RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781010|ref|YP_003065423.1| hypothetical protein
CLIBASIA_04560 [Candidatus Liberibacter asiaticus str. psy62]
         (195 letters)



>d2dyja1 d.52.7.1 (A:4-94) Ribosome-binding factor A, RbfA
          {Thermus thermophilus [TaxId: 274]}
          Length = 91

 Score = 24.7 bits (54), Expect = 5.1
 Identities = 7/38 (18%), Positives = 16/38 (42%), Gaps = 2/38 (5%)

Query: 35 IGNTIKKSINRVIQENNKPR--NMTIFKTEVKRDIRRA 70
          +   +K+++   IQ    PR   +T+    + +D    
Sbjct: 5  LEAQLKRALAEEIQALEDPRLFLLTVEAVRLSKDGSVL 42


>d1jqna_ c.1.12.3 (A:) Phosphoenolpyruvate carboxylase {Escherichia
           coli [TaxId: 562]}
          Length = 880

 Score = 23.9 bits (51), Expect = 8.3
 Identities = 12/93 (12%), Positives = 32/93 (34%), Gaps = 1/93 (1%)

Query: 31  KRNTIGNTIKKSINRVIQENNKPRNMTIFKTEVKRDIRRASRLSLEEKSKNADKPTVIEN 90
            R T+ + + + +N  +++ +          ++ R +R+    S         +P+ ++ 
Sbjct: 140 TRRTLIHKMVE-VNACLKQLDNKDIADYEHNQLMRRLRQLIAQSWHTDEIRKLRPSPVDE 198

Query: 91  QADNINIEVEVATNLNPNHQASEIDIAIENLPD 123
                 +         PN+     +   ENL  
Sbjct: 199 AKWGFAVVENSLWQGVPNYLRELNEQLEENLGY 231


>d2q66a2 d.218.1.3 (A:5-201) Poly(A) polymerase, PAP, N-terminal
           domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId:
           4932]}
          Length = 197

 Score = 23.7 bits (51), Expect = 10.0
 Identities = 12/50 (24%), Positives = 19/50 (38%), Gaps = 1/50 (2%)

Query: 124 LKSNHQASEIDIAIENL-PDLKSNHQASEIDIAIENLPDHQVDRNHTLSN 172
           L+   +  EI    +   P +K       I +    L   QV  + TLS+
Sbjct: 120 LRERKELDEIAPVPDAFVPIIKIKFSGISIALICARLDQPQVPLSLTLSD 169


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.312    0.128    0.347 

Gapped
Lambda     K      H
   0.267   0.0599    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 636,186
Number of extensions: 26850
Number of successful extensions: 50
Number of sequences better than 10.0: 1
Number of HSP's gapped: 49
Number of HSP's successfully gapped: 10
Length of query: 195
Length of database: 2,407,596
Length adjustment: 81
Effective length of query: 114
Effective length of database: 1,295,466
Effective search space: 147683124
Effective search space used: 147683124
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 50 (23.3 bits)