRSL 609

Query: 440 HAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRSIHDAENKSFNSMEQISTQKRINLE 499
            A     D             ++  +++     +  +  A N+    + Q  T     + 
Sbjct: 610 IARALEEDLRKVNESRAAIDASLGSHLERLEEGRNRLSLALNEDSGKLVQARTIIDEMVA 669

Query: 500 INSEVDYYTLNINTIHSFEEL--LANKRILNFLLESKGIDSQKVREDFLCEIFKSDLKDP 557
            +        NI +     +L  L++ R     L +  ++        L    +SD+   
Sbjct: 670 GHVGKLAEGRNILSRALEADLGKLSDSRADIDGLVAGQVEKIAEGRAVLARALESDIAGI 729

Query: 558 KSFANTYK 565
           KS   ++ 
Sbjct: 730 KSLIESHS 737


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.304    0.120    0.287 

Lambda     K      H
   0.267   0.0367    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,115,002,302
Number of Sequences: 14124377
Number of extensions: 174144409
Number of successful extensions: 527851
Number of sequences better than 10.0: 1069
Number of HSP's better than 10.0 without gapping: 168
Number of HSP's successfully gapped in prelim test: 901
Number of HSP's that attempted gapping in prelim test: 523737
Number of HSP's gapped (non-prelim): 2342
length of query: 750
length of database: 4,842,793,630
effective HSP length: 147
effective length of query: 603
effective length of database: 2,766,510,211
effective search space: 1668205657233
effective search space used: 1668205657233
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.1 bits)
S2: 85 (37.5 bits)