RPSBLAST alignment of GI: 254781009 and MMDB domain: 2o8s_A_69-192

>2o8s_A (A:69-192) AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str}Length = 124
 Score = 76.7 bits (189), Expect = 8e-15
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 13/94 (13%)

Query: 357 IKDYQLPLGKIKSIDNLLSGKCQLEGPNSAEEPIITLQFALDAYNLNMQDLDRDQLRNVL 416
            + Y+  +G +KSID+  +   +L              +AL A+ L      +  +R VL
Sbjct: 17  TEYYREKIGSVKSIDDFXADT-RL------------YNYALKAHGLEDXAYAKAFIRKVL 63

Query: 417 TSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSI 450
           T   SD +++ANK  D+R  +L  + +F   G+ 
Sbjct: 64  TEGASDKNAFANKLSDNRYAELAKSLDFAGLGAA 97