>TIGR01975 isoAsp_dipep beta-aspartyl peptidase; InterPro: IPR010229 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases . Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. This group of proteins include metallopeptidases belonging to the MEROPS peptidase family M38 (clan MJ, beta-aspartyl dipeptidase family). This entry includes the beta-aspartyl dipeptidase from Escherichia coli, (3.4.19.5 from EC, IadA), which degrades isoaspartyl dipeptides and may unblock degradation of proteins that cannot be repaired. This entry also describes closely related proteins from other species (e.g. Clostridium perfringens, Thermoanaerobacter tengcongensis) that may have an equivalent in function. This family shows homology to dihydroorotases. The L-isoaspartyl derivative of Asp arises non-enzymatically over time as a form of protein damage. In this isomerisation, the connectivity of the polypeptide changes to pass through the beta-carboxyl of the side chain. Much but not all of this damage can be repaired by protein-L-isoaspartate (D-aspartate) O-methyltransferase..

Probab=99.01 E-value=8.7e-09 Score=73.77 Aligned_cols=295 Identities=15% Similarity=0.149 Sum_probs=167.1 Q ss_pred EEEECCCCEEEEECC----CHHHHHHH----H-HHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCCEEEEEE Q ss_conf 558646642375088----17889874----9-87418873999838951489898999999999998386884699501 Q gi|254781012|r 3 KISLRVPDDWHLHLR----DGEILKTV----L-RDTAKNFRRALVMPNIDPPIITVDDACAYRQRILNALPPEYDFSPLM 73 (349) Q Consensus 3 ~l~lp~~~D~HvH~R----eg~~~~~t----~-aa~aGG~TtV~~MPNT~Ppi~t~e~~~~~~~r~~~~~~~~~~~~~~~ 73 (349) T Consensus 52 ~i~vPGfID~HVHiiGGGGEgG~~TRTPE~~Ls~~t~~GvTtvVG~lGTDgi~R~m~~L~AK-ArAL~--eEGvs~y~lt 128 (391) T TIGR01975 52 MIAVPGFIDQHVHIIGGGGEGGPKTRTPELTLSDITKGGVTTVVGLLGTDGITRDMESLLAK-ARALE--EEGVSCYVLT 128 (391) T ss_pred CEECCCCCCCCEEEEECCCCCCCCCCCHHHECCCEEECCCEEEEEEEECCCCCCCCHHHHHH-HHHHH--HCCEEEEEEE T ss_conf 08738741474578405768868888432230120112624898886278622584678999-98652--0782699963 Q ss_pred EEEECCCC--CHHHHHHHHHCCCEEEHHHCCCCCEECCCCC--CCHHHHHHHHHHHHHHCCCCEECCCCCCCCCCCCHHH Q ss_conf 34527899--9889987440687210221045510025654--1006889999999987398222025755555430014 Q gi|254781012|r 74 TIYLTETT--DPDDVEKGFTSQLVQAIKLYFAGSTTNSHHG--IRNIDRVMPVLERMETIGMPLCIHGEILNQDIDIFDR 149 (349) Q Consensus 74 ~~~lt~~~--~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~--v~~~~~~~~~le~~~~~~~~i~~H~E~~~~~~~~~~~ 149 (349) T Consensus 129 GaY~vP~~TlTgsv~sDl~LIDkvIGvG-----eiAiSDHRSaqPt~~~L~-~~aAeARVGGLLgGK~Giv~~H~Gds~~ 202 (391) T TIGR01975 129 GAYEVPVRTLTGSVKSDLLLIDKVIGVG-----EIAISDHRSAQPTVEELT-NLAAEARVGGLLGGKPGIVNLHVGDSKR 202 (391) T ss_pred CCEECCCCCCCCCEEEEEEEEEEEEEEE-----EEEECCCCCCCCCHHHHH-HHHHHHCCCCCCCCCCCEEEEEECCCHH T ss_conf 3313552001511243267883355424-----572214778874489999-9977511241116887568996369867 Q ss_pred HHHHHHHHHHHHHH-HHCCCE---EEEECCCH--HHHHHHHHHCC--CCCEEEECCCCCCCHHHHHCCCCCCCEEECCCC Q ss_conf 67654578999996-206953---99705785--89999987057--332023023100397886137888311321346 Q gi|254781012|r 150 ELMFIDKILDPLRN-KLPNLK---IILEHITT--SNGIDYVNNAT--NIAGSITVHHLIINRNAIFHDGLNPHYYCLPIP 221 (349) Q Consensus 150 E~~~~~~~l~~~~a-~~~~~~---iHi~HiST--~~sv~lir~ak--~vtaEVTPHHL~lt~~d~~~~~~~~~~k~nPPl 221 (349) T Consensus 203 ~L~~i---~~~v~~~dvPi~q~lPTH~nR~~~LFE~g~~fa~~GG~iDlTss~~p~~~~ege-----------------v 262 (391) T TIGR01975 203 KLEPI---EELVEETDVPITQFLPTHINRNRELFEAGLEFAKKGGTIDLTSSIDPQFRKEGE-----------------V 262 (391) T ss_pred HHHHH---HHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCC-----------------C T ss_conf 77799---999850588700255776476756899999999739808760278887553554-----------------3 Q ss_pred CCHHHHHHHHHHHHCCCCEE--EEECCC---CCCCHHHHHCCCCCCCCCCHHHHHHHHHHHH-HCCCCHHHHHHHHHHCC Q ss_conf 99999999999997699418--971388---8653133215457754454367999999997-20699999999982431 Q gi|254781012|r 222 KREKHRLSLRKAALSGNPRF--FLGTDS---APHWDSSKESSCGCAGIYTARNALNCLAQIF-EEENKLENLESFVSING 295 (349) Q Consensus 222 R~~~dr~aL~~ai~~G~i~d--~I~TDH---APH~~eeK~~~~~~~g~~~~~~~~~~~~~~~-~~~~~L~~l~~~~s~np 295 (349) T Consensus 263 ~---p~eGlk~~l~~gvPle~vT~sSDgnGS~P~Fde~g~l--~~~~v~~~~sLf~~v~~av~~~~~pL~~al~v~T~nv 337 (391) T TIGR01975 263 K---PAEGLKKLLEAGVPLEKVTFSSDGNGSLPLFDENGEL--KGLGVGSVESLFEEVREAVKEGDVPLEKALRVITSNV 337 (391) T ss_pred C---HHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCE--EEEEEECHHHHHHHHHHHHHHCCCCHHHCCEEECCCC T ss_conf 7---6789999996389752356423578874637678746--3357604166789999998514787657646440364 Q ss_pred HHHCCCCCC--------CCEEEEEECCCCEEECHHHCCCCCCEEECC Q ss_conf 788188988--------852899947971784711226777714657 Q gi|254781012|r 296 ATWYGIPVN--------TRKISLKRREQPIIFDEKITTSTGSITIFN 334 (349) Q Consensus 296 a~~~gl~~~--------~~~i~l~d~~~~~~v~~~~~~sk~~~tpF~ 334 (349) T Consensus 338 A~~L~L~P~KG~I~~g~DADlv~l~~~~-L~I--~~V~ArG~~mv~~ 381 (391) T TIGR01975 338 AKVLKLSPKKGEISPGKDADLVLLDKDS-LDI--HSVIARGKLMVKE 381 (391) T ss_pred CCCCCCCCCCCCCCCCCCCCEEEECCCC-CCE--EEEEECCCEEECC T ss_conf 5541367888500789972279865264-844--1577304100017

HHsearch alignment for GI: 254781012 and conserved domain: TIGR01975