RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781010|ref|YP_003065423.1| hypothetical protein CLIBASIA_04560 [Candidatus Liberibacter asiaticus str. psy62] (195 letters) >2qne_A Putative methyltransferase; ZP_00558420.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.30A {Desulfitobacterium hafniense Y51} (A:114-181,A:366-471) Length = 174 Score = 30.0 bits (68), Expect = 0.22 Identities = 11/50 (22%), Positives = 18/50 (36%), Gaps = 5/50 (10%) Query: 148 QASEIDIAIENLPD-----HQVDRNHTLSNLRGACYQPSLVSNSSLKLWD 192 E A + + H + + HT N + Y P+L S+ W Sbjct: 101 TFDEDGXAFDVIEKVGPGGHFLTQKHTRKNHKREFYTPTLSDRSAYDTWA 150 >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} (A:) Length = 457 Score = 29.5 bits (64), Expect = 0.30 Identities = 2/41 (4%), Positives = 11/41 (26%), Gaps = 1/41 (2%) Query: 104 NLNPNHQASEIDIAIENLPDLKSNHQASEIDIAIENLPDLK 144 + + +++ ++ + E +K Sbjct: 418 TITWENLSTDNPAVTYTF-TSENGAIVGTVTTPFEAPQPIK 457 >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme A kinase, structural genomics, joint center for structural genomics, JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} (A:1-43,A:110-192) Length = 126 Score = 28.6 bits (64), Expect = 0.52 Identities = 10/43 (23%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Query: 60 KTEVKRDIRRASRLSLEEKSKNADKPTVIENQADNINIEVEVA 102 +T +KR+ RL +E V+ N + ++E +V Sbjct: 75 ETILKRNREADRRLKFQEDIVPQG--IVVANNSTLEDLEKKVE 115 >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* (B:46-594) Length = 549 Score = 28.4 bits (61), Expect = 0.73 Identities = 5/51 (9%), Positives = 14/51 (27%), Gaps = 6/51 (11%) Query: 123 DLKSNHQASEIDIAIENLP-----DLKSNHQASEIDIAIENLPDHQVDRNH 168 + + A I P +LK ++ ++ + + Sbjct: 4 FIGNC-YAVSPATVIRRFPKVRSVELKGKPHFADFNLVPDGWGGYVYPWIE 53 >2z7x_B TOLL-like receptor 1, variable lymphocyte receptor B; TLR2, TLR1, lipopeptide, innate immunity, glycoprotein, immune response, inflammatory response, leucine-rich repeat, membrane; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} (B:1-484) Length = 484 Score = 26.9 bits (57), Expect = 1.7 Identities = 9/55 (16%), Positives = 16/55 (29%), Gaps = 20/55 (36%) Query: 123 DLKSNHQASEIDIAIENLPDLKSNHQASEIDIAIENLPDHQVDRNHTLSNLRGAC 177 ++ SN S D + L L+ +I + N +C Sbjct: 450 NVASNQLKSVPDGIFDRLTSLQ------KIWL----------HTN----PWDCSC 484 >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} (A:1-38,A:106-203) Length = 136 Score = 26.3 bits (58), Expect = 2.5 Identities = 11/47 (23%), Positives = 19/47 (40%), Gaps = 6/47 (12%) Query: 47 IQENNKPRNMTIFKTEVKRDIRRASRLSLEEKSKNADKPTVIENQAD 93 ++ ++ + EV R ++ EEK K A V+EN Sbjct: 72 VRRVXARSGLS--REEVLA--RERAQXPEEEKRKRAT--WVLENTGS 112 >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} (A:46-466) Length = 421 Score = 26.4 bits (56), Expect = 2.6 Identities = 10/49 (20%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Query: 119 ENLPDLKSNHQASEIDIAIENLPDLK----SNHQASEIDIAIENLPDHQ 163 + + L+++ + +E L +L SN+Q ++I ++NL Sbjct: 1 DQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNQLTDI-TPLKNLTKLV 48 >1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} (A:272-418) Length = 147 Score = 25.8 bits (56), Expect = 3.9 Identities = 7/23 (30%), Positives = 9/23 (39%) Query: 80 KNADKPTVIENQADNINIEVEVA 102 A K + + IN EVA Sbjct: 3 DGAAKSDIPTILYERINNRWEVA 25 >2dyj_A Ribosome-binding factor A; 16S rRNA processing, 17S RNA, KH domain, structural genomics, NPPSFA; 1.84A {Thermus thermophilus HB8} (A:) Length = 95 Score = 25.8 bits (57), Expect = 4.0 Identities = 7/38 (18%), Positives = 16/38 (42%), Gaps = 2/38 (5%) Query: 35 IGNTIKKSINRVIQENNKPR--NMTIFKTEVKRDIRRA 70 + +K+++ IQ PR +T+ + +D Sbjct: 8 LEAQLKRALAEEIQALEDPRLFLLTVEAVRLSKDGSVL 45 >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling protein; HET: NAG FLC; 3.40A {Bos taurus} (A:) Length = 332 Score = 25.6 bits (54), Expect = 4.1 Identities = 5/29 (17%), Positives = 7/29 (24%) Query: 117 AIENLPDLKSNHQASEIDIAIENLPDLKS 145 +PDL S L+ Sbjct: 9 TTSGIPDLDSLPPTYSAMCPFGCHCHLRV 37 >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} (W:) Length = 461 Score = 25.3 bits (53), Expect = 5.6 Identities = 5/48 (10%), Positives = 15/48 (31%), Gaps = 5/48 (10%) Query: 104 NLNPNHQASEIDIAIENLP-----DLKSNHQASEIDIAIENLPDLKSN 146 L ++ + L + + E++ ++ L K + Sbjct: 409 CLGDAGILQLVESVRQPGCLLEQLVLYDIYWSEEMEDRLQALEKDKPS 456 >1q0v_A Hydrophilic protein; has cysteine rich putative zinc finger esential for function;...; stable, non-interacting alpha-helices; NMR {Saccharomyces cerevisiae} (A:) Length = 81 Score = 24.7 bits (54), Expect = 7.5 Identities = 16/66 (24%), Positives = 25/66 (37%), Gaps = 14/66 (21%) Query: 66 DIRRASRLSLEEKSKNADKPTVIENQADNINIEVEVATNLNPNHQASEIDIAIENLPDLK 125 IR+A LSL+E +A ++ ++ +I E PDLK Sbjct: 14 LIRKAIELSLKESRNSASSEPIVPVVE--------------SKNEVKRQEIEEEEDPDLK 59 Query: 126 SNHQAS 131 + Q S Sbjct: 60 AAIQES 65 >2odr_A Phosphoseryl-tRNA synthetase; phosphoserine tRNA synthetase class II, ligase; 3.23A {Methanococcus maripaludis S2} (A:550-614) Length = 65 Score = 24.7 bits (53), Expect = 9.4 Identities = 3/6 (50%), Positives = 6/6 (100%) Query: 96 NIEVEV 101 N+EV++ Sbjct: 1 NVEVKI 6 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.312 0.128 0.347 Gapped Lambda K H 0.267 0.0566 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,259,214 Number of extensions: 51143 Number of successful extensions: 156 Number of sequences better than 10.0: 1 Number of HSP's gapped: 151 Number of HSP's successfully gapped: 23 Length of query: 195 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 111 Effective length of database: 2,116,429 Effective search space: 234923619 Effective search space used: 234923619 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 52 (24.2 bits)