RPSBLAST alignment of GI: 254781009 and protein with PDBid: 2o8s

>2o8s_A AGR_C_984P; all alpha-helical protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Agrobacterium tumefaciens str} SCOP: a.295.1.1 Length = 323
 Score =  104 bits (260), Expect = 8e-23
 Identities = 36/166 (21%), Positives = 71/166 (42%), Gaps = 3/166 (1%)

Query: 122 IIQDYKQSHQH--KEEVALEESKYFRKNIHKINSVDQLFKDRRLLDYVLQSFSITPKYIS 179
           I QD  +S +   K+     E++Y+R+ I  + S+D    D RL +Y L++  +     +
Sbjct: 64  ISQDIGKSLERVSKQPDVARETEYYREKIGSVKSIDDFMADTRLYNYALKAHGLEDMAYA 123

Query: 180 LPFLKDVLTLGLANPKKYFIESRDNRFRAMAENFRFQPDGSLSKRDKILTDMQIEKIVSN 239
             F++ VLT G ++   +  +  DNR+  +A++  F   G+ +   +      I      
Sbjct: 124 KAFIRKVLTEGASDKNAFANKLSDNRYAELAKSLDFAGLGAAATATEAAKSGVIGNYARQ 183

Query: 240 YFNNTIDCV-PIVSDQNYYKLAINSVSSFSDFLKDPKLFKMLQLSL 284
                       V    Y++    ++ S  DFL D  L ++ + + 
Sbjct: 184 TLEQEAGDDNNGVRLALYFERKAPTIKSGLDFLADDALAQVFRTTF 229