RPSBLAST alignment of GI: 254781009 and protein with PDBid: 2o8s

>2o8s_A AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} SCOP: a.295.1.1 Length = 323
 Score =  187 bits (475), Expect = 1e-47
 Identities = 63/276 (22%), Positives = 110/276 (39%), Gaps = 22/276 (7%)

Query: 416 LTSNPSDPDSYANKSKDDRLIKLNHAFNFNADGSIGPIPMMQSRLTIRDNVKHYANRKRS 475
           L++ P  P S    S      K                   +S          Y + +  
Sbjct: 13  LSAMPPAPPSPQPVSH-----KQAATLCRQGRTCALKSGSNESG---GSVTSTYTSYRLI 64

Query: 476 IHDAENKSFNSMEQISTQKRINLEINSEVDYYTLNINTIHSFEELLANKRILNFLLESKG 535
             D       S+E++S Q     ++  E +YY   I ++ S ++ +A+ R+ N+ L++ G
Sbjct: 65  SQDIGK----SLERVSKQP----DVARETEYYREKIGSVKSIDDFMADTRLYNYALKAHG 116

Query: 536 IDSQKVREDFLCEIFKSDLKDPKSFANTYKDNRYKEIISSFNFDIHGELSHKKIGKVQDN 595
           ++     + F+ ++      D  +FAN   DNRY E+  S +F   G             
Sbjct: 117 LEDMAYAKAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGA------AATATE 170

Query: 596 FHIDDTCDLYKHQMIEKKEEEKDPNIALALYFKRTIPNIRNHYEILGDSKLFKVVSKKLK 655
                    Y  Q +E++  + +  + LALYF+R  P I++  + L D  L +V      
Sbjct: 171 AAKSGVIGNYARQTLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTFN 230

Query: 656 LSPYFAVLPERKKIRILKKHIKINDFKDSKKVEDFL 691
           L   FA     K+  +++K I I D +D +KV   L
Sbjct: 231 LPDAFAAADVDKQAALIEKSINIKDLQDPEKVGKLL 266