254781011

254781011

orotate phosphoribosyltransferase

GeneID in NCBI database:8210034Locus tag:CLIBASIA_04565
Protein GI in NCBI database:254781011Protein Accession:YP_003065424.1
Gene range:-(1011072, 1011758)Protein Length:228aa
Gene description:orotate phosphoribosyltransferase
COG prediction:none
KEGG prediction:pyrE; orotate phosphoribosyltransferase (EC:2.4.2.10); K00762 orotate phosphoribosyltransferase [EC:2.4.2.10]
SEED prediction:Orotate phosphoribosyltransferase (EC 2.4.2.10)
Pathway involved in KEGG:Pyrimidine metabolism [PATH:las00240]
Subsystem involved in SEED:De Novo Pyrimidine Synthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE
ccccccccHHHHHHHHHHHHHHHccHHccccccEEccccccccEEEEcHHHHccHHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccEEEEccccccEEEEEEEHHHccHHHHHHHHHHHHcccEEEEEEEEEEEcccccHHHHHHHccccEEEEEEHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccc
ccccccccHHHHHHHHHHHHHHcccEEccccccEEEcccccccEEEcccEEcccHHHHHHHHHHHHHHHHHHcccccccEEcccHHHHHHHHHHHHHHccccEEEEEccccccccccEEEEccccccEEEEEEEcccccccHHHHHHHHHHcccEEEEEEEEEEccccHHHHHHHHHccccEEEEccHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHcccccc
MIVNYFPQQNIIAELVAKMLFEIkavnfspenpyhltsgivsplyiDCRKLISFVRARSMIMDLTAKTVLrnigfesidiiaggetagiPFATLLAERLNlpmiyvrkkskkhgqksqieghlfKGARVLVIEDLVTLGNSMFEFVKVIRdsggiiqdgiglffydifpevparfrenniklHYLATWNDILTIAEKLKIFNHDVLEEVRCFldnpmqwskknggige
MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKkskkhgqksqieghlfkgaRVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFldnpmqwskknggige
MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE
*************ELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQW*********
MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRK**********IEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE
***NYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWS********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE
MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE
MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target228 orotate phosphoribosyltransferase [Candidatus Liberibac
315122517231 orotate phosphoribosyltransferase [Candidatus Liberibac 1 1e-98
227820701232 orotate phosphoribosyltransferase [Sinorhizobium fredii 1 3e-78
222084760232 orotate phosphoribosyltransferase protein [Agrobacteriu 1 7e-78
150395335232 orotate phosphoribosyltransferase [Sinorhizobium medica 1 7e-78
307318052232 orotate phosphoribosyltransferase [Sinorhizobium melilo 1 3e-77
15964234232 orotate phosphoribosyltransferase [Sinorhizobium melilo 1 1e-76
209547745229 orotate phosphoribosyltransferase [Rhizobium leguminosa 1 1e-75
327190390229 orotate phosphoribosyltransferase [Rhizobium etli CNPAF 1 1e-75
116250272229 orotate phosphoribosyltransferase [Rhizobium leguminosa 1 2e-75
218509074229 orotate phosphoribosyltransferase [Rhizobium etli Brasi 1 3e-75
>gi|315122517|ref|YP_004063006.1| orotate phosphoribosyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 231 Back     alignment and organism information
 Score =  363 bits (931), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 197/228 (86%)

Query: 1   MIVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSM 60
           MI + FP+   +AELVAKMLFEIKAVNFSPE PY LTSGIVSP+YIDCRKLISF R RS 
Sbjct: 1   MIFSDFPEPKFMAELVAKMLFEIKAVNFSPEKPYRLTSGIVSPVYIDCRKLISFARVRST 60

Query: 61  IMDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIE 120
           IM+     VLRNIGFESIDIIAGGETAGIPFA  LAERL+LPMIYVRKK+K HG+KSQIE
Sbjct: 61  IMNFATTIVLRNIGFESIDIIAGGETAGIPFAAFLAERLSLPMIYVRKKTKNHGRKSQIE 120

Query: 121 GHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNI 180
           GH+FKGAR+L+IEDL+TLG SM +FV+VIR SGG++++GIGLFFYDIFP++  R REN+I
Sbjct: 121 GHIFKGARILIIEDLITLGGSMVDFVQVIRKSGGVVKNGIGLFFYDIFPDITVRLRENDI 180

Query: 181 KLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSKKNGGIGE 228
            LHYLATWNDI+ +A  LKIFN D+L+EV+ FLDNPM WS+KNGGIG+
Sbjct: 181 NLHYLATWNDIMKVATNLKIFNQDILDEVQYFLDNPMIWSEKNGGIGK 228



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227820701|ref|YP_002824671.1| orotate phosphoribosyltransferase [Sinorhizobium fredii NGR234] Length = 232 Back     alignment and organism information
>gi|222084760|ref|YP_002543289.1| orotate phosphoribosyltransferase protein [Agrobacterium radiobacter K84] Length = 232 Back     alignment and organism information
>gi|150395335|ref|YP_001325802.1| orotate phosphoribosyltransferase [Sinorhizobium medicae WSM419] Length = 232 Back     alignment and organism information
>gi|307318052|ref|ZP_07597489.1| orotate phosphoribosyltransferase [Sinorhizobium meliloti AK83] Length = 232 Back     alignment and organism information
>gi|15964234|ref|NP_384587.1| orotate phosphoribosyltransferase [Sinorhizobium meliloti 1021] Length = 232 Back     alignment and organism information
>gi|209547745|ref|YP_002279662.1| orotate phosphoribosyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 229 Back     alignment and organism information
>gi|327190390|gb|EGE57487.1| orotate phosphoribosyltransferase [Rhizobium etli CNPAF512] Length = 229 Back     alignment and organism information
>gi|116250272|ref|YP_766110.1| orotate phosphoribosyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 229 Back     alignment and organism information
>gi|218509074|ref|ZP_03506952.1| orotate phosphoribosyltransferase [Rhizobium etli Brasil 5] Length = 229 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target228 orotate phosphoribosyltransferase [Candidatus Liberibac
PRK00455202 PRK00455, pyrE, orotate phosphoribosyltransferase; Vali 1e-50
TIGR00336173 TIGR00336, pyrE, orotate phosphoribosyltransferase 6e-22
PRK05500477 PRK05500, PRK05500, bifunctional orotidine 5'-phosphate 3e-19
PRK13809206 PRK13809, PRK13809, orotate phosphoribosyltransferase; 2e-16
COG0461201 COG0461, PyrE, Orotate phosphoribosyltransferase [Nucle 9e-36
PRK13810187 PRK13810, PRK13810, orotate phosphoribosyltransferase; 3e-16
PRK13811170 PRK13811, PRK13811, orotate phosphoribosyltransferase; 1e-11
PRK13812176 PRK13812, PRK13812, orotate phosphoribosyltransferase; 1e-10
TIGR01367187 TIGR01367, pyrE_Therm, orotate phosphoribosyltransferas 3e-10
COG0503179 COG0503, Apt, Adenine/guanine phosphoribosyltransferase 1e-09
PRK02277200 PRK02277, PRK02277, orotate phosphoribosyltransferase-l 1e-09
COG0856203 COG0856, COG0856, Orotate phosphoribosyltransferase hom 5e-07
PRK08558238 PRK08558, PRK08558, adenine phosphoribosyltransferase; 7e-07
PRK12560187 PRK12560, PRK12560, adenine phosphoribosyltransferase; 7e-06
TIGR01744191 TIGR01744, XPRTase, xanthine phosphoribosyltransferase 2e-04
pfam00156123 pfam00156, Pribosyltran, Phosphoribosyl transferase dom 1e-09
PRK02304175 PRK02304, PRK02304, adenine phosphoribosyltransferase; 4e-07
TIGR01090169 TIGR01090, apt, adenine phosphoribosyltransferase 5e-06
PRK07322178 PRK07322, PRK07322, adenine phosphoribosyltransferase; 2e-05
PRK06031233 PRK06031, PRK06031, phosphoribosyltransferase; Provisio 0.002
KOG1712183 KOG1712, KOG1712, KOG1712, Adenine phosphoribosyl trans 5e-05
>gnl|CDD|179036 PRK00455, pyrE, orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>gnl|CDD|129436 TIGR00336, pyrE, orotate phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|180119 PRK05500, PRK05500, bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>gnl|CDD|184340 PRK13809, PRK13809, orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30809 COG0461, PyrE, Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|184341 PRK13810, PRK13810, orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|172342 PRK13811, PRK13811, orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184342 PRK13812, PRK13812, orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162319 TIGR01367, pyrE_Therm, orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>gnl|CDD|30849 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179404 PRK02277, PRK02277, orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|31197 COG0856, COG0856, Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181466 PRK08558, PRK08558, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183595 PRK12560, PRK12560, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130805 TIGR01744, XPRTase, xanthine phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|143924 pfam00156, Pribosyltran, Phosphoribosyl transferase domain Back     alignment and domain information
>gnl|CDD|179411 PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162198 TIGR01090, apt, adenine phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|180928 PRK07322, PRK07322, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180357 PRK06031, PRK06031, phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|36924 KOG1712, KOG1712, KOG1712, Adenine phosphoribosyl transferases [Nucleotide transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 228 orotate phosphoribosyltransferase [Candidatus Liberibac
PRK13809206 orotate phosphoribosyltransferase; Provisional 100.0
PRK05500478 bifunctional orotidine 5'-phosphate decarboxylase/orota 100.0
PRK00455200 pyrE orotate phosphoribosyltransferase; Validated 100.0
PRK13810187 orotate phosphoribosyltransferase; Provisional 100.0
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide tran 100.0
PRK13812174 orotate phosphoribosyltransferase; Provisional 100.0
PRK13811170 orotate phosphoribosyltransferase; Provisional 100.0
TIGR00336187 pyrE orotate phosphoribosyltransferase; InterPro: IPR00 100.0
TIGR01367205 pyrE_Therm orotate phosphoribosyltransferase; InterPro: 100.0
TIGR01743269 purR_Bsub pur operon repressor; InterPro: IPR010078 Thi 99.76
KOG1712183 consensus 99.75
KOG1377261 consensus 99.67
PRK02277201 orotate phosphoribosyltransferase-like protein; Provisi 99.92
TIGR01090175 apt adenine phosphoribosyltransferase; InterPro: IPR005 99.9
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleotide 99.82
PRK00553340 ribose-phosphate pyrophosphokinase; Provisional 99.24
PRK02812331 ribose-phosphate pyrophosphokinase; Provisional 99.13
PRK06827381 phosphoribosylpyrophosphate synthetase; Provisional 99.11
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide 99.07
PRK04554327 consensus 99.06
PRK02269321 ribose-phosphate pyrophosphokinase; Provisional 99.05
PTZ00145443 phosphoribosylpyrophosphate synthetase; Provisional 98.97
PRK02270327 consensus 98.89
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Provisi 98.51
KOG1448316 consensus 98.13
TIGR01251316 ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro 97.78
PRK02304174 adenine phosphoribosyltransferase; Provisional 99.9
PRK12560184 adenine phosphoribosyltransferase; Provisional 99.88
PRK08558238 adenine phosphoribosyltransferase; Provisional 99.86
PRK09219189 xanthine phosphoribosyltransferase; Validated 99.86
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and rela 99.83
PRK07322178 adenine phosphoribosyltransferase; Provisional 99.81
PRK09213274 purine operon repressor; Provisional 99.75
TIGR01744191 XPRTase xanthine phosphoribosyltransferase; InterPro: I 99.72
PRK06031233 phosphoribosyltransferase; Provisional 99.41
PRK05205176 bifunctional pyrimidine regulatory protein PyrR uracil 98.77
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotransfe 98.58
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil phosp 98.54
PRK06388474 amidophosphoribosyltransferase; Provisional 98.37
PRK08525445 amidophosphoribosyltransferase; Provisional 98.32
PRK06781471 amidophosphoribosyltransferase; Provisional 98.31
PRK07272484 amidophosphoribosyltransferase; Provisional 98.31
PRK07631475 amidophosphoribosyltransferase; Provisional 98.29
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Provisi 98.29
PRK07847489 amidophosphoribosyltransferase; Provisional 98.29
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nuc 98.15
TIGR01203183 HGPRTase hypoxanthine phosphoribosyltransferase; InterP 98.02
TIGR01134467 purF amidophosphoribosyltransferase; InterPro: IPR00585 97.76
PTZ00149231 hypoxanthine phosphoribosyltransferase; Provisional 97.45
KOG3367216 consensus 96.84
pfam00156123 Pribosyltran Phosphoribosyl transferase domain. This fa 99.69
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 99.17
PRK04117309 consensus 99.09
PRK05259310 consensus 99.08
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 98.98
PRK00934286 ribose-phosphate pyrophosphokinase; Provisional 98.98
PRK03675279 consensus 98.92
PRK11595227 gluconate periplasmic binding protein; Provisional 98.88
COG1040225 ComFC Predicted amidophosphoribosyltransferases [Genera 98.58
COG2236192 Predicted phosphoribosyltransferases [General function 98.5
PRK07349495 amidophosphoribosyltransferase; Provisional 98.32
PRK09177156 xanthine-guanine phosphoribosyltransferase; Validated 98.32
PRK09123480 amidophosphoribosyltransferase; Provisional 98.28
PRK05793472 amidophosphoribosyltransferase; Provisional 98.27
PRK08341442 amidophosphoribosyltransferase; Provisional 98.27
KOG0572474 consensus 97.7
TIGR00201207 comF comF family protein; InterPro: IPR005222 Proteins 97.59
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 99.07
PRK01999311 consensus 99.07
PRK02039316 consensus 99.07
PRK01506317 consensus 99.07
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 98.99
PRK05038315 consensus 98.99
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisional 98.98
PRK01132286 consensus 98.95
TIGR01091213 upp uracil phosphoribosyltransferase; InterPro: IPR0057 96.47
PRK00129208 upp uracil phosphoribosyltransferase; Reviewed 96.17
PRK09246503 amidophosphoribosyltransferase; Provisional 98.8
COG1926220 Predicted phosphoribosyltransferases [General function 98.59
COG0035210 Upp Uracil phosphoribosyltransferase [Nucleotide transp 95.17
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase; InterPro: IPR004467 Orotate phosphoribosyl transferase (OPRTase) is involved in the biosynthesis of pyrimidine nucleotides Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase; InterPro: IPR006273 This group of sequences are a distinct clade of orotate phosphoribosyltransferases Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor; InterPro: IPR010078 This entry represents the pur operon repressor PurR of low-GC Gram-positive bacteria Back     alignment and domain information
>KOG1712 consensus Back     alignment and domain information
>KOG1377 consensus Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase; InterPro: IPR005764 Adenine phosphoribosyltransferase (APRTase, 2 Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK04554 consensus Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK02270 consensus Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG1448 consensus Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase; InterPro: IPR005946 Synonyms: phosphoribosylpyrophosphate synthetase Phosphoribosyldiphosphate synthetase (PRPPsase, 2 Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09213 purine operon repressor; Provisional Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase; InterPro: IPR010079 This entry represent a xanthine-specific phosphoribosyltransferase of Bacillus subtilis and closely related proteins from other species, mostly from other Gram-positive bacteria Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase; InterPro: IPR005904 Phosphoribosyltransferases (PRT) are enzymes that catalyze the synthesis of beta-n-5'-monophosphates from phosphoribosylpyrophosphate (PRPP) and an enzyme specific amine Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase; InterPro: IPR005854 Purine nucleotides are synthesised both via the de novo pathway and via the salvage pathway and are vital for cell functions and cell proliferation through DNA and RNA syntheses and ATP energy supply Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG3367 consensus Back     alignment and domain information
>pfam00156 Pribosyltran Phosphoribosyl transferase domain Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK04117 consensus Back     alignment and domain information
>PRK05259 consensus Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK03675 consensus Back     alignment and domain information
>PRK11595 gluconate periplasmic binding protein; Provisional Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG0572 consensus Back     alignment and domain information
>TIGR00201 comF comF family protein; InterPro: IPR005222 Proteins in this family are found in bacterial species which posses systems for natural transformation with exogenous DNA (eg Bacillus subtilis, Haemophilus influenzae), and also species without these systems (eg Escherichia coli) Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK01999 consensus Back     alignment and domain information
>PRK02039 consensus Back     alignment and domain information
>PRK01506 consensus Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK05038 consensus Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK01132 consensus Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase; InterPro: IPR005765 The enzyme uracil phosphoribosyltransferase (UPRT, 2 Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target228 orotate phosphoribosyltransferase [Candidatus Liberibac
3m3h_A234 1.75 Angstrom Resolution Crystal Structure Of An Or 1e-42
3dez_A243 Crystal Structure Of Orotate Phosphoribosyltransfer 2e-41
2aee_A211 Crystal Structure Of Orotate Phosphoribosyltransfer 1e-38
2wns_A205 Human Orotate Phosphoribosyltransferase (Oprtase) D 9e-32
3qw4_B453 Structure Of Leishmania Donovani Ump Synthase Lengt 4e-27
3n2l_A238 2.1 Angstrom Resolution Crystal Structure Of An Oro 3e-22
1lh0_A213 Crystal Structure Of Salmonella Typhimurium Omp Syn 5e-22
1sto_A213 Crystal Structure Of Orotate Phosphoribosyltransfer 6e-22
1oro_A213 A Flexible Loop At The Dimer Interface Is A Part Of 2e-21
2pry_A226 Apo Form Of S. Cerevisiae Orotate Phosphoribosyltra 8e-20
3mjd_A232 1.9 Angstrom Crystal Structure Of Orotate Phosphori 1e-15
2yzk_A178 Crystal Structure Of Orotate Phosphoribosyltransfer 2e-15
2p1z_A180 Crystal Structure Of Phosphoribosyltransferase From 3e-14
2dy0_A190 Crystal Structure Of Project Jw0458 From Escherichi 2e-06
1o57_A291 Crystal Structure Of The Purine Operon Repressor Of 7e-04
1p4a_A285 Crystal Structure Of The Purr Complexed With Cprpp 7e-04
1ore_A180 Human Adenine Phosphoribosyltransferase Length = 18 0.003
>gi|294662565|pdb|3M3H|A Chain A, 1.75 Angstrom Resolution Crystal Structure Of An Orotate Phosphoribosyltransferase From Bacillus Anthracis Str. 'ames Ancestor' Length = 234 Back     alignment and structure 
 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 66/220 (30%), Positives = 120/220 (54%), Gaps = 5/220 (2%)

Query: 2   IVNYFPQQNIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMI 61
             N + Q N + + +A  L EI AV   P +P+  +SG+ SP+Y D R  +S+ + R  I
Sbjct: 15  TENLYFQSNAMKKEIASHLLEIGAVFLQPNDPFTWSSGMKSPIYCDNRLTLSYPKVRQTI 74

Query: 62  MDLTAKTVLRNIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEG 121
                + +  +  F ++++IAG  TAGI  A  +++R++LPM YVR K+K HG+ +QIEG
Sbjct: 75  AAGLEELIKEH--FPTVEVIAGTATAGIAHAAWVSDRMDLPMCYVRSKAKGHGKGNQIEG 132

Query: 122 HLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIK 181
              KG +V+V+EDL++ G S    V+ +R++G  +   + +F Y+       +    N+ 
Sbjct: 133 KAEKGQKVVVVEDLISTGGSAITCVEALREAGCEVLGIVSIFTYE-LEAGKEKLEAANVA 191

Query: 182 LHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNP--MQW 219
            + L+ ++ +  +A +  I      ++++ +  NP    W
Sbjct: 192 SYSLSDYSALTEVAAEKGIIGQAETKKLQEWRKNPADEAW 231
>gi|240104312|pdb|3DEZ|A Chain A, Crystal Structure Of Orotate Phosphoribosyltransferase From Streptococcus Mutans Length = 243 Back     alignment and structure
>gi|75766134|pdb|2AEE|A Chain A, Crystal Structure Of Orotate Phosphoribosyltransferase From Streptococcus Pyogenes Length = 211 Back     alignment and structure
>gi|255917815|pdb|2WNS|A Chain A, Human Orotate Phosphoribosyltransferase (Oprtase) Domain Of Uridine 5'-Monophosphate Synthase (Umps) In Complex With Its Substrate Orotidine 5'-Monophosphate (Omp) Length = 205 Back     alignment and structure
>gi|329666255|pdb|3QW4|B Chain B, Structure Of Leishmania Donovani Ump Synthase Length = 453 Back     alignment and structure
>gi|297343233|pdb|3N2L|A Chain A, 2.1 Angstrom Resolution Crystal Structure Of An Orotate Phosphoribosyltransferase (Pyre) From Vibrio Cholerae O1 Bi Str. N16961 Length = 238 Back     alignment and structure
gi|21466078|pdb|1LH0|A Chain A, Crystal Structure Of Salmonella Typhimurium Omp Synthase In Complex With Mgprpp And Orotate Length = 213 Back     alignment and structure
>gi|157833867|pdb|1STO|A Chain A, Crystal Structure Of Orotate Phosphoribosyltransferase Length = 213 Back     alignment and structure
gi|1421029|pdb|1ORO|A Chain A, A Flexible Loop At The Dimer Interface Is A Part Of The Active Site Of The Adjacent Monomer Of Escherichia Coli Orotate Phosphoribosyltransferase Length = 213 Back     alignment and structure
gi|165760984|pdb|2PRY|A Chain A, Apo Form Of S. Cerevisiae Orotate Phosphoribosyltransferase Length = 226 Back     alignment and structure
>gi|294979885|pdb|3MJD|A Chain A, 1.9 Angstrom Crystal Structure Of Orotate Phosphoribosyltransferase (Pyre) Francisella Tularensis. Length = 232 Back     alignment and structure
>gi|160286250|pdb|2YZK|A Chain A, Crystal Structure Of Orotate Phosphoribosyltransferase From Aeropyrum Pernix Length = 178 Back     alignment and structure
>gi|145580434|pdb|2P1Z|A Chain A, Crystal Structure Of Phosphoribosyltransferase From Corynebacterium Diphtheriae Length = 180 Back     alignment and structure
>gi|134104177|pdb|2DY0|A Chain A, Crystal Structure Of Project Jw0458 From Escherichia Coli Length = 190 Back     alignment and structure
>gi|34809637|pdb|1O57|A Chain A, Crystal Structure Of The Purine Operon Repressor Of Bacillus Subtilis Length = 291 Back     alignment and structure
gi|40889286|pdb|1P4A|A Chain A, Crystal Structure Of The Purr Complexed With Cprpp Length = 285 Back     alignment and structure
gi|47168476|pdb|1ORE|A Chain A, Human Adenine Phosphoribosyltransferase Length = 180 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target228 orotate phosphoribosyltransferase [Candidatus Liberibac
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; glyco 7e-49
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 5e-47
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; struc 1e-39
2wns_A205 Orotate phosphoribosyltransferase; alternative splicing 5e-38
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 5e-29
1lh0_A213 OMP synthase; loop closure, monomer closure, orotate ph 7e-29
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid, str 1e-28
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, oprtas 2e-21
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleotide b 2e-19
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; rossm 2e-18
2p1z_A180 Phosphoribosyltransferase; structural genomics, PSI-2, 7e-17
1o57_A291 PUR operon repressor; purine operon repressor, helix-tu 6e-17
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabolism, 2e-13
1vch_A175 Phosphoribosyltransferase-related protein; structural g 8e-13
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single doma 3e-11
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardia lam 3e-11
2dy0_A190 APRT, adenine phosphoribosyltransferase; structural gen 1e-07
3dah_A319 Ribose-phosphate pyrophosphokinase; seattle structural 5e-05
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; purin 2e-04
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, magnesium, pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Length = 243 Back     alignment and structure
 Score =  189 bits (480), Expect = 7e-49
 Identities = 69/209 (33%), Positives = 124/209 (59%), Gaps = 3/209 (1%)

Query: 12  IAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLR 71
           +A+ +A+ L +IKAV   PE P+   SGI SP+Y D R  +S+   R++I +   +T+  
Sbjct: 37  LAKDIARDLLDIKAVYLKPEEPFTWASGIKSPIYTDNRITLSYPETRTLIENGFVETIKE 96

Query: 72  NIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLV 131
              F  +++IAG  TAGIP   ++A+++NLP+ Y+R K K HG  +QIEG + KG ++++
Sbjct: 97  A--FPEVEVIAGTATAGIPHGAIIADKMNLPLAYIRSKPKDHGAGNQIEGRVTKGQKMVI 154

Query: 132 IEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDI 191
           IEDL++ G S+ + V   +  G  +   + +F Y+  P+  A F + ++KL  L+ ++++
Sbjct: 155 IEDLISTGGSVLDAVAAAQREGADVLGVVAIFTYE-LPKATANFEKASVKLVTLSNYSEL 213

Query: 192 LTIAEKLKIFNHDVLEEVRCFLDNPMQWS 220
           + +A+     + D L  ++ F +N   W 
Sbjct: 214 IKVAKVQGYIDADGLTLLKKFKENQETWQ 242
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Length = 234 Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, protein structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Length = 211 Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Length = 205 Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Length = 238 Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Length = 213 Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Length = 232 Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Length = 226 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Length = 178 Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.44A {Corynebacterium diphtheriae NCTC13129} Length = 180 Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Length = 197 Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Length = 187 Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Length = 190 Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} Length = 319 Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Length = 152 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target228 orotate phosphoribosyltransferase [Candidatus Liberibac
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; struc 100.0
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 100.0
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; glyco 100.0
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, oprtas 100.0
2wns_A205 Orotate phosphoribosyltransferase; alternative splicing 100.0
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; pyrim 100.0
1lh0_A213 OMP synthase; loop closure, monomer closure, orotate ph 100.0
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid, str 100.0
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; rossm 100.0
2p1z_A180 Phosphoribosyltransferase; structural genomics, PSI-2, 100.0
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleotide b 99.97
2dy0_A190 APRT, adenine phosphoribosyltransferase; structural gen 99.95
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabolism, 99.95
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosyltransf 99.94
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single doma 99.93
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardia lam 99.93
1o57_A291 PUR operon repressor; purine operon repressor, helix-tu 99.89
1vch_A175 Phosphoribosyltransferase-related protein; structural g 99.79
3dah_A319 Ribose-phosphate pyrophosphokinase; seattle structural 99.03
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); open 99.02
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated prot 98.97
1vdm_A153 Purine phosphoribosyltransferase; structural genomics, 99.34
1wd5_A208 Hypothetical protein TT1426; structural genomics, riken 99.05
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyl 98.94
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural geno 98.92
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthine-gu 98.83
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; purin 98.81
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, 98.8
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthas 98.8
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; protein 98.78
2jky_A213 Hypoxanthine-guanine phosphoribosyltransferase; nucleus 98.78
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; rossman 98.78
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxantine-gua 98.71
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyrimidin 98.61
2jbh_A225 HHGP; glycosyltransferase, PRTFDC1, transferase, purine 98.61
1w30_A201 PYRR bifunctional protein; transferase, glycosyltransfe 98.55
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); trans 98.53
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransferase; 98.5
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; transc 98.44
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltransferas 98.36
1cjb_A231 Protein (hypoxanthine-guanine phosphoribosyltransferase 98.27
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibitor co 98.05
2h06_A326 Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthe 99.08
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransferase; 98.1
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structural ge 96.38
2ehj_A208 Uracil phosphoribosyltransferase; structural genomics, 95.97
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salvage, o 95.65
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; HET: 95.59
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosyltran 95.4
3dmp_A217 Uracil phosphoribosyltransferase; structural genomics, 95.12
1xtt_A216 Probable uracil phosphoribosyltransferase; tetramer, ty 94.08
2e55_A208 Uracil phosphoribosyltransferase; structural genomics, 92.85
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransferase; 98.56
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltra 98.51
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, protein structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
Probab=100.00  E-value=0  Score=407.22  Aligned_cols=209  Identities=32%  Similarity=0.645  Sum_probs=201.4

Q ss_pred             HHHHHHHHHHHHHCCCEEEECCCCEEEECCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCHH
Q ss_conf             89999999999865976820789867311872640142621357989999999999998664217566678998223125
Q gi|254781011|r   10 NIIAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLRNIGFESIDIIAGGETAGI   89 (228)
Q Consensus        10 ~~~~~~~a~~L~~~~ai~~~~~g~F~L~SG~~Sp~Y~d~r~~~s~P~~~~~i~~~~~~~i~~~~~~~~~d~I~G~a~~Gi   89 (228)
                      .++++++++.|++++|++|+|+|||+|+||++||||||+|+++++|+.++.+++.+++.|.++.  ..+|.|+|+|++||
T Consensus         3 m~~~~~~~~~L~~~~ai~f~~~~~F~L~SG~~S~~Yid~r~~~~~p~~~~~i~~~~~~~i~~~~--~~~d~i~G~~~~gi   80 (211)
T 2aee_A            3 MTLASQIATQLLDIKAVYLKPEDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKAHF--PEVEVIAGTATAGI   80 (211)
T ss_dssp             SCHHHHHHHHHHHTTSEEECTTSCEECGGGCEESEEECGGGGGGCHHHHHHHHHHHHHHHHHHC--TTCCEEEEETTTTH
T ss_pred             CCHHHHHHHHHHHCCCEEECCCCCEEECCCCCCHHHEECHHHHCCHHHHHHHHHHHHHHHHHHC--CCCCEECCCHHHHH
T ss_conf             4299999999997699995799985878335664563093232597899999999998887505--55363403134469


Q ss_pred             HHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHCCCCCCCEEEHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEEEECCCCH
Q ss_conf             78899985158717876315642011001331037334144087887322369999999986598785688887417632
Q gi|254781011|r   90 PFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLVIEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFP  169 (228)
Q Consensus        90 p~a~~iA~~l~~p~~~vRK~~K~hG~~~~iEG~~~~g~~vliVDDviTtG~S~~~~i~~l~~~g~~V~~~~vii~~~~~~  169 (228)
                      |+|+.+|..+++|++|+||++|+||+++++||.+.+|+||+|||||+|||+|+++++++|+++|++|++++|+++|+ ++
T Consensus        81 pla~~ia~~~~~p~~~vRKe~K~hG~~~~ieG~~~~g~~VliVEDViTTG~S~~~ai~~l~~~g~~V~~~~vivdr~-~~  159 (211)
T 2aee_A           81 PHGAIIADKMTLPFAYIRSKPKDHGAGNQIEGRVLKGQKMVIIEDLISTGGSVLDAAAAASREGADVLGVVAIFTYE-LP  159 (211)
T ss_dssp             HHHHHHHHHHTCCEEEECSSCC----CCSEESCCCTTCEEEEEEEEESSCHHHHHHHHHHHHTTCEEEEEEEEEECC-CH
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCHHHHHHCCCCCCCEEEEEEEEECCCCCHHHHHHHHHHCCCEEEEEEEEEECC-CH
T ss_conf             99999999757982355413455331232210137999899985304567215765446887498066999999888-61


Q ss_pred             HHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             4899999779809996329999999998889998999999999972997788
Q gi|254781011|r  170 EVPARFRENNIKLHYLATWNDILTIAEKLKIFNHDVLEEVRCFLDNPMQWSK  221 (228)
Q Consensus       170 ~~~~~l~~~gi~~~sl~t~~~il~~l~~~~~I~~~~~~~I~~~l~dP~~W~~  221 (228)
                      ++.++++++|+++|||+|++||++++++.++|++++++.+++|++||.+|+.
T Consensus       160 ~~~~~l~~~gi~~~sl~t~~~ll~~~~~~~~i~~~~~~~i~~~~~dp~~w~~  211 (211)
T 2aee_A          160 KASQNFKEAGIKLITLSNYTELIAVAKLQGYITNDGLHLLKKFKEDQVNWQQ  211 (211)
T ss_dssp             HHHHHHHHHTCCEEESCCHHHHHHHHHHHTSSCHHHHHHHHHHHHCTTTCC-
T ss_pred             HHHHHHHHCCCCEEEECCHHHHHHHHHHCCCCCHHHHHHHHHHHHCHHHHCC
T ss_conf             6899999669969995659999999998699999999999999859997578
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.44A {Corynebacterium diphtheriae NCTC13129} Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, polymorphism, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, catalytic loop; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; seattle structural genomics center for infectious disease, ssgcid, cytoplasm, magnesium; HET: AMP; 2.30A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzyme; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis MB4} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>2jky_A Hypoxanthine-guanine phosphoribosyltransferase; nucleus, cytoplasm, magnesium, GMP complex, FLIP peptide-plane, glycosyltransferase; HET: 5GP; 2.3A {Saccharomyces cerevisiae} PDB: 2jkz_A* Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxantine-guanine phosphoribosyltransferase, 2-(N- morpholino)ethanesulfonic acid (MES); HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>2jbh_A HHGP; glycosyltransferase, PRTFDC1, transferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii RH} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>1cjb_A Protein (hypoxanthine-guanine phosphoribosyltransferase); malaria, purine salvage, transition state inhibitor; HET: IRP; 2.00A {Plasmodium falciparum} SCOP: c.61.1.1 Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure
>2h06_A Ribose-phosphate pyrophosphokinase I; PRS1, PRPP synthetase 1, phosphoribosyl pyrophosphate synthetase 1, transferase; 2.20A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h07_A 2h08_A Back     alignment and structure
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomics, JCSG, PSI, protein structure initiative; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Escherichia coli} Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics; 2.10A {Thermus thermophilus HB8} SCOP: c.61.1.1 Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.15A {Aquifex aeolicus} Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransferase; purine biosynthesis, glycosyltransferase, glutamine amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

IdentityAlignment graphLength Definition E-value
Target 228 orotate phosphoribosyltransferase [Candidatus Liberibac
d2aeea1208 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogen 3e-38
d1lh0a_213 c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [T 4e-22
d1qb7a_236 c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxI 1e-13
d1y0ba1191 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase { 3e-13
d1vcha1174 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase T 2e-11
d1o57a2202 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-term 2e-10
d1zn7a1178 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) 1e-08
d1l1qa_181 c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5 5e-08
d1g2qa_178 c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomy 2e-09
d1nula_150 c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escher 0.003
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Orotate PRTase
species: Streptococcus pyogenes [TaxId: 1314]

 Score =  152 bits (384), Expect = 3e-38
 Identities = 67/208 (32%), Positives = 119/208 (57%), Gaps = 3/208 (1%)

Query: 12  IAELVAKMLFEIKAVNFSPENPYHLTSGIVSPLYIDCRKLISFVRARSMIMDLTAKTVLR 71
           +A  +A  L +IKAV   PE+P+   SGI SP+Y D R  +S+ + R +I +   +T+  
Sbjct: 3   LASQIATQLLDIKAVYLKPEDPFTWASGIKSPIYTDNRVTLSYPKTRDLIENGFVETIKA 62

Query: 72  NIGFESIDIIAGGETAGIPFATLLAERLNLPMIYVRKKSKKHGQKSQIEGHLFKGARVLV 131
           +  F  +++IAG  TAGIP   ++A+++ LP  Y+R K K HG  +QIEG + KG ++++
Sbjct: 63  H--FPEVEVIAGTATAGIPHGAIIADKMTLPFAYIRSKPKDHGAGNQIEGRVLKGQKMVI 120

Query: 132 IEDLVTLGNSMFEFVKVIRDSGGIIQDGIGLFFYDIFPEVPARFRENNIKLHYLATWNDI 191
           IEDL++ G S+ +        G  +   + +F Y+  P+    F+E  IKL  L+ + ++
Sbjct: 121 IEDLISTGGSVLDAAAAASREGADVLGVVAIFTYE-LPKASQNFKEAGIKLITLSNYTEL 179

Query: 192 LTIAEKLKIFNHDVLEEVRCFLDNPMQW 219
           + +A+      +D L  ++ F ++ + W
Sbjct: 180 IAVAKLQGYITNDGLHLLKKFKEDQVNW 207
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Length = 213 Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Length = 236 Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 191 Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 202 Back     information, alignment and structure
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Length = 181 Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 178 Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Length = 150 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

IdentityAlignment graphLength Definition Probability
Target228 orotate phosphoribosyltransferase [Candidatus Liberibac
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} 100.0
d1lh0a_213 Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} 100.0
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 99.97
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subtilis [ 99.95
d1o57a2202 Pur operon repressor (PurR), C-terminal domain {Bacillu