RPSBLAST alignment of GI: 254781009 and MMDB domain: 2o8s_A_69-192

>2o8s_A (A:69-192) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str}Length = 124
 Score =  105 bits (265), Expect = 1e-23
 Identities = 24/113 (21%), Positives = 49/113 (43%)

Query: 133 KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYISLPFLKDVLTLGLA 192
           K+     E++Y+R+ I  + S+D    D RL +Y L++  +     +  F++ VLT G +
Sbjct: 9   KQPDVARETEYYREKIGSVKSIDDFXADTRLYNYALKAHGLEDXAYAKAFIRKVLTEGAS 68

Query: 193 NPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSNYFNNTI 245
           +   +  +  DNR+  +A++  F   G+ +   +      I            
Sbjct: 69  DKNAFANKLSDNRYAELAKSLDFAGLGAAATATEAAKSGVIGNYARQTLEQEA 121