BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781013|ref|YP_003065426.1| phage-associated protein
[Candidatus Liberibacter asiaticus str. psy62]
         (302 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254781013|ref|YP_003065426.1| phage-associated protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040690|gb|ACT57486.1| phage-associated protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 302

 Score =  496 bits (1278), Expect = e-138,   Method: Composition-based stats.
 Identities = 302/302 (100%), Positives = 302/302 (100%)

Query: 1   MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE 60
           MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE
Sbjct: 1   MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE 60

Query: 61  EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
           EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS
Sbjct: 61  EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120

Query: 121 TEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFD 180
           TEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFD
Sbjct: 121 TEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFD 180

Query: 181 SDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFW 240
           SDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFW
Sbjct: 181 SDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFW 240

Query: 241 VTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDT 300
           VTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDT
Sbjct: 241 VTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGKGLFGVHNDT 300

Query: 301 QP 302
           QP
Sbjct: 301 QP 302


>gi|239502391|ref|ZP_04661701.1| phage-associated protein [Acinetobacter baumannii AB900]
          Length = 149

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 34/145 (23%), Positives = 63/145 (43%), Gaps = 10/145 (6%)

Query: 13  YSTIAVANFFIDKGV--KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
              + VAN+ +      + S  I  LK+Q+ +Y      +    K +  E  +AW  GPV
Sbjct: 3   IKALDVANYILWLENRFEGSEGITPLKLQKLVYYCQGFHLAMFDKELFPESIEAWLHGPV 62

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
              VYH FK   +  +    D +  I     ++   E+++ +   Y   S  +L+ +  E
Sbjct: 63  VPSVYHHFKAAGNDIVTPPKDFNIEI----LSEAQRELLDEVIESYGQFSAWRLRNMTHE 118

Query: 131 ENKTWRRLYDPNDPNTNRTITVEEI 155
           E   W+  Y   +P  N  I+++++
Sbjct: 119 E-APWKNAY---EPGCNNEISIKDM 139


>gi|282900240|ref|ZP_06308193.1| Putative prophage protein (Ps3) [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194882|gb|EFA69826.1| Putative prophage protein (Ps3) [Cylindrospermopsis raciborskii
           CS-505]
          Length = 152

 Score =  166 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 60/146 (41%), Gaps = 11/146 (7%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   VA +FI    +    I +LK+Q+ +Y      +     ++ +EE +AW  GPV   
Sbjct: 3   TCFDVARYFIHLANETGSYISNLKLQKLVYYAQAWHLALYDTALFEEEFEAWVHGPVIPV 62

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y ++K F   PI+  ++           + I   ++ +   Y      +L+ +  +E  
Sbjct: 63  LYQQYKGFGWRPIQQEVEEP------NLPENIRSFLDEVVEVYFQCDAYELERMTHQE-T 115

Query: 134 TW----RRLYDPNDPNTNRTITVEEI 155
            W     R   P D   N  IT E I
Sbjct: 116 PWIESRARGSLPMDAPCNEIITKESI 141


>gi|294502072|ref|YP_003566137.1| phage-associated protein [Salinibacter ruber M8]
 gi|294342056|emb|CBH22721.1| phage-associated protein [Salinibacter ruber M8]
          Length = 170

 Score =  165 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 43/150 (28%), Positives = 75/150 (50%), Gaps = 8/150 (5%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSI--PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAW 65
            ++PPY  +AVANFFID  V+     P+  LK+Q+ +Y+ H   +    + ++ E  +AW
Sbjct: 1   MSSPPYPAVAVANFFIDTAVEDPDVGPVTQLKLQKLVYIAHGWHLAIYDEHLIKEPVEAW 60

Query: 66  KQGPVFVGVYHRFKYFDSHPIEVIMDL-SFRIFPKIA-----NQEIGEIMESIWNKYQSH 119
           + GPV   +Y R   + S PI   +D  S R  P++      ++     + S+W  Y+ +
Sbjct: 61  EFGPVVRDLYSRAGDYGSDPISDRLDGTSSRSAPELLEIPSSDERTRNFLRSVWQTYREY 120

Query: 120 STEQLQEIVQEENKTWRRLYDPNDPNTNRT 149
           S  +L  I  +E+  W   ++      N+T
Sbjct: 121 SAVELTSITHKEDTPWYDTWERRGGKENKT 150


>gi|330970699|gb|EGH70765.1| phage-associated protein [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 165

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 64/148 (43%), Gaps = 4/148 (2%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +S  ++AN+F++        I  +K+Q+ +Y  H        + +++E  +AW+ GPV  
Sbjct: 2   FSAKSIANYFLELAAASGQSISPMKLQKLVYYAHGWYSGYTDRPLINEPVEAWQYGPVIP 61

Query: 73  GVYHRFKYFDSHPIEVI----MDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
            +YH FK F S  I+        L  R     ++  +   +++++N Y  +S  +L E+ 
Sbjct: 62  SLYHEFKRFGSGDIQCKAFDYDALGVREAATPSDPNVRTFLQNVFNSYGKYSGIRLSEMT 121

Query: 129 QEENKTWRRLYDPNDPNTNRTITVEEIT 156
                 W   +          I   EI+
Sbjct: 122 HASGTPWDTTWSKCKGMRGVDIPFAEIS 149


>gi|330874252|gb|EGH08401.1| phage-associated protein [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 196

 Score =  163 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 64/148 (43%), Gaps = 4/148 (2%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +S  ++AN+F++        I  +K+Q+ +Y  H        + +++E  +AW+ GPV  
Sbjct: 33  FSAKSIANYFLELAAASGQSISPMKLQKLVYYAHGWYSGYTDRPLINEPVEAWQYGPVIP 92

Query: 73  GVYHRFKYFDSHPIEVI----MDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
            +YH FK F S  I+        L  R     ++  +   +++++N Y  +S  +L E+ 
Sbjct: 93  SLYHEFKRFGSGDIQCKAFDYDALGVREAATPSDPNVRTFLQNVFNSYGKYSGIRLSEMT 152

Query: 129 QEENKTWRRLYDPNDPNTNRTITVEEIT 156
                 W   +          I   EI+
Sbjct: 153 HASGTPWDTTWSKCKGMRGVDIPFAEIS 180


>gi|170782774|ref|YP_001711108.1| putative prophage protein [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169157344|emb|CAQ02531.1| putative prophage protein [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 161

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 13  YSTIAVANFFIDKGVKYSI-PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           Y    +A +F+          + +LK+Q+ +Y      + +    +  +E QAW  GPV 
Sbjct: 13  YDASTIARWFLAWADSEEEGALSNLKLQKLLYYAQGHHLARFGAPLFADEIQAWTHGPVV 72

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             VY ++K   S+ I    D  F       + E  +++ S+W  + S S  +L+E+   E
Sbjct: 73  PVVYRQYKDHGSNAIPFTEDFDFFQ----VDTETTDLLASVWETFGSKSAWKLREMTHSE 128

Query: 132 NKTWRRLY 139
              W   Y
Sbjct: 129 -APWTSSY 135


>gi|281357129|ref|ZP_06243618.1| phage-associated protein [Victivallis vadensis ATCC BAA-548]
 gi|281316160|gb|EFB00185.1| phage-associated protein [Victivallis vadensis ATCC BAA-548]
          Length = 157

 Score =  162 bits (411), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 30/150 (20%), Positives = 64/150 (42%), Gaps = 9/150 (6%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
             +     + +A++ I+K +     I +LK+Q+ +Y      ++     + DE+ QAW  
Sbjct: 1   MDSRKILPLTIASYLIEKSITSGDCITNLKLQKLVYYAQAWFIVLFGIKLFDEDIQAWVH 60

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           GPV   +Y  +K +   P+                 ++ + ++ I   +  +S  QL+ +
Sbjct: 61  GPVVRSIYDCYKQYGYKPLPCPR------VKSDLPGDVQKHLDEILKIFGGYSGFQLELM 114

Query: 128 VQEENKTWRRLYD--PNDPNTNRTITVEEI 155
             +E   W+      P D   +R I+ E++
Sbjct: 115 THQE-APWKNARKGLPPDMACDRVISPEDM 143


>gi|146302603|ref|YP_001197194.1| phage-associated protein [Flavobacterium johnsoniae UW101]
 gi|146157021|gb|ABQ07875.1| Uncharacterized phage-associated protein [Flavobacterium johnsoniae
           UW101]
          Length = 149

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 40/146 (27%), Positives = 70/146 (47%), Gaps = 8/146 (5%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           Y+   +A +FI+   +    +D +K+ +  Y++H   +    K + D E QAWK G V  
Sbjct: 2   YNCFDIAKYFIELAEEEGQGLDPMKLLKLTYISHGWHLGITGKPLFDNEVQAWKYGSVIP 61

Query: 73  GVYHRFKYFDSHPI-EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
            +Y+  + F   P+   ++++S +   K   QE  E ++ IWN Y+  S  QL  +  EE
Sbjct: 62  DLYYEIRMFGKDPVDPFLINISAKTPLK---QEDKEFLKKIWNNYKGLSGLQLSALTHEE 118

Query: 132 NKTWRRLYDPNDPNTNRTITVEEITK 157
              W + +D     T+  I   +I K
Sbjct: 119 GSPWSQTWD----GTHNVIIGNDIIK 140


>gi|315288228|gb|EFU47627.1| conserved hypothetical protein [Escherichia coli MS 110-3]
          Length = 149

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 67/143 (46%), Gaps = 8/143 (5%)

Query: 14  STIAVANFFIDKGVKY-SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +   VA++F+    +     I +LKIQ+  Y      ++   K + +E+ +AW  GPV  
Sbjct: 5   TCFDVADYFLAHCDEESGDIISNLKIQKLTYYAQGFSLVLLGKPLFNEKIEAWMHGPVVP 64

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +Y +++   +  +    +   + F     ++  E+++ ++  Y   S  +L+ +  EE 
Sbjct: 65  ELYRKYRDCGNGALPAPENFDAKKFS----EDEIELLDEVYKVYGQFSAWKLRNMTHEE- 119

Query: 133 KTWRRLYDPNDPNTNRTITVEEI 155
           + W+  Y   +   ++ IT++ +
Sbjct: 120 QPWKDAY--IEGAVSQEITLDSM 140


>gi|237704836|ref|ZP_04535317.1| phage-associated protein [Escherichia sp. 3_2_53FAA]
 gi|226901202|gb|EEH87461.1| phage-associated protein [Escherichia sp. 3_2_53FAA]
 gi|332344139|gb|AEE57473.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 147

 Score =  162 bits (410), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 67/143 (46%), Gaps = 8/143 (5%)

Query: 14  STIAVANFFIDKGVKY-SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +   VA++F+    +     I +LKIQ+  Y      ++   K + +E+ +AW  GPV  
Sbjct: 3   TCFDVADYFLAHCDEESGDIISNLKIQKLTYYAQGFSLVLLGKPLFNEKIEAWMHGPVVP 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +Y +++   +  +    +   + F     ++  E+++ ++  Y   S  +L+ +  EE 
Sbjct: 63  ELYRKYRDCGNGALPAPENFDAKKFS----EDEIELLDEVYKVYGQFSAWKLRNMTHEE- 117

Query: 133 KTWRRLYDPNDPNTNRTITVEEI 155
           + W+  Y   +   ++ IT++ +
Sbjct: 118 QPWKDAY--IEGAVSQEITLDSM 138


>gi|167465465|ref|ZP_02330554.1| putative prophage protein (ps3) [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 154

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 34/150 (22%), Positives = 63/150 (42%), Gaps = 5/150 (3%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   VA +FI         + HLK+Q+  Y      +    +SM D+E +AW  GPV   
Sbjct: 3   TIYEVAKYFIKYANSRRELLCHLKLQKLCYYAQAWYLAFFGESMFDDEFEAWVHGPVNYK 62

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y  +K F   PI+   +        I +     +++ +W +Y     + L+ +   E+ 
Sbjct: 63  LYLDYKKFGWSPIKENTEGFQE--DSIFDDNQLHVLDQVWERYGRLDVKVLEALTHGED- 119

Query: 134 TWRRLY--DPNDPNTNRTITVEEITKMADG 161
            W++      NDP +   I  +++     G
Sbjct: 120 PWKKARMLLENDPYSPAIIVKDDMMSFYRG 149


>gi|85715204|ref|ZP_01046188.1| Uncharacterized phage-associated protein [Nitrobacter sp. Nb-311A]
 gi|85698119|gb|EAQ35992.1| Uncharacterized phage-associated protein [Nitrobacter sp. Nb-311A]
          Length = 171

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 62/144 (43%), Gaps = 10/144 (6%)

Query: 15  TIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
              +A +FI++   +    + HLK+Q+ IY +    +    K +  E+ +AW  GPV   
Sbjct: 22  PTDIAKWFINRADREAGDDMTHLKLQKLIYFSQAWHLANFNKPLFQEDIEAWAHGPVVPS 81

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           V+H++K +    I  I D          +  +   ++ I+ +Y   S + L+ +   E+ 
Sbjct: 82  VWHQYKEYRWGSIPPITDDFD------VDANVAGYLDKIYARYGELSGKALERLTH-EHA 134

Query: 134 TWRRLY--DPNDPNTNRTITVEEI 155
            WR      P +     TI+   +
Sbjct: 135 PWRETRGDLPPEAKCTDTISKNLM 158


>gi|254424290|ref|ZP_05038008.1| hypothetical protein S7335_4449 [Synechococcus sp. PCC 7335]
 gi|196191779|gb|EDX86743.1| hypothetical protein S7335_4449 [Synechococcus sp. PCC 7335]
          Length = 148

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 64/146 (43%), Gaps = 10/146 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S   +A++FI    +    I +LK+Q+ +Y      +      +  E+ QAW  GPV   
Sbjct: 2   SCFDIADYFIWLANETGSFISNLKLQKLVYYAQAWHIALYDDPLFAEDFQAWVHGPVIPS 61

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y ++K F   PI    D           +++ + ++ +  +Y +    +L+++   E  
Sbjct: 62  LYQKYKTFGWQPILEDADP-------KLPEDVFQFLDEVAEEYFACDAYELEQMTHAE-A 113

Query: 134 TWR--RLYDPNDPNTNRTITVEEITK 157
            W   R   P+D ++N  I  E + +
Sbjct: 114 PWDWARGDLPSDASSNEVIKKEWMKE 139


>gi|229070620|ref|ZP_04203858.1| Prophage ps3 protein 01 [Bacillus cereus F65185]
 gi|228712525|gb|EEL64462.1| Prophage ps3 protein 01 [Bacillus cereus F65185]
          Length = 352

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 39/155 (25%), Positives = 67/155 (43%), Gaps = 11/155 (7%)

Query: 14  STIAVANFFIDKG------VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
           S  +V  FFI KG       +  + +  LK+Q+ +Y             + ++  QAW+ 
Sbjct: 189 SIESVEKFFIIKGQEFNEKDEDDLRVSPLKLQKLMYFAQGWSHAFTGHDLFEDNFQAWQH 248

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           GPV   +YHR+K + S  I+   D +  I       +   I+  IW+KY     + L+++
Sbjct: 249 GPVIPDLYHRYKSYGSKRIDK--DFNVSIHDLGLTSDQLSILHWIWDKYSKFEAKFLEDL 306

Query: 128 VQEENKTWRRLYD--PNDPNTNRTITVEEITKMAD 160
              E   WR+      +D + +  I  E+I    D
Sbjct: 307 THMEY-PWRKTRADLTDDASCDWVIEKEDIHHFFD 340


>gi|119511541|ref|ZP_01630649.1| Putative prophage protein (ps3) [Nodularia spumigena CCY9414]
 gi|119463776|gb|EAW44705.1| Putative prophage protein (ps3) [Nodularia spumigena CCY9414]
          Length = 149

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 33/147 (22%), Positives = 66/147 (44%), Gaps = 8/147 (5%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +S   VAN+FI    +    I +LK+Q+ +Y      +   +  +  E+ QAW  GPV  
Sbjct: 5   FSCFNVANYFIWLANETGSFISNLKLQKLVYYAQAWHLALYETPLFPEDFQAWIHGPVIP 64

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +Y ++K F   PI    +            E+ E ++ +  +Y +    +L+++  +E 
Sbjct: 65  VLYQKYKPFGWQPILQDANPELE-----LPDEVREFLDELAEEYFACDAYELEQMTHDE- 118

Query: 133 KTWR--RLYDPNDPNTNRTITVEEITK 157
           + W+  R    +D  +N  I  + + +
Sbjct: 119 EPWKWARGNLASDAPSNEIIKKDWMKE 145


>gi|90022360|ref|YP_528187.1| phage-associated protein-like protein [Saccharophagus degradans
           2-40]
 gi|89951960|gb|ABD81975.1| Uncharacterized phage-associated protein-like protein
           [Saccharophagus degradans 2-40]
          Length = 159

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 32/137 (23%), Positives = 64/137 (46%), Gaps = 3/137 (2%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
             +S I VA  F+ K       +  +++Q+ +Y+ H   +      ++ ++  AWK GPV
Sbjct: 2   SSHSAIDVAYKFLQKAASEGGSLTPMQLQKLVYIAHGCSLGWCDAPLIKDDVYAWKFGPV 61

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKI--ANQEIGEIMESIWNKYQSHSTEQLQEIV 128
              +YH FK F +  ++V  D       +    +    EI++++WN Y+ +S  QL ++ 
Sbjct: 62  IEDLYHCFKRFRADEVQVT-DKQIEAMVEAAGFSDAEDEIIDAVWNNYKHYSGPQLSDLT 120

Query: 129 QEENKTWRRLYDPNDPN 145
            +    W + +   D +
Sbjct: 121 HQPGTPWYQTWRHGDSS 137


>gi|197294690|ref|YP_001799231.1| phage-associated protein [Candidatus Phytoplasma australiense]
 gi|171854017|emb|CAM11984.1| Uncharacterized phage-associated protein [Candidatus Phytoplasma
           australiense]
          Length = 156

 Score =  156 bits (395), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 40/152 (26%), Positives = 66/152 (43%), Gaps = 4/152 (2%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
            + N   +   VAN+ I +       I ++KI + +Y      + Q  K++  E+ +AW 
Sbjct: 1   MKNNNQINVFDVANYLISQTDTNKYKISNMKINKLLYYIQGHYIAQTGKTLFPEKIEAWL 60

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIMESIWNKYQSHSTEQLQ 125
            GPV + +Y  F  F  +PI    D   +   K     E  +I++ + NKY   S  +L 
Sbjct: 61  FGPVILNIYSEFFNFVDNPIP--NDYVCKGASKNELTTEAKKIIDKVINKYSPFSARELS 118

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTITVEEITK 157
               EE   W+  Y+P     N  IT + + K
Sbjct: 119 VKTHEE-LPWKEAYNPRKKWQNNIITHQLLEK 149


>gi|67459185|ref|YP_246809.1| phage-associated protein [Rickettsia felis URRWXCal2]
 gi|67004718|gb|AAY61644.1| Uncharacterized phage-associated protein [Rickettsia felis
           URRWXCal2]
          Length = 213

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 51/219 (23%), Positives = 91/219 (41%), Gaps = 21/219 (9%)

Query: 8   QTNPPYSTIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
           Q     S   VAN+F+     +    I  LK+Q+ +Y      +    K + +EE +AW+
Sbjct: 5   QKEQALSCFDVANYFLVLVDREAGDIISQLKLQKLVYFAQGVHLALFNKPLFEEEIEAWQ 64

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQE 126
            GPV   +   F       I    ++ F I+     ++   +M  I++ Y  HS   L+ 
Sbjct: 65  HGPVAPKLRIPFSSLKDGSIAASGEMDFDIY----TEQQKNLMYKIFSLYGEHSARYLRN 120

Query: 127 IVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFA 186
           +  +    WR   + +D     TIT E+I +          N+V  IK  +   ++ +  
Sbjct: 121 LTHKH-SIWREAIESSD----NTITKEKIQEFFKA------NIVNDIKDYILLITEDDIQ 169

Query: 187 TLES---QLVKGFKSMPP--QLTKEFQEAQVQIKKDSAI 220
            +E+   Q    + S  P   +T E  EA+ ++K+   I
Sbjct: 170 QMENAEDQWWMNYDSGVPAEDVTNEILEAKKELKEGKGI 208


>gi|315497342|ref|YP_004086146.1| phage-associated protein-like protein [Asticcacaulis excentricus CB
           48]
 gi|315415354|gb|ADU11995.1| uncharacterized phage-associated protein-like protein
           [Asticcacaulis excentricus CB 48]
          Length = 159

 Score =  155 bits (392), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 34/147 (23%), Positives = 65/147 (44%), Gaps = 8/147 (5%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
           P +S  A+AN F+        P+D +K+Q+ +Y+ H   +   ++ ++ +  +AW  GPV
Sbjct: 2   PGHSATAIANEFVRL---NGGPLDQMKLQKLVYMAHGWNLALNQEPLVKDRIEAWDGGPV 58

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFR--IFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           F  ++   K+F       ++D   R  I           +++ +W KY+ ++   L E+ 
Sbjct: 59  FRAIWDHIKFFGISGSGFLVDPFARNPITTNALTPNERAVIDHVWKKYKPYTGHMLSEMT 118

Query: 129 QEENKTWRRLYDPNDPNTNRTITVEEI 155
            +    W   Y       N  I+ E I
Sbjct: 119 HQRGTPWYNSYL---SGRNTAISDEAI 142


>gi|288573122|ref|ZP_06391479.1| phage-associated protein [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288568863|gb|EFC90420.1| phage-associated protein [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 149

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 57/131 (43%), Gaps = 6/131 (4%)

Query: 14  STIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           S   VA++ + K        I HLK+Q+ +Y      V+   + +  E  +AW  GPV  
Sbjct: 3   SVFDVASYILSKADLDEGDGITHLKLQKLVYYAQGFSVVLLGRPLFPETIEAWTHGPVVP 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +Y+++++F  + I      +    P     E   +++ +++ Y  +S  +L+ +   E 
Sbjct: 63  ELYNKYRHFGPNVISKAQGGT----PDNLTTEEKTLIDDVFSVYGEYSASKLRNLTHNE- 117

Query: 133 KTWRRLYDPND 143
             W    +  D
Sbjct: 118 TPWMEAENKED 128


>gi|160915529|ref|ZP_02077740.1| hypothetical protein EUBDOL_01537 [Eubacterium dolichum DSM 3991]
 gi|158432649|gb|EDP10938.1| hypothetical protein EUBDOL_01537 [Eubacterium dolichum DSM 3991]
          Length = 182

 Score =  154 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 35/156 (22%), Positives = 71/156 (45%), Gaps = 7/156 (4%)

Query: 15  TIAVANFFIDKGVK-YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
            +  ANFFID         I +L++ + +Y      + ++   + D+E +AWK GPV   
Sbjct: 4   AVDYANFFIDLANSSDDDYISNLRLNKLLYFAQGYSLYKRGMPLFDDEIEAWKYGPVVPS 63

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY  FK      I+           +  + +  EI+ ++  ++  +S+ +L +I   +  
Sbjct: 64  VYRTFKVCGRGNIDETY---GDYNVENFSSDELEILLNVAEEFGKYSSPKLVDITHAQGS 120

Query: 134 TWRRLYDPNDPNTNRTITVEEITK-MADGSNISPEN 168
            W+++++ +  +T   I+ + I     D   +SP N
Sbjct: 121 PWQQVFNVDAKHT--IISKKSIADYFRDKMKLSPFN 154


>gi|91228525|ref|ZP_01262446.1| Uncharacterized phage-associated protein [Vibrio alginolyticus
           12G01]
 gi|91187901|gb|EAS74212.1| Uncharacterized phage-associated protein [Vibrio alginolyticus
           12G01]
          Length = 155

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 31/134 (23%), Positives = 61/134 (45%), Gaps = 7/134 (5%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
            +    YS + VA   +    +      +L++Q+  Y+ H   +   ++ ++ ++  AWK
Sbjct: 1   MKAYHTYSAVDVAWSLLKHAKEQGKCFSNLQLQKLTYVCHGLSLAHFQRPLVVDDVFAWK 60

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQE 126
            GPV   VY RFK + S  I    D++        +QE   I++ + +K    +  QL +
Sbjct: 61  FGPVVPSVYFRFKSYGSSVITEQCDVA-------LDQESESIVKDVVSKLGHLTGPQLVD 113

Query: 127 IVQEENKTWRRLYD 140
           +   E   W +++D
Sbjct: 114 LTHREGSPWHQVWD 127


>gi|121608301|ref|YP_996108.1| hypothetical protein Veis_1323 [Verminephrobacter eiseniae EF01-2]
 gi|121552941|gb|ABM57090.1| conserved hypothetical protein [Verminephrobacter eiseniae EF01-2]
          Length = 161

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 67/138 (48%), Gaps = 10/138 (7%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
             +P YS  A+AN F+ K  + +IP +  +K+Q+ +Y T    +  +   +LD+    WK
Sbjct: 1   MAHPEYSAFAIANAFVQKAGQGAIPNLTPMKLQKLLYFTQAWHLKVRGFPLLDDHFARWK 60

Query: 67  QGPVFVGVYHRFKYFDSHPIEVI--------MDLSFRI-FPKIANQEIGEIMESIWNKYQ 117
            GPV   VYH F+ +   PI            D + +I    +A+++   ++++I ++Y 
Sbjct: 61  HGPVIPAVYHEFRAYGHRPITRKATTLAMSDDDYAVKIPMVPLADRDTWGLIDAIIDRYG 120

Query: 118 SHSTEQLQEIVQEENKTW 135
           +   ++L  +   E   W
Sbjct: 121 AVDAQELSRMTHLEGSAW 138


>gi|260914611|ref|ZP_05921078.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260631302|gb|EEX49486.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 148

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 55/127 (43%), Gaps = 3/127 (2%)

Query: 13  YSTIAVANFFIDKGVKYSI-PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           YS + VAN FI +    ++  +  +K+Q+ ++      + +    + D+    W+ GPV 
Sbjct: 3   YSAMQVANSFIQRAKDGAVTDLTPMKLQKLMFFAQSWSLKETGYPLFDDFFSRWQYGPVI 62

Query: 72  VGVYHRFKYFDSHPIEV--IMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
             +YH FK F   PI    I      +     + +  E+++ I  +Y  +S  QL  +  
Sbjct: 63  PSIYHEFKSFRDQPITSYGIDVFGNTVMVSEDDPQSWELIDDIIKEYGEYSASQLSWMTH 122

Query: 130 EENKTWR 136
           +    W 
Sbjct: 123 QPKTAWS 129


>gi|322513457|ref|ZP_08066569.1| hypothetical protein HMPREF0027_0321 [Actinobacillus ureae ATCC
           25976]
 gi|322120748|gb|EFX92629.1| hypothetical protein HMPREF0027_0321 [Actinobacillus ureae ATCC
           25976]
          Length = 148

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 53/129 (41%), Gaps = 4/129 (3%)

Query: 13  YSTIAVANFFIDKGVKYSIPI---DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
           YS + +AN FI K  +    +     +K+Q+ ++      + + +  ++D+    W  GP
Sbjct: 3   YSAMQIANAFIRKAQETPNELPNLTPMKLQKLMFFAQSWYIKKLRARLIDDNFMRWPYGP 62

Query: 70  VFVGVYHRFKYFDSHPIEVI-MDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           V   +Y+ FK      IEV   ++    F           ++ I + Y       L ++ 
Sbjct: 63  VIPSIYYEFKDNGGGNIEVPSKNIFGTPFDSQLEARDEYFLDEIIHVYGGFDGWTLSDMT 122

Query: 129 QEENKTWRR 137
            +E   WR+
Sbjct: 123 HQEGTAWRK 131


>gi|296501671|ref|YP_003663371.1| prophage protein 01 [Bacillus thuringiensis BMB171]
 gi|296322723|gb|ADH05651.1| Prophage ps3 protein 01 [Bacillus thuringiensis BMB171]
          Length = 349

 Score =  152 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 37/149 (24%), Positives = 63/149 (42%), Gaps = 10/149 (6%)

Query: 14  STIAVANFFIDKGVKYSI-----PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQG 68
           S   V  FFI KG +         +  LK+Q+ +Y            ++  ++ QAW  G
Sbjct: 187 SIEDVEMFFIIKGQELDDEDDDLRVSPLKLQKLMYYAQGWTFAYTGLNLYKDDFQAWVHG 246

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV   +Y ++K + S  I+   +   +I       E  +I+  +WN+Y     + L+++ 
Sbjct: 247 PVIPDLYAKYKEYGSRRIDE--NFGMKIESLKLTFEQLQILHWVWNQYSKFEAKFLEDLT 304

Query: 129 QEENKTWRRLY--DPNDPNTNRTITVEEI 155
             E   WR      PN+   N  I  E+I
Sbjct: 305 HME-SPWRNTRGDLPNNQGCNWIIRKEDI 332


>gi|153869326|ref|ZP_01998966.1| phage-associated protein [Beggiatoa sp. PS]
 gi|152074156|gb|EDN71042.1| phage-associated protein [Beggiatoa sp. PS]
          Length = 159

 Score =  152 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 64/150 (42%), Gaps = 7/150 (4%)

Query: 11  PPYSTIAVANFFID-KGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
             Y    +A++F+     +    I HLK+Q+ +Y      +    K + DE+ +AW  GP
Sbjct: 2   NTYQVNQIADWFLAAIDREAGDTISHLKLQKLMYYAQAWSLALNHKCLFDEDFEAWTHGP 61

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   ++ RFK FD + I      +         +E  E++  I N Y   S + L+E+  
Sbjct: 62  VLPTLWQRFKEFDWNSIP---PEAIISNTDGLTEEDEELLSDILNSYGDLSAKHLEELTH 118

Query: 130 EENKTWR--RLYDPNDPNTNRTITVEEITK 157
            E   WR  R   P +  +   I  E + +
Sbjct: 119 SE-TPWRSARGNLPIEARSIHIINKERMQE 147


>gi|146298679|ref|YP_001193270.1| phage-associated protein [Flavobacterium johnsoniae UW101]
 gi|146153097|gb|ABQ03951.1| Uncharacterized phage-associated protein [Flavobacterium johnsoniae
           UW101]
          Length = 209

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 33/143 (23%), Positives = 64/143 (44%), Gaps = 4/143 (2%)

Query: 5   TFTQTNP-PYSTIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEP 62
              + N   Y+ + +AN  I     +    I +LK+Q+ +Y      +    K + D+  
Sbjct: 51  NLQKNNSMAYNVVDIANKIIANINTEAGDLISNLKLQKLLYYMQGYYIAIFNKKLFDDVI 110

Query: 63  QAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTE 122
           +AW+ GPV   +Y  FK F S  I +  ++   I  ++   E   +   ++ +Y  +S  
Sbjct: 111 EAWQYGPVVPTMYMHFKEFGSSAITISDEIKENII-RLNTDEEENLFNDVFEQYNQYSAI 169

Query: 123 QLQEIVQEENKTWRRLYDPNDPN 145
            L  +  +E K WR++++ N   
Sbjct: 170 ALMNMTHDE-KPWRQIFNANPKG 191


>gi|238764937|ref|ZP_04625876.1| hypothetical protein ykris0001_360 [Yersinia kristensenii ATCC
           33638]
 gi|238696878|gb|EEP89656.1| hypothetical protein ykris0001_360 [Yersinia kristensenii ATCC
           33638]
          Length = 156

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 33/137 (24%), Positives = 63/137 (45%), Gaps = 11/137 (8%)

Query: 13  YSTIAVANFFIDKGVKYSI-PIDHLKIQQFIYLTHCDVVLQKK-KSMLDEEPQAWKQGPV 70
           YS +AVAN FI+K +K  +  +  +K+Q+ ++ T    +  +    + D+    WK GPV
Sbjct: 3   YSAVAVANAFIEKALKGELKELTPMKLQKLLFYTQSWHLKLRGGTPLFDDLFARWKFGPV 62

Query: 71  FVGVYHRFKYFDSHPIEVIMDL-------SFRIFPKIA--NQEIGEIMESIWNKYQSHST 121
              +Y   K + ++ I+  +           RI P I   ++E  ++++ I   Y  +S 
Sbjct: 63  IPTLYRLLKKYGANEIDSKISFIQESDGDFERITPSIQKDDEETRKLVDKIIEVYGEYSG 122

Query: 122 EQLQEIVQEENKTWRRL 138
            +L  +    N  W + 
Sbjct: 123 PELSSMTHAPNTAWSKG 139


>gi|170718371|ref|YP_001783596.1| hypothetical protein HSM_0245 [Haemophilus somnus 2336]
 gi|168826500|gb|ACA31871.1| conserved hypothetical protein [Haemophilus somnus 2336]
          Length = 145

 Score =  151 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 50/125 (40%), Gaps = 1/125 (0%)

Query: 13  YSTIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           YS + VAN FI K  +  +P +  +K+Q+ ++      + +    ++D+    W+ GPV 
Sbjct: 3   YSAMQVANAFIQKAQEGKVPALTPMKLQKLMFFAQSWYLKKYHVRLIDDHFVRWQYGPVI 62

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             VY+ F  F S  I       F I            ++ +   Y S    +L  +  + 
Sbjct: 63  PSVYYEFSSFGSCDINQPATNPFGIIAPNLTIADDAFIDEVIATYGSFDGWKLSVMTHQP 122

Query: 132 NKTWR 136
              W 
Sbjct: 123 KTAWS 127


>gi|157964587|ref|YP_001499411.1| Phage-associated protein [Rickettsia massiliae MTU5]
 gi|157844363|gb|ABV84864.1| Phage-associated protein [Rickettsia massiliae MTU5]
          Length = 207

 Score =  150 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 40/178 (22%), Positives = 75/178 (42%), Gaps = 16/178 (8%)

Query: 14  STIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           S   VAN+F+     +    I  LK+Q+ IY      +    K + +EE +AWK GPV  
Sbjct: 11  SCFDVANYFLVLVDREAGDSITQLKLQKLIYFAQGIHLALFDKVLFEEEIKAWKHGPVVP 70

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +   F  F  + I +  ++ F I+     ++  +++  +++ Y  HS   L+ +     
Sbjct: 71  ALRSIFGSFRDNVIPLPGEIDFAIY----TEQQKKLLHKVYSFYGEHSAAYLRNLTHRH- 125

Query: 133 KTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLES 190
             W    +  D      IT E+I +          N++  IK  +   +  + A +E+
Sbjct: 126 SIWYEAIEKAD----NIITKEKIKEFFKA------NIINDIKDYILSITKEDIAQIEN 173


>gi|307152153|ref|YP_003887537.1| putative phage-associated protein [Cyanothece sp. PCC 7822]
 gi|306982381|gb|ADN14262.1| putative phage-associated protein [Cyanothece sp. PCC 7822]
          Length = 155

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 58/144 (40%), Gaps = 9/144 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S   +A FFI    +    + +LK+Q+ +Y      +      + +E+ +AW  GPV   
Sbjct: 3   SCYKIAQFFIRYAHEAGSLLTNLKLQKLVYYAQAWHLAIHGSPLFEEDFEAWVHGPVIPE 62

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y ++K +  +PI   +D            E       + + Y S+   +L+ +   E  
Sbjct: 63  LYQKYKQYKWNPISEDVDKPVLSEELEEFLEE------VIDVYFSYDAYELERMTHCE-A 115

Query: 134 TWRRLYD--PNDPNTNRTITVEEI 155
            W       P D  +N  IT E +
Sbjct: 116 PWIEARGAIPIDEPSNAIITKESM 139


>gi|149908524|ref|ZP_01897186.1| possible prophage ps3 protein01-like protein [Moritella sp. PE36]
 gi|149808358|gb|EDM68295.1| possible prophage ps3 protein01-like protein [Moritella sp. PE36]
          Length = 145

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 62/148 (41%), Gaps = 10/148 (6%)

Query: 14  STIAVANFFIDKGVKYSIPI-DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +   VA F I    +    I  +LK+Q+  Y      +    K + D+E QAW  GPV  
Sbjct: 3   NVTDVAEFIIGLANRDDDDIITNLKLQKITYYAQGFYLALFDKPLFDDEIQAWAHGPVIP 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +YH++K    + I   +  +     K   ++  E +  +++ +   S  +L+ +  EE 
Sbjct: 63  DLYHKYKINGKNHI---VSDAMFDAEKCLAEQEREHLNDVYDIFGQFSAWKLRNMTHEE- 118

Query: 133 KTWRRLYDPNDPNTNRTITVEEITKMAD 160
             W      ++  +   IT  E+ +  D
Sbjct: 119 APW-----IDNEKSANIITKTELKRYFD 141


>gi|229588705|ref|YP_002870824.1| hypothetical protein PFLU1166 [Pseudomonas fluorescens SBW25]
 gi|229360571|emb|CAY47428.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 164

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 65/133 (48%), Gaps = 10/133 (7%)

Query: 13  YSTIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           YS +AVAN FI++  +  +  +  +K+Q+ ++ T    + +++  ++D+    W+ GPV 
Sbjct: 5   YSALAVANAFIERAKEGKLSGLTPMKLQKLLFYTQSWHLRERELPLMDDHFARWQYGPVI 64

Query: 72  VGVYHRFKYFDSHPIEVIM-------DLSFRIFPKIANQEI--GEIMESIWNKYQSHSTE 122
             +YH  K + S P+  ++       +    + P+I   +     +++ I NKY   S  
Sbjct: 65  PSLYHELKSYGSRPVTSLLSNLKPDVEDIVFVTPRIPESDTYAQRLIDRIINKYGKWSGT 124

Query: 123 QLQEIVQEENKTW 135
           QL  +  EE   W
Sbjct: 125 QLSNLSHEEGTAW 137


>gi|312897856|ref|ZP_07757271.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
 gi|310621055|gb|EFQ04600.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
          Length = 217

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/172 (22%), Positives = 79/172 (45%), Gaps = 10/172 (5%)

Query: 15  TIAVANFFIDKGVK--YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
            I VA FFI+          + +L++ + +Y    + + +    +  ++ +AWK GPV  
Sbjct: 39  AIDVARFFINIVNSLPTDDLMTNLRVNKLLYFAQGECLKKLGHPLFTDDIEAWKYGPVVP 98

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            VY ++K  + +PI+  +  S   F     +E  E++  + + Y   S+  L ++  ++ 
Sbjct: 99  SVYEQYKSLEKNPIQESIPYSKGAFS----EEERELLFDVASYYGQISSSALVKMSHQKG 154

Query: 133 KTWRRLYDPNDPNTNRTITVEEITKMADGSNISP--ENVVEQIKKPVRFDSD 182
             W+++YDPN  +    I ++ I       N  P    V+ +I+   R D +
Sbjct: 155 SPWQQVYDPNRKHV--KIDIDSIYSYFSQQNPIPTFSEVINKIETVGRRDDE 204


>gi|291458021|ref|ZP_06597411.1| putative prophage protein [Oribacterium sp. oral taxon 078 str.
           F0262]
 gi|291419353|gb|EFE93072.1| putative prophage protein [Oribacterium sp. oral taxon 078 str.
           F0262]
          Length = 156

 Score =  149 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/147 (26%), Positives = 65/147 (44%), Gaps = 15/147 (10%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
            YS   +AN+F+ KG      + H K+Q+  Y         K   + D + QAW  GPV 
Sbjct: 11  KYSVFDIANWFLSKG-----EMTHKKLQKLCYYAQAWCYALKGYRLEDTDYQAWIHGPVS 65

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             ++ RFK F   PI++   +  RI     + E   ++  +W+ Y  ++   L+ +   E
Sbjct: 66  PALWERFKSFAYDPIKIKGTVRLRI-----DPEDEALLNDVWDTYGENTGNALETLTHRE 120

Query: 132 NKTW---RRLYDPNDPNTNRTITVEEI 155
              W   RR Y+P D      I+ + +
Sbjct: 121 -LPWIEARRGYEP-DERCTVVISPDTM 145


>gi|322433755|ref|YP_004215967.1| phage-associated protein-like protein [Acidobacterium sp. MP5ACTX9]
 gi|321161482|gb|ADW67187.1| phage-associated protein-like protein [Acidobacterium sp. MP5ACTX9]
          Length = 161

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 68/154 (44%), Gaps = 12/154 (7%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           P+   AVAN  +D+     + +  + IQ+ +Y  H   +      ++ +  +AW+ GPV 
Sbjct: 2   PFPATAVANELLDRASAEGLSLTQINIQKLVYFAHGWNLGWSANPLILDPIEAWQYGPVV 61

Query: 72  VGVYHRFKYFDSHPI-----EVIMDLSFRI---FPKIANQEIGEIMESIWNKYQSHSTEQ 123
             +Y++F+ F S PI     E  +D + +I    P + +     ++ ++WN+Y      +
Sbjct: 62  RNLYNQFRRFGSSPITGKAVEFRIDSNGKIGTTCPTLEDAYSKSVVGAVWNQYGRLQPFK 121

Query: 124 LQEIVQEENKTWRRLYDPNDPNTNRTITVEEITK 157
           L E+       W   ++         I  E+I +
Sbjct: 122 LVELTHAPGSPWEAAWNAKK----ALIENEDIRR 151


>gi|270717131|ref|ZP_06223248.1| conserved hypothetical protein [Haemophilus influenzae HK1212]
 gi|319776465|ref|YP_004138953.1| hypothetical protein-related [Haemophilus influenzae F3047]
 gi|319897242|ref|YP_004135437.1| uncharacterised protein, phage-related [Haemophilus influenzae
           F3031]
 gi|329123965|ref|ZP_08252514.1| hypothetical protein HMPREF9095_1732 [Haemophilus aegyptius ATCC
           11116]
 gi|270315532|gb|EFA27756.1| conserved hypothetical protein [Haemophilus influenzae HK1212]
 gi|317432746|emb|CBY81111.1| putative uncharacterised protein, phage-related [Haemophilus
           influenzae F3031]
 gi|317451056|emb|CBY87289.1| putative uncharacterised protein, phage-related [Haemophilus
           influenzae F3047]
 gi|327467759|gb|EGF13252.1| hypothetical protein HMPREF9095_1732 [Haemophilus aegyptius ATCC
           11116]
          Length = 146

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 2/128 (1%)

Query: 13  YSTIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           YS + VAN FI K  +  IP +  +K+Q+ ++      +   K  + ++E   W+ GPV 
Sbjct: 3   YSAMQVANAFIQKAQEGKIPNLTPMKLQKLLFFAQSWYLKNNKSRLFNDEFIRWQYGPVV 62

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFR-IFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
             VY+ F       I+     SF   F    N+E    ++ +   Y  ++  QL E+   
Sbjct: 63  QSVYYEFAKNKGTEIKHKAKNSFGTDFESRLNREDEFFLDELITAYGEYTGWQLSEMTHT 122

Query: 131 ENKTWRRL 138
           +   W + 
Sbjct: 123 QGGAWEKG 130


>gi|153869744|ref|ZP_01999277.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152073781|gb|EDN70714.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 144

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 6/124 (4%)

Query: 13  YSTIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
            +   VANFFI KG+      I +LK+Q+ +Y          ++++  E   AW  GPV 
Sbjct: 2   ITAQDVANFFIMKGIDDEESGISNLKLQKLLYYAKGFHQAIFEEALFPENLWAWTYGPVV 61

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             +Y  +K +   PI  +            ++E  E++  +W+ +   S  +L+++   E
Sbjct: 62  PEMYQAYKQYGKDPITQVE----YDPTHRFDEEQLELLNEVWSTFGQFSAWKLRDMTHNE 117

Query: 132 NKTW 135
            K W
Sbjct: 118 -KPW 120


>gi|273809596|ref|YP_003344834.1| phage-associated protein [Aggregatibacter phage S1249]
 gi|261410503|gb|ACX80334.1| phage-associated protein [Aggregatibacter phage S1249]
          Length = 146

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 52/125 (41%), Gaps = 2/125 (1%)

Query: 13  YSTIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           YS + VAN FI K  +  IP +  +K+Q+ ++      +      ++++E   W+ GPV 
Sbjct: 3   YSAMQVANAFIQKAQEGKIPALTPMKLQKLMFFAQSWYLRVHSCRLINDEFVRWQYGPVI 62

Query: 72  VGVYHRFKYFDSHPI-EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
             VY+ F       I +   D                 ++ +   Y + S  QL E+  +
Sbjct: 63  QSVYYEFARNGGGIIRQFAKDFRGEDVAYQLETTDDLFLDKVIATYGAFSGWQLSEMTHD 122

Query: 131 ENKTW 135
           ++  W
Sbjct: 123 KDGAW 127


>gi|258516059|ref|YP_003192281.1| phage-associated protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257779764|gb|ACV63658.1| Putative phage-associated protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 339

 Score =  148 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 38/150 (25%), Positives = 69/150 (46%), Gaps = 8/150 (5%)

Query: 9   TNPPYSTIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
                +T+ V+ FFI K   +    I HLK+Q+ +Y      +   +     E+ +AW  
Sbjct: 165 DKNASNTLNVSKFFITKIYPEAGEVITHLKLQKMVYYVQSWYLAFFQSPFFHEDCEAWVH 224

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           GPVF G+Y  +K F + PI  +   +  IF    N +   I+  +W  Y  +  + L+++
Sbjct: 225 GPVFPGLYDIYKDFGNKPITKLTRFNENIF----NNDQKFILNMVWQVYGKYDAKYLEKL 280

Query: 128 VQEENKTWRRLYDP--NDPNTNRTITVEEI 155
              E   W+++ +    D  ++  I  E+I
Sbjct: 281 THIEY-PWKKVRESYKKDERSSEVIVKEDI 309


>gi|38234221|ref|NP_939988.1| hypothetical protein DIP1646 [Corynebacterium diphtheriae NCTC
           13129]
 gi|38200483|emb|CAE50176.1| Conserved hypothetical protein [Corynebacterium diphtheriae]
          Length = 159

 Score =  148 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 29/135 (21%), Positives = 56/135 (41%), Gaps = 3/135 (2%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           Y    +AN  +++       I  +K+Q+ +Y    +      KS+  E  + W+ GPV  
Sbjct: 3   YVPTLIANNVLNRAFAEKYRISPMKLQKILYFAAAEYQKNTGKSLFSERFETWQYGPVLR 62

Query: 73  GVYHRFKYFDSHPIE---VIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
            VY  F+ F    I       +    +  + A+  +  +++++W+  + HS   L  I  
Sbjct: 63  SVYSEFRPFSRDFITRFAKDAENQSHMINESADPALQRVLDTVWSATKGHSAVDLSRITH 122

Query: 130 EENKTWRRLYDPNDP 144
            EN  W + +    P
Sbjct: 123 MENSAWDKSFQNEQP 137


>gi|314940587|ref|ZP_07847721.1| conserved hypothetical protein [Enterococcus faecium TX0133a04]
 gi|314942538|ref|ZP_07849376.1| conserved hypothetical protein [Enterococcus faecium TX0133C]
 gi|314953905|ref|ZP_07856764.1| conserved hypothetical protein [Enterococcus faecium TX0133A]
 gi|314992729|ref|ZP_07858139.1| conserved hypothetical protein [Enterococcus faecium TX0133B]
 gi|314996740|ref|ZP_07861760.1| conserved hypothetical protein [Enterococcus faecium TX0133a01]
 gi|313589126|gb|EFR67971.1| conserved hypothetical protein [Enterococcus faecium TX0133a01]
 gi|313592749|gb|EFR71594.1| conserved hypothetical protein [Enterococcus faecium TX0133B]
 gi|313594122|gb|EFR72967.1| conserved hypothetical protein [Enterococcus faecium TX0133A]
 gi|313598697|gb|EFR77542.1| conserved hypothetical protein [Enterococcus faecium TX0133C]
 gi|313640232|gb|EFS04813.1| conserved hypothetical protein [Enterococcus faecium TX0133a04]
          Length = 155

 Score =  148 bits (374), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 66/146 (45%), Gaps = 5/146 (3%)

Query: 13  YSTIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           +    VA +F+          I  LKIQ+ +Y      +    + ++D E +AW  GPV 
Sbjct: 2   HKPKDVAKWFVANTDVASGSQITPLKIQKLLYYAQAWYLAIYNEPLMDTEFEAWAHGPVV 61

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             VYH    F  +P+ +  +  F    +++ ++  ++++ I + Y  +  + L+++  +E
Sbjct: 62  PEVYHGLSDFKYNPVSISAEY-FSDAEEVSCEQEVDLLQQIMDIYGIYDGKYLEKLTHQE 120

Query: 132 NKTWRRLY--DPNDPNTNRTITVEEI 155
           +  W +     P +   N  I+ E +
Sbjct: 121 D-PWIQTRGDLPPEARCNEVISREVM 145


>gi|239947434|ref|ZP_04699187.1| phage-associated protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921710|gb|EER21734.1| phage-associated protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 207

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/178 (23%), Positives = 78/178 (43%), Gaps = 16/178 (8%)

Query: 14  STIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           S   VAN+F+     +    I  LK+Q+ IY      +    K++ +EE +AWK GPV  
Sbjct: 11  SCFDVANYFLVLVDREAGDSITQLKLQKLIYFAQGIHLALFDKALFEEEIKAWKHGPVVP 70

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +   F  F  + I +  ++ F I+ ++      +++  +++ Y +HS   L+ +     
Sbjct: 71  ALRSIFGNFRDNVIPLPYEIDFAIYTEL----QKKLIHKVYSFYGAHSAAYLRNLTHTH- 125

Query: 133 KTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLES 190
             W    +  D     TIT E+I +          N++  IK  +   +  + A +E+
Sbjct: 126 SIWYEAIEKAD----NTITKEKIQEFFKA------NIINNIKDYILSITKEDIAQIEN 173


>gi|186701742|ref|ZP_02553389.2| conserved hypothetical protein [Ureaplasma parvum serovar 6 str.
           ATCC 27818]
 gi|186701012|gb|EDU19294.1| conserved hypothetical protein [Ureaplasma parvum serovar 6 str.
           ATCC 27818]
          Length = 157

 Score =  147 bits (372), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 20/155 (12%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEPQ 63
              + + VAN+F+ K       +   K+Q+ +Y  +   +    +        + DE+ +
Sbjct: 2   KEITPLIVANWFLTK-----ESMTPKKVQKLVYYAYSWYLTLMNEKVDDLKNKLFDEKIK 56

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           AW  GP    +Y+ FK    + I  I D +   +    N +  +I+  +W++Y  +S  Q
Sbjct: 57  AWVHGPAIPMLYNEFKEHKYNSIPKINDFNELEY---FNLDTIDILNQVWDEYGHYSANQ 113

Query: 124 LQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
           L+ I  +E+  W   R+ + P D   N  I+ +EI
Sbjct: 114 LESITHQED-PWIKARKGFGPLDS-CNAVISDKEI 146


>gi|185178710|ref|ZP_02554581.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 5
           str. ATCC 27817]
 gi|188024436|ref|ZP_02570664.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 7
           str. ATCC 27819]
 gi|225551416|ref|ZP_03772362.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 8
           str. ATCC 27618]
 gi|184209305|gb|EDU06348.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 5
           str. ATCC 27817]
 gi|188018729|gb|EDU56769.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 7
           str. ATCC 27819]
 gi|225379231|gb|EEH01596.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 8
           str. ATCC 27618]
          Length = 157

 Score =  147 bits (372), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 73/155 (47%), Gaps = 20/155 (12%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEPQ 63
              + + VAN+F+ K       +   K+Q+ +Y  +   +    +        + DE+ +
Sbjct: 2   KEITPLIVANWFLTK-----ESMTLKKVQKLVYYAYSWYLTLMNEKVDDLKNKLFDEKIK 56

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           AW  GP    +Y+ FK +  + I  I D + + +    N +  +I+  +W++Y  +S  Q
Sbjct: 57  AWVHGPAIPMLYNEFKEYKYNSIPKINDFNEQEY---FNLDTIDILNQVWDEYGHYSANQ 113

Query: 124 LQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
           L+ I  +E+  W   R+ ++P D   N  I+ +EI
Sbjct: 114 LESITHQED-PWIKARKGFEPLDS-CNAVISDKEI 146


>gi|171920265|ref|ZP_02690891.2| conserved hypothetical protein [Ureaplasma parvum serovar 1 str.
           ATCC 27813]
 gi|171902669|gb|EDT48958.1| conserved hypothetical protein [Ureaplasma parvum serovar 1 str.
           ATCC 27813]
          Length = 157

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 73/155 (47%), Gaps = 20/155 (12%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEPQ 63
              + + VAN+F+ K       +   K+Q+ +Y  +   +    +        + DE+ +
Sbjct: 2   KEITPLIVANWFLTK-----ESMTPKKVQKLVYYAYSWYLTLMNEKVDDLKNKLFDEKIK 56

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           AW  GP    +Y+ FK +  + I  I D + + +    N +  +I+  +W++Y  +S  Q
Sbjct: 57  AWVHGPAIPMLYNEFKEYKYNSIPKINDFNEQEY---FNLDTIDILNQVWDEYGHYSANQ 113

Query: 124 LQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
           L+ I  +E+  W   R+ ++P D   N  I+ +EI
Sbjct: 114 LESITHQEDL-WIKARKGFEPLDS-CNAVISDKEI 146


>gi|153869049|ref|ZP_01998748.1| phage-associated protein [Beggiatoa sp. PS]
 gi|152074402|gb|EDN71261.1| phage-associated protein [Beggiatoa sp. PS]
          Length = 144

 Score =  147 bits (370), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 62/126 (49%), Gaps = 6/126 (4%)

Query: 14  STIAVANFFIDKGVKY-SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +   VA +F+ +  +     I +LK+Q+ +Y      +   +  +  E  +AW  GPV  
Sbjct: 3   NCYDVARYFLAQVDEDAGDLISNLKLQKLVYYAQGINLALHELPLFPETLEAWIHGPVVP 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +++ ++ ++++ I    DL F I+    N +I E+++ ++  +  +S  +L ++  EE 
Sbjct: 63  VLFYTYQRYNANAIPPPNDLDFSIY----NSQIRELLDEVYVVFGQYSAWKLYQMTHEE- 117

Query: 133 KTWRRL 138
             W+  
Sbjct: 118 PPWKNT 123


>gi|153871345|ref|ZP_02000541.1| phage-associated protein [Beggiatoa sp. PS]
 gi|152072191|gb|EDN69461.1| phage-associated protein [Beggiatoa sp. PS]
          Length = 173

 Score =  147 bits (370), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 58/135 (42%), Gaps = 10/135 (7%)

Query: 12  PYSTIAVANFFIDKGVKYS-IPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
           PYS+ AVAN FI K  +     I  +K+Q+ +Y  H   +    +  + EE QAWK GPV
Sbjct: 4   PYSSKAVANSFILKAKEKGCTDISPMKLQKLVYFAHGWFMAFTDQEFIKEEVQAWKFGPV 63

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA---------NQEIGEIMESIWNKYQSHST 121
              +Y  FK + +  IE++         K+          + +   I+  +W  Y   + 
Sbjct: 64  IPDIYFEFKEYGNSNIEILAKELRFTGSKLELITPNIDDDDDDANRIINEVWRAYGEFTP 123

Query: 122 EQLQEIVQEENKTWR 136
            QL  I   +   W 
Sbjct: 124 IQLSNITHAKGSPWE 138


>gi|47564893|ref|ZP_00235937.1| uncharacterized phage-associated protein [Bacillus cereus G9241]
 gi|47558266|gb|EAL16590.1| uncharacterized phage-associated protein [Bacillus cereus G9241]
          Length = 169

 Score =  146 bits (369), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 33/149 (22%), Positives = 65/149 (43%), Gaps = 11/149 (7%)

Query: 12  PYSTIAVANFFIDKGVKYSIP---IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQG 68
            +S   VAN+F+++    S P   + HLK+Q+  Y      V   ++ +  E  +AW  G
Sbjct: 18  EHSVSQVANYFLNRSQNDSRPSTDVTHLKLQKLAYYAQAWHVTILRRRLFAERIEAWVHG 77

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV   +Y  ++++    I         +     N+    ++ ++W  Y     ++L+++ 
Sbjct: 78  PVSPDLYSEYRHYGYQSI-----YGNIVQENQFNEPTLGVLNAVWITYGDKDAKELEKLT 132

Query: 129 QEENKTWR--RLYDPNDPNTNRTITVEEI 155
             E + W+  R   P     N  I+VE +
Sbjct: 133 HSE-EPWKLARGNMPATMYGNNEISVEGM 160


>gi|158422490|ref|YP_001523782.1| uncharacterized phage-associated protein [Azorhizobium caulinodans
           ORS 571]
 gi|158329379|dbj|BAF86864.1| uncharacterized phage-associated protein [Azorhizobium caulinodans
           ORS 571]
          Length = 213

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 65/143 (45%), Gaps = 5/143 (3%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +S++ +AN F+D   +    +  +++ + +Y+ H  ++      ++++E QAWK GPV  
Sbjct: 63  HSSLTIANRFLDLANEEGDTLTPMQLLKLVYIAHGWMLGLYGVPLINDEVQAWKYGPVIP 122

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +YH    F S P+   +       P         +++ ++  Y + +  +L  +  +  
Sbjct: 123 KLYHSISQFRSDPVRGPLRAHD---PDPLVSVENALIQQVYEIYGNMTGIELSRLTHQPG 179

Query: 133 KTWRRLYDPNDPNTNRTITVEEI 155
             W + Y   D  +N  I+ + I
Sbjct: 180 SPWAQTYQ--DGVSNIVISNDLI 200


>gi|171920661|ref|ZP_02695533.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 13
           str. ATCC 33698]
 gi|188524188|ref|ZP_02557555.2| conserved hypothetical protein [Ureaplasma urealyticum serovar 12
           str. ATCC 33696]
 gi|198273404|ref|ZP_03205940.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 4
           str. ATCC 27816]
 gi|171903394|gb|EDT49683.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 13
           str. ATCC 33698]
 gi|195660086|gb|EDX53466.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 12
           str. ATCC 33696]
 gi|198249924|gb|EDY74704.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 4
           str. ATCC 27816]
          Length = 157

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 38/155 (24%), Positives = 73/155 (47%), Gaps = 20/155 (12%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEPQ 63
              + + VAN+F+ K       +   K+Q+ +Y  +   ++   +        + DE+ +
Sbjct: 2   KEITPLIVANWFLTK-----ESMTLKKVQKLVYYAYSWYLILMNEKVDDLKNKLFDEKIK 56

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           AW  GP    +Y+ FK    + I  I D + + +    N +  +I+  +W++Y  +S  Q
Sbjct: 57  AWVHGPAIPMLYNEFKKHKYNSIPKINDFNEQEY---FNLDTIDILNQVWDEYGHYSANQ 113

Query: 124 LQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
           L+ I  +E+  W   R+ + P D   N TI+ +EI
Sbjct: 114 LESITHQED-PWIKARKGFGPLDS-CNETISDKEI 146


>gi|19551563|ref|NP_599565.1| uncharacterized phage-associated protein [Corynebacterium
           glutamicum ATCC 13032]
 gi|62389211|ref|YP_224613.1| phage-associated protein [Corynebacterium glutamicum ATCC 13032]
 gi|21323078|dbj|BAB97707.1| Uncharacterized phage-associated protein [Corynebacterium
           glutamicum ATCC 13032]
 gi|41324544|emb|CAF18884.1| putative phage-associated protein [Corynebacterium glutamicum ATCC
           13032]
          Length = 148

 Score =  146 bits (369), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 31/138 (22%), Positives = 60/138 (43%), Gaps = 5/138 (3%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S   +A +F+  G +    +  LK+Q+ +Y +  + +    + +  ++  AW+ GPV  G
Sbjct: 5   SAREIAEWFVAWGDELDAEVSPLKLQKLLYYSQGEHIAATGRKLFSDKILAWQHGPVTPG 64

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY   K +  +PI+   +     F      ++ + + ++W KY  +S   L+E    E  
Sbjct: 65  VYSDTKSYGRNPID-PDEFVSDEFNWDDYSDVSDELVTVWRKYGIYSAWALREKTHSE-S 122

Query: 134 TWRRLYDPNDPNTNRTIT 151
            W   +       N  IT
Sbjct: 123 PWLDAWA---QGQNIEIT 137


>gi|195867386|ref|ZP_03079390.1| cdse [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
 gi|195660862|gb|EDX54115.1| cdse [Ureaplasma urealyticum serovar 9 str. ATCC 33175]
          Length = 157

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 38/155 (24%), Positives = 73/155 (47%), Gaps = 20/155 (12%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEPQ 63
              + + VAN+F+ K       +   K+Q+ +Y  +   ++   +        + DE+ +
Sbjct: 2   KEITPLIVANWFLTK-----ESMTLKKVQKLVYYAYSWYLILMNEKVDDLKNKLFDEKIK 56

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           AW  GP    +Y+ FK    + I  I D + + +    N +  +I+  +W++Y  +S  Q
Sbjct: 57  AWVHGPAIPMLYNEFKEHKYNSIPKINDFNEQEY---FNLDTIDILNQVWDEYGHYSANQ 113

Query: 124 LQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
           L+ I  +E+  W   R+ + P D   N TI+ +EI
Sbjct: 114 LESITHQED-PWIKARKGFGPLDS-CNETISDKEI 146


>gi|209554130|ref|YP_002284448.1| hypothetical protein UUR10_0035 [Ureaplasma urealyticum serovar 10
           str. ATCC 33699]
 gi|209541631|gb|ACI59860.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 10
           str. ATCC 33699]
          Length = 157

 Score =  146 bits (368), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 72/155 (46%), Gaps = 20/155 (12%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEPQ 63
              + + VAN+F+ K       +   K+Q+ +Y  +   ++   +        + DE+ +
Sbjct: 2   KEITPLIVANWFLTK-----ESMTLKKVQKLVYYAYSWYLILMNEKVDDLKNKLFDEKIK 56

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           AW  GP    +Y+ FK    + I  I D + + +    N +  +I+  +W++Y  +S  Q
Sbjct: 57  AWVHGPAIPMLYNEFKEHKYNSIPKINDFNEQEY---FNLDTIDILNQVWDEYGHYSANQ 113

Query: 124 LQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
           L+ I  +E+  W   R+ + P D   N  I+ +EI
Sbjct: 114 LESITHQED-PWIKARKGFGPLDS-CNAVISDKEI 146


>gi|146329725|ref|YP_001209182.1| hypothetical protein DNO_0260 [Dichelobacter nodosus VCS1703A]
 gi|1628368|emb|CAA67161.1| gepA [Dichelobacter nodosus]
 gi|146233195|gb|ABQ14173.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A]
          Length = 156

 Score =  145 bits (367), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 61/139 (43%), Gaps = 3/139 (2%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
            T   Y  I VA+  +   +    P+ +LK+Q+  YL +   +      M  +  +AWK 
Sbjct: 1   MTYQVYKAIDVADALVRLALADKKPLTNLKVQKLTYLVYGCWLGFTNFQMFQDRVEAWKY 60

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           GPV   +Y++   + ++ I+   +      P   + E  +++  I+N+++     QL  +
Sbjct: 61  GPVIPVLYNQLARYGANFIQ---EPILEKNPIPKDSEEYQLIHDIYNEFKDLKAWQLVYL 117

Query: 128 VQEENKTWRRLYDPNDPNT 146
             ++   W + + P    +
Sbjct: 118 THQKGSPWHQTHTPETKGS 136


>gi|227487241|ref|ZP_03917557.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51867]
 gi|227541589|ref|ZP_03971638.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227092899|gb|EEI28211.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51867]
 gi|227182557|gb|EEI63529.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 177

 Score =  145 bits (366), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 58/148 (39%), Gaps = 3/148 (2%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           PYS   VAN  + +  K  +    +K+Q+ +Y      + +    +L+     W  GPV 
Sbjct: 19  PYSPTVVANNILARAFKEKLYPTPMKLQKILYFVSSQYIKKTGHPLLESPFLTWAYGPVV 78

Query: 72  VGVYHRFKYFDSHPIEVIMD---LSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
             VY  F+ F  + I+           I  +  ++ + E +  +W   +      L +I 
Sbjct: 79  YTVYDEFRPFSKNGIKRYARDAAGQSYIVDENEDRALAESLSEVWEATKYRGAVDLSKIT 138

Query: 129 QEENKTWRRLYDPNDPNTNRTITVEEIT 156
            +E+  W + Y   +   +     ++ T
Sbjct: 139 HKESSAWDKAYQRGEDTLSWEDVKQDRT 166


>gi|261416854|ref|YP_003250537.1| Uncharacterized phage-associated protein-like protein [Fibrobacter
           succinogenes subsp. succinogenes S85]
 gi|261373310|gb|ACX76055.1| Uncharacterized phage-associated protein-like protein [Fibrobacter
           succinogenes subsp. succinogenes S85]
 gi|302327608|gb|ADL26809.1| conserved hypothetical protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 145

 Score =  145 bits (365), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 62/146 (42%), Gaps = 11/146 (7%)

Query: 13  YSTIAVANFFIDKGVKYSIPI-DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           Y  + +A   + K  + +  +  +LK+Q+ +Y      +      + DE  +AW  GPV 
Sbjct: 3   YKALQIAQLLLSKAAERNQELMSNLKLQKMLYYEQGFHLAAFDTPLFDENIEAWMFGPVV 62

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             VY ++  +D+  IE    +  +      N+E   +  ++++ Y  +S  +L E+   E
Sbjct: 63  PEVYEKYAKYDAKGIEPPTQIDIK-----LNEEETTLFNNVFDVYNQYSAVKLVEMTHSE 117

Query: 132 NKTWRRLYDPNDPNTNRTITVEEITK 157
              W    +   P     I+ E + K
Sbjct: 118 -PPW----NSVSPGKGNIISQESMKK 138


>gi|167461419|ref|ZP_02326508.1| putative prophage protein (ps3) [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 160

 Score =  145 bits (365), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 66/156 (42%), Gaps = 13/156 (8%)

Query: 2   KKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
           ++R  T   P  +   VA  F+         +   K+Q+  Y  +   +   +K + D+ 
Sbjct: 5   EERAKTIQEP--TVHDVAKAFLRL-----ESMTPKKLQKLCYYAYSFYLAIYEKKLFDDN 57

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHST 121
            +AW  GPV   +Y  ++ +    I   ++    I     N+ + EI+E ++  Y     
Sbjct: 58  FEAWVHGPVNPQLYTEYREYGWQEIPQEINYPNSIM---KNERVREIIEEVYESYGHLDG 114

Query: 122 EQLQEIVQEENKTWRRLYDPNDP--NTNRTITVEEI 155
            QL+ + ++E+  W+   +   P  ++   I  E+I
Sbjct: 115 SQLEYLTRQED-PWKNARNRLQPYESSRNVIDDEDI 149


>gi|322382660|ref|ZP_08056525.1| hypothetical protein PL1_2573 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|322384063|ref|ZP_08057784.1| hypothetical protein PL1_2192 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321151236|gb|EFX44532.1| hypothetical protein PL1_2192 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321153375|gb|EFX45797.1| hypothetical protein PL1_2573 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 162

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 32/156 (20%), Positives = 66/156 (42%), Gaps = 13/156 (8%)

Query: 2   KKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
           ++R  T   P  +   VA  F+         +   K+Q+  Y  +   +   +K + D+ 
Sbjct: 7   EERAKTIQEP--TVHDVAKAFLRL-----ESMTPKKLQKLCYYAYSFYLAIYEKKLFDDN 59

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHST 121
            +AW  GPV   +Y  ++ +    I   ++    I     N+ + EI+E ++  Y     
Sbjct: 60  FEAWVHGPVNPQLYTEYREYGWQEIPQEINYPNSIM---KNERVREIIEEVYESYGHLDG 116

Query: 122 EQLQEIVQEENKTWRRLYDPNDP--NTNRTITVEEI 155
            QL+ + ++E+  W+   +   P  ++   I  E+I
Sbjct: 117 SQLEYLTRQED-PWKNARNRLQPYESSRNVIDDEDI 151


>gi|71274687|ref|ZP_00650975.1| similar to Uncharacterized phage-associated protein [Xylella
           fastidiosa Dixon]
 gi|71902094|ref|ZP_00684130.1| similar to Uncharacterized phage-associated protein [Xylella
           fastidiosa Ann-1]
 gi|170730076|ref|YP_001775509.1| phage-associated protein-like protein [Xylella fastidiosa M12]
 gi|71164419|gb|EAO14133.1| similar to Uncharacterized phage-associated protein [Xylella
           fastidiosa Dixon]
 gi|71728139|gb|EAO30334.1| similar to Uncharacterized phage-associated protein [Xylella
           fastidiosa Ann-1]
 gi|167964869|gb|ACA11879.1| Uncharacterized phage-associated protein-like protein [Xylella
           fastidiosa M12]
          Length = 173

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 31/136 (22%), Positives = 64/136 (47%), Gaps = 2/136 (1%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           PY    +AN F+ K  +    +  L++ + +YL H   +   ++ ++DE  +AW+ GPV 
Sbjct: 2   PYLPTIIANDFLQKASQEGRALTPLQVLKLVYLAHGWCLGVHRQPLIDEPVEAWRAGPVI 61

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIA--NQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
             +Y+  K + S+ I   + + +  + +    +     I+ S+W  Y+ +   +L EI +
Sbjct: 62  RSLYNAIKQYGSNAITERLPVRWFSWGRALKIDATAAAILASVWVTYRRYGGVELAEITR 121

Query: 130 EENKTWRRLYDPNDPN 145
            E   W   +   + N
Sbjct: 122 AEGSPWWTTWKGLNEN 137


>gi|261866994|ref|YP_003254916.1| hypothetical protein D11S_0286 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412326|gb|ACX81697.1| hypothetical protein D11S_0286 [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 147

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 54/127 (42%), Gaps = 3/127 (2%)

Query: 13  YSTIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           YS+IA+AN FI K     I  +  +K+Q+ ++ T    +    K + +   + W+ GPV 
Sbjct: 3   YSSIAIANSFIGKANIGEISNLTPMKLQKLMFYTQSWYIKLYGKPLFEGGVERWQFGPVL 62

Query: 72  VGVYHRFKYFDSHPIEVIMDL--SFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
             +YH FK F S  I          +   K ++++    ++ I   Y      QL  +  
Sbjct: 63  PEIYHEFKPFGSRIISSFGTDIWGKQQIIKESDKDTLLFLDKIIEIYGKFDGPQLSWMTH 122

Query: 130 EENKTWR 136
           +    W 
Sbjct: 123 QPETAWS 129


>gi|115334623|ref|YP_764469.1| GepA protein [Geobacillus phage GBSV1]
 gi|155042929|ref|YP_001425596.1| GepA [Bacillus virus 1]
 gi|84688573|gb|ABC61269.1| GepA protein [Geobacillus phage GBSV1]
 gi|115529833|gb|ABJ09612.1| GepA [Bacillus virus 1]
          Length = 249

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/162 (26%), Positives = 71/162 (43%), Gaps = 22/162 (13%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
           +   +   VA F +       IP  HLK+Q+ +Y  + + +L+  + +  E   A+K GP
Sbjct: 90  DQELTAYDVAKFILSV-----IPSSHLKLQKLLYFAYAEFLLRTGEKLFREPILAFKYGP 144

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFP----------KIANQEIGEI----MESIWNK 115
           V   V+H++K   S  I+   D +  I+P          KIA+ E G I    +  ++ K
Sbjct: 145 VVESVFHKYKVHGSSIIDYKEDETVCIYPEELAVTPSFMKIASSEHGLIALDCLIDVFEK 204

Query: 116 YQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITK 157
           Y   S ++L          W R+Y    P  N  IT + I +
Sbjct: 205 YGHLSAQELVYKTHRPGGPWDRVY---KPGKNAVITDDLILQ 243


>gi|253990607|ref|YP_003041963.1| hypothetical protein PAU_03133 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782057|emb|CAQ85221.1| Hypothetical Protein PAU_03133 [Photorhabdus asymbiotica]
          Length = 155

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 10/136 (7%)

Query: 13  YSTIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           Y TIAVAN FI+K ++  IP +  +K+Q+ ++      +      ++D+    W+ GPV 
Sbjct: 3   YPTIAVANAFINKAIQGQIPDLTPMKLQKLMFYAQSWHLKIHNDPLVDDFFAKWQYGPVI 62

Query: 72  VGVYHRFKYFDSHPI-------EVIMDLSFRIFPKIANQEIGE--IMESIWNKYQSHSTE 122
             +YH  K + ++PI           +    + P I  ++     +++ I N Y      
Sbjct: 63  PSLYHEVKRYGANPICRTISTLLNTEEGFAIVTPTIPKEDTRTNVLIDKIINVYGPLRGT 122

Query: 123 QLQEIVQEENKTWRRL 138
           QL  +       W   
Sbjct: 123 QLSYLTHLPGTAWSET 138


>gi|307947548|ref|ZP_07662879.1| cdse [Roseibium sp. TrichSKD4]
 gi|307769254|gb|EFO28484.1| cdse [Roseibium sp. TrichSKD4]
          Length = 169

 Score =  144 bits (364), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 60/132 (45%), Gaps = 8/132 (6%)

Query: 13  YSTIAVANFFIDKGVKYSI-PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           Y    VAN F+ +  +  I  +D LK+Q+ +Y  H   +  +    + E  +AW  GPV 
Sbjct: 11  YKPSWVANTFLVRAREDRISDVDPLKLQKLMYCLHGWNLAVRGHPAVGERFEAWPHGPVL 70

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIA-------NQEIGEIMESIWNKYQSHSTEQL 124
             +YH+FK +    I  + +       + A       ++   E+ + +W++Y+  S  +L
Sbjct: 71  SSIYHQFKSYGGFRIHGLAEEIDPTTGEKATLIVAKSDENFYEVFDRVWDRYKKFSGLKL 130

Query: 125 QEIVQEENKTWR 136
            E+  + N  W 
Sbjct: 131 SEMTHQPNTPWS 142


>gi|117676333|ref|YP_863932.1| hypothetical protein BPSphi5223_0049 [Burkholderia phage phi52237]
 gi|117670160|gb|ABK56726.1| conserved hypothetical protein [Burkholderia phage phi52237]
          Length = 157

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 39/143 (27%), Positives = 65/143 (45%), Gaps = 4/143 (2%)

Query: 12  PYSTIAVANFFIDKGVKYSIP--IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
             S + +A   I +    S P    +L IQ+  Y  H   +    + +++E  +AW+ GP
Sbjct: 2   TISALQLAAELIRRSDAQSRPQFTTNLAIQKLAYFCHGWHLALSGEPLVNEPFEAWRFGP 61

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V  G+YH  K F S+PI     L        A    G++++ + N Y   ST QL  I  
Sbjct: 62  VLPGLYHTLKVFSSNPIPANHPLVISQASLPAGSWSGQLIDHVLNVYGGLSTTQLVSISH 121

Query: 130 EENKTWRRLYD--PNDPNTNRTI 150
             +  W++++   P+   TN +I
Sbjct: 122 ASDGPWQQVWSQGPSSWITNESI 144


>gi|229111150|ref|ZP_04240707.1| hypothetical protein bcere0018_33970 [Bacillus cereus Rock1-15]
 gi|228672314|gb|EEL27601.1| hypothetical protein bcere0018_33970 [Bacillus cereus Rock1-15]
          Length = 155

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 67/127 (52%), Gaps = 6/127 (4%)

Query: 15  TIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
            + VA + I++    +   I +LK+Q+ +Y      +  K+K++ +E+ +AW  GPV   
Sbjct: 4   VMDVAKYLINQSRPGTQENITNLKLQKLLYYAQGFCLAIKEKALFEEDIEAWVHGPVVPE 63

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY  FK +  + I+ I D +      +  +E  ++++++W  +QS+S + L+E+   E +
Sbjct: 64  VYSEFKGYTYNDIDGIYDENK----IVLTKEEIDLLDNMWKIFQSYSGKVLEEMTHNE-E 118

Query: 134 TWRRLYD 140
            W    +
Sbjct: 119 PWINARN 125


>gi|119383205|ref|YP_914261.1| hypothetical protein Pden_0451 [Paracoccus denitrificans PD1222]
 gi|119372972|gb|ABL68565.1| conserved hypothetical protein [Paracoccus denitrificans PD1222]
          Length = 183

 Score =  144 bits (363), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 32/135 (23%), Positives = 61/135 (45%), Gaps = 6/135 (4%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           PY   A+AN  +D+  +    I +L +Q+ +Y  H   + + K+ ++    +AW+ GPV 
Sbjct: 4   PYDPRAIANLMLDEADRRGWKITNLALQKLLYFAHGIHLTKTKRPLVSGYFEAWQYGPVH 63

Query: 72  VGVYHRFKYFDSHPI------EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
             VY  FK   S PI      +  +    R  PK  + E+ +++  +   Y      +L 
Sbjct: 64  PAVYRAFKPSGSAPIINRAAAKDPLTGKTRDLPKPTDLEVIDLVSDVMRSYGHLPPGRLV 123

Query: 126 EIVQEENKTWRRLYD 140
           ++   ++  W  + D
Sbjct: 124 DLSHAKDSPWSVVVD 138


>gi|260910168|ref|ZP_05916845.1| phage protein [Prevotella sp. oral taxon 472 str. F0295]
 gi|260635672|gb|EEX53685.1| phage protein [Prevotella sp. oral taxon 472 str. F0295]
          Length = 174

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 39/156 (25%), Positives = 81/156 (51%), Gaps = 15/156 (9%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLD---EEPQAWKQGPV 70
           + ++VAN+FI+      + +  LK+ + +Y+ +   +    +S++D   ++ +AW+ GPV
Sbjct: 4   NALSVANYFIELAKNDKVDVRPLKLMKLVYMAYGYALAIIDRSIIDPRFDKVEAWRYGPV 63

Query: 71  FVGVYHRFKYFDSHPIEVI---MDLSFR-----IFPKIANQEIGEIMESIWNKYQSHSTE 122
              VYH FK + ++P+      M+ S +     + PK+ ++   ++ + +W +Y+ HS  
Sbjct: 64  IPSVYHSFKQYRNNPVTEKTVVMEPSDKYEVKFVEPKLEDKSARKVCDFVWKRYRDHSDS 123

Query: 123 QLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKM 158
            L  ++  E   W ++Y       N TI  E +TK+
Sbjct: 124 GLVSLLHGEATPWAQVY---REGQNCTIP-EVMTKI 155


>gi|258517004|ref|YP_003193226.1| prophage ps3 protein 01 [Desulfotomaculum acetoxidans DSM 771]
 gi|257780709|gb|ACV64603.1| prophage ps3 protein 01 [Desulfotomaculum acetoxidans DSM 771]
          Length = 163

 Score =  143 bits (361), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 69/161 (42%), Gaps = 6/161 (3%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
              + I ++   I         + HLK+Q+ IY       +   + +++++ +AW  GPV
Sbjct: 3   KQINPIDLSRHVIKYVNDKGHEVSHLKLQKLIYYVDAWHNVYFNQPLIEDQFEAWMHGPV 62

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
              +++ F+        + ++  +    +  + E  E++  + ++Y   +   L+ +   
Sbjct: 63  VRNIWNYFRDKSVLYDPIKLEEGYFDISEYISSEQLELINDVLDEYGDKTAYYLECLTHS 122

Query: 131 ENKTWRRL---YDPNDPNTNRTITVEEITKMADGSNISPEN 168
           E + WRR    Y P+D      I  +++ K   GS +  +N
Sbjct: 123 E-EPWRRARLGYAPSDK-CEAVI-YKDLIKQFYGSMLYGKN 160


>gi|300867705|ref|ZP_07112350.1| putative Phage-associated protein [Oscillatoria sp. PCC 6506]
 gi|300334288|emb|CBN57522.1| putative Phage-associated protein [Oscillatoria sp. PCC 6506]
          Length = 151

 Score =  143 bits (360), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 30/145 (20%), Positives = 63/145 (43%), Gaps = 9/145 (6%)

Query: 14  STIAVANFFIDKGVKY-SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           S + VA +F+ +  +     I  LK+Q+ +Y      ++ + + +  E+ QAW  GP   
Sbjct: 3   SALDVARYFLYRVDRDAGDTISPLKLQKLVYYAQAWSLVLRDQPLFYEDIQAWVHGPAIY 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            V+  +K +    I    +               E++E +WN Y   S ++L+++   E 
Sbjct: 63  EVWDTYKDYRYGAIPEPEEELPEFEDDE-----IEVLEEVWNAYGELSAKRLEDLTHSE- 116

Query: 133 KTWRRLYDPNDPNT--NRTITVEEI 155
           + W       +P    ++ I+ E++
Sbjct: 117 EPWINARKGLEPAQKSSKVISHEDM 141


>gi|300864260|ref|ZP_07109140.1| putative Similar to A0ZKW1_NODSP prophage protein [Oscillatoria sp.
           PCC 6506]
 gi|300337725|emb|CBN54286.1| putative Similar to A0ZKW1_NODSP prophage protein [Oscillatoria sp.
           PCC 6506]
          Length = 195

 Score =  142 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 32/151 (21%), Positives = 65/151 (43%), Gaps = 9/151 (5%)

Query: 13  YSTIAVANFFIDKGVKYSIP--IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
              + VA +FI +  +  I   + ++K+Q+ +Y      +    + +  EE QAW+ GPV
Sbjct: 2   IDCLNVACYFIIRAYEDGIEAEMTNMKVQKLLYYAQSLHLALYNEPLFAEEIQAWRYGPV 61

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
               Y  +  F++  + +    S   FP     E  E++E IW  +  +   +L ++   
Sbjct: 62  CPPAYRFYSDFEARQLPIPRKESLSDFP----SEKKELLEEIWEYFGGYHAYRLSDMTHG 117

Query: 131 ENKTWRRLYD--PNDPNTNRTITVEEITKMA 159
           E   W+R     P   ++   I + ++  + 
Sbjct: 118 EF-PWKRARKGLPPQASSTEPILLNDMKALG 147


>gi|187736496|ref|YP_001878608.1| Uncharacterized phage-associated protein-like protein [Akkermansia
           muciniphila ATCC BAA-835]
 gi|187426548|gb|ACD05827.1| Uncharacterized phage-associated protein-like protein [Akkermansia
           muciniphila ATCC BAA-835]
          Length = 161

 Score =  142 bits (359), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 67/155 (43%), Gaps = 3/155 (1%)

Query: 1   MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE 60
           M+   F+  N   +T  + N+FI +     + +  +K+   + L     + +    +++E
Sbjct: 1   MEATHFSMANST-TTQKLCNWFIQQANAKELILTPVKLNHLVILADWWHLHRTGAFLINE 59

Query: 61  EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
             +AW  GPV   +YH +K     P   I   S R  P     +I   +E IWN Y  ++
Sbjct: 60  RVEAWPSGPVLPSIYHEYKDQ--PPYSSIEHPSRRQPPLEEETDIIPFLEHIWNVYGKYT 117

Query: 121 TEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
            +QL  I    +  W++    ++    + IT E +
Sbjct: 118 AQQLGRINTAPSSPWKQSQGKHEQAHRQQITEEHV 152


>gi|13357589|ref|NP_077863.1| hypothetical protein UU033 [Ureaplasma parvum serovar 3 str. ATCC
           700970]
 gi|170762084|ref|YP_001752113.1| hypothetical protein UPA3_0033 [Ureaplasma parvum serovar 3 str.
           ATCC 27815]
 gi|11345919|pir||F82941 hypothetical UU033 [imported] - Ureaplasma urealyticum
 gi|6898980|gb|AAF30438.1|AE002103_3 hypothetical [Ureaplasma parvum serovar 3 str. ATCC 700970]
 gi|168827661|gb|ACA32923.1| conserved hypothetical protein [Ureaplasma parvum serovar 3 str.
           ATCC 27815]
          Length = 157

 Score =  142 bits (358), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 36/155 (23%), Positives = 69/155 (44%), Gaps = 20/155 (12%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEPQ 63
              + + VAN+F+ K       +   K+Q+ +Y  +   +    +        + DE+ +
Sbjct: 2   KEITPLIVANWFLTK-----ESMTPKKVQKLVYYAYSWYLTLMNEKVDDLKNKLFDEKIK 56

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           AW   P    +Y+ FK    + I  I D +   +    N +  +I+  +W++Y  +S  Q
Sbjct: 57  AWVHEPAIPMLYNEFKEHKYNSIPKINDFNELEY---FNLDTIDILNQVWDEYGHYSANQ 113

Query: 124 LQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
           L+ I  +E+  W   R+ + P D   N  I+ +EI
Sbjct: 114 LESITHQED-PWIKARKGFGPLDS-CNAVISDKEI 146


>gi|309805020|ref|ZP_07699077.1| conserved hypothetical protein [Lactobacillus iners LactinV 09V1-c]
 gi|309806809|ref|ZP_07700798.1| conserved hypothetical protein [Lactobacillus iners LactinV 03V1-b]
 gi|325912764|ref|ZP_08175143.1| hypothetical protein HMPREF0523_0447 [Lactobacillus iners UPII
           60-B]
 gi|308165679|gb|EFO67905.1| conserved hypothetical protein [Lactobacillus iners LactinV 09V1-c]
 gi|308166783|gb|EFO68973.1| conserved hypothetical protein [Lactobacillus iners LactinV 03V1-b]
 gi|325477895|gb|EGC81028.1| hypothetical protein HMPREF0523_0447 [Lactobacillus iners UPII
           60-B]
          Length = 154

 Score =  142 bits (358), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 30/153 (19%), Positives = 66/153 (43%), Gaps = 20/153 (13%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK-------KSMLDE-EPQA 64
           Y+   VA +F+ KG K    I   K+Q+ +Y  +   +             + ++ + +A
Sbjct: 3   YTFKDVAKWFLAKGNKD---ISPKKLQKLVYYAYAWTLTLLNDSSDDLENKLFEDGKFEA 59

Query: 65  WKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQL 124
           W  GPV   +Y  +  +    I    +          ++++ +++  +W  Y  +S +QL
Sbjct: 60  WIHGPVIRKLYVMYADYGFEDIPEKPEKPK------FSKDVEDVLNQVWEVYGDYSADQL 113

Query: 125 QEIVQEENKTWRRLYDPNDP--NTNRTITVEEI 155
           + I  +E + W++      P  N +  I+ ++I
Sbjct: 114 ESITHQE-EPWQKARKGFSPLQNCDNIISDKDI 145


>gi|228969638|ref|ZP_04130429.1| CDSE [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228790076|gb|EEM37867.1| CDSE [Bacillus thuringiensis serovar sotto str. T04001]
          Length = 193

 Score =  142 bits (357), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 35/153 (22%), Positives = 66/153 (43%), Gaps = 10/153 (6%)

Query: 6   FTQTNPPYSTIAVANFFIDKGVKY-SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQA 64
           F +   P S   VAN+F+          I  LK+Q+  +         + + + DE+ +A
Sbjct: 33  FMKEKKP-SIYDVANYFLYLSSPGTPRSITPLKLQKLTFYAQALNYAMEGEPLFDEDFEA 91

Query: 65  WKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQL 124
           W  GPV   +Y+ +K + S  I+     S  I     ++++  +++ IW  Y +   + L
Sbjct: 92  WVHGPVSPELYYEYKNYGSREID-----SSTIMKPKLDKKVKNVIKIIWRMYGTKDGKYL 146

Query: 125 QEIVQEENKTWRRLYDPND--PNTNRTITVEEI 155
           +     E K W++  +  D   ++N  I    I
Sbjct: 147 ENKTHNE-KPWQQARNGLDYYQHSNEIIDKTSI 178


>gi|153810977|ref|ZP_01963645.1| hypothetical protein RUMOBE_01368 [Ruminococcus obeum ATCC 29174]
 gi|149832865|gb|EDM87948.1| hypothetical protein RUMOBE_01368 [Ruminococcus obeum ATCC 29174]
          Length = 152

 Score =  141 bits (356), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           + + VAN  +++G    I I  +K+Q+ +YL +        K +  +  + WK GPV   
Sbjct: 3   TALNVANNVLERGFSEDIDITPMKLQKLVYLIYKKYYQDTDKILFQDRFEVWKYGPVVRS 62

Query: 74  VYHRFKYFDSHPIE---VIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
           +Y  FK F  + I+      + S  I  +    +  E + +IW+KY+ +    L  +  +
Sbjct: 63  IYDEFKEFGGNAIKRYSKEKNGSVLIVNEKKAADFRECINAIWDKYKLYDGIPLSAMTHK 122

Query: 131 ENKTWRRLYDPNDPNTN-RTITVEEI 155
           +   W +     +P  +   I  EE+
Sbjct: 123 KGTAWYKAAKRQEPYLSIADIKEEEV 148


>gi|159029382|emb|CAO90758.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 195

 Score =  141 bits (355), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 67/151 (44%), Gaps = 9/151 (5%)

Query: 13  YSTIAVANFFIDKGVKYSI--PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
              + VA +FI +  +  I   + ++K+Q+ +Y      +    + +  EE QAW+ GPV
Sbjct: 2   IDCLTVARYFIIRAYEDGIDAEMTNMKVQKLLYYAQSLHLALYDEPLFKEEIQAWRYGPV 61

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
               Y  +  F++  + +    S    P     E  E++E IW  + ++   +L ++   
Sbjct: 62  CPAAYKFYSDFEAKQLPIPRQESLSGLP----SEKKELLEEIWQYFGNYHAYRLSDMTHA 117

Query: 131 ENKTWRRLYD--PNDPNTNRTITVEEITKMA 159
           E   W++     P + ++   I ++++  + 
Sbjct: 118 EF-PWKKARKGLPPEESSTEPILLDDMKALG 147


>gi|260844980|ref|YP_003222758.1| hypothetical protein ECO103_2857 [Escherichia coli O103:H2 str.
           12009]
 gi|257760127|dbj|BAI31624.1| hypothetical protein ECO103_2857 [Escherichia coli O103:H2 str.
           12009]
 gi|323176675|gb|EFZ62265.1| hypothetical protein ECOK1180_4037 [Escherichia coli 1180]
          Length = 156

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 57/128 (44%), Gaps = 11/128 (8%)

Query: 22  FIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQK-KKSMLDEEPQAWKQGPVFVGVYHRFK 79
           FIDK  +  I  +  +K+Q+ ++ T    +     K + D+    W  GPV   +YH  K
Sbjct: 12  FIDKAKRGEIKDLTPMKLQKLLFYTQSWHLKLFNGKPLFDDLFARWPYGPVIPHLYHMLK 71

Query: 80  YFDSHPIEVIMDLSF-------RIFPKIA--NQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
            + S+ I+ ++ +         RI P I   + E G +++ I   Y S+S  +L  +   
Sbjct: 72  KYGSNEIQEMISIIIDSDGEWKRITPTIQNGDTETGRLIDKIVEVYGSYSGTELSNMTHA 131

Query: 131 ENKTWRRL 138
            N  W + 
Sbjct: 132 PNAAWSKG 139


>gi|218281122|ref|ZP_03487657.1| hypothetical protein EUBIFOR_00218 [Eubacterium biforme DSM 3989]
 gi|218217636|gb|EEC91174.1| hypothetical protein EUBIFOR_00218 [Eubacterium biforme DSM 3989]
          Length = 333

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/180 (21%), Positives = 79/180 (43%), Gaps = 12/180 (6%)

Query: 3   KRTFTQTNPPYSTIAVANFFI---DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLD 59
           K++  + +   +   ++N  I       +    +  L +Q+ +Y       +   + M +
Sbjct: 147 KKSMKRVSELKNIFIISNKMIGVISYIFEKLDEVTPLMLQKLLYYIQGLSFVLNGREMFE 206

Query: 60  EEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSH 119
           E  +AW  GPV+  VY+ FK F  + I+    + F  + K  + E   I++ + N +  +
Sbjct: 207 ENCEAWVHGPVYKDVYNIFKQFGFNVIDDPKFIMFEGYKKYLDDEDKYIIDLVVNTFGQY 266

Query: 120 STEQLQEIVQEENKTW---RRLYDPNDPNTNRTITVEEIT----KMADGSNISPENVVEQ 172
             + L++   +EN  W   R  Y  +D  +N  IT + I     K+ +  +IS E  + +
Sbjct: 267 GGKTLEKTTHKEN-PWLIARNGYG-DDIPSNELITKDSIKNYFIKICNEYDISKEEDIHK 324


>gi|225550956|ref|ZP_03771905.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 2
           str. ATCC 27814]
 gi|225380110|gb|EEH02472.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 2
           str. ATCC 27814]
          Length = 157

 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 72/155 (46%), Gaps = 20/155 (12%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEPQ 63
              + + VAN+F+ K       +   K+Q+ +Y  +   ++   +        + DE+ +
Sbjct: 2   KEITPLIVANWFLTK-----ESMTLKKVQKLVYYAYSWYLILMNEKVDDLKNKLFDEKIK 56

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           A   GP    +Y+ FK    + I  I D + + +    N +  +I+  +W++Y  +S  Q
Sbjct: 57  ARVHGPAIPMLYNEFKEHKYNSIPKINDFNEQEY---FNLDTIDILNQVWDEYGHYSANQ 113

Query: 124 LQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
           L+ I  +E+  W   R+ + P D   N TI+ +EI
Sbjct: 114 LESITHQED-PWIKARKGFGPLDS-CNETISDKEI 146


>gi|154488282|ref|ZP_02029399.1| hypothetical protein BIFADO_01856 [Bifidobacterium adolescentis
           L2-32]
 gi|154083433|gb|EDN82478.1| hypothetical protein BIFADO_01856 [Bifidobacterium adolescentis
           L2-32]
          Length = 168

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 34/157 (21%), Positives = 67/157 (42%), Gaps = 11/157 (7%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           ++I VAN FI +     I I +L + + +Y    + + +  K + +++ +AW  GPV   
Sbjct: 2   NSIQVANAFILRHGSD-IDITNLVLNKLVYFAQVESLRETGKPLFEDKIEAWSYGPVERD 60

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY  F+ +  + I      + +      ++    +++    KY   +   L      +N 
Sbjct: 61  VYFTFQKYGRNRIPKPEGETAK------DERTLSVVDRTAKKYGFLTAFDLVGFSHRKNS 114

Query: 134 TWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVV 170
            W+ +Y       N  IT ++I    DG    P+N +
Sbjct: 115 AWKNVY---RKGENVEITNDDILASDDGLTF-PKNTL 147


>gi|315168861|gb|EFU12878.1| conserved hypothetical protein [Enterococcus faecalis TX1341]
          Length = 151

 Score =  139 bits (351), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 64/151 (42%), Gaps = 17/151 (11%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE-EPQAWKQG 68
           N  YS   +A++F++K       +   K+Q+  Y            S++D+ E QAW  G
Sbjct: 2   NKKYSIFEIADWFLNK-----ESMTPKKLQKLCYYAQAWNNALLDDSIIDDSEFQAWAHG 56

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV   +Y++++ +  + I           P   + +  +++ES+W  Y   S  +L+ + 
Sbjct: 57  PVSPELYNKYREYRWNSIPK------CTSPAAIDNQTVDVLESVWITYGDKSANELEALT 110

Query: 129 QEENKTWRRLYD----PNDPNTNRTITVEEI 155
             E   W++           +    I+ E++
Sbjct: 111 HTE-LPWKQARLRAGVSEGDSCREKISTEDM 140


>gi|251791488|ref|YP_003006209.1| hypothetical protein Dd1591_3930 [Dickeya zeae Ech1591]
 gi|247540109|gb|ACT08730.1| conserved hypothetical protein [Dickeya zeae Ech1591]
          Length = 174

 Score =  139 bits (351), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 60/141 (42%), Gaps = 17/141 (12%)

Query: 13  YSTIAVANFFIDKGVKYSI-PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           YS I+VAN  I+K     I  +  +K+Q+ +Y  H  ++   ++ +++E  +AWK GPV 
Sbjct: 3   YSAISVANSLIEKAKNRGITDLTPMKLQKLVYFAHAWMLAIDERPLINETVKAWKFGPVI 62

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRI----------------FPKIANQEIGEIMESIWNK 115
             VYH FK + +  I+        I                +   ++     +M++I + 
Sbjct: 63  DSVYHEFKAYGAKNIDSFGTEFDLIDAEDNGGVPDVGFITPYVDSSDTRAHSVMDAILDT 122

Query: 116 YQSHSTEQLQEIVQEENKTWR 136
           Y   S   L  +    +  W 
Sbjct: 123 YGDKSATFLSNLTHAPDSAWS 143


>gi|166368019|ref|YP_001660292.1| putative prophage protein [Microcystis aeruginosa NIES-843]
 gi|166090392|dbj|BAG05100.1| putative prophage protein [Microcystis aeruginosa NIES-843]
          Length = 195

 Score =  139 bits (350), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 65/151 (43%), Gaps = 9/151 (5%)

Query: 13  YSTIAVANFFIDKGVKYSI--PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
              + VA +FI +  +  +   + ++K+Q+ +Y      +    + +  EE QAW+ GPV
Sbjct: 2   IDCLTVARYFIIRAYEDGMDAEMTNMKVQKLLYYAQSLHLALYDEPLFKEEIQAWRYGPV 61

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
               Y  +  F++      + +  +        E  E++  IW  + ++   +L ++   
Sbjct: 62  CPAAYKFYSDFEA----EQLPIPRQECLSGLPSEKKELLAEIWQYFGNYHAYRLSDMTHA 117

Query: 131 ENKTWRRLYD--PNDPNTNRTITVEEITKMA 159
           E   W++     P + ++   I ++++  + 
Sbjct: 118 EF-PWKKARKGLPPEESSTEPILLDDMKALG 147


>gi|283783651|ref|YP_003374405.1| CPW-WPC domain protein [Gardnerella vaginalis 409-05]
 gi|283441193|gb|ADB13659.1| CPW-WPC domain protein [Gardnerella vaginalis 409-05]
          Length = 153

 Score =  138 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 61/145 (42%), Gaps = 9/145 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   VA++ +D        I  +K+Q+  Y +    +      + +E+ QAW+ GPV   
Sbjct: 3   TIFNVASYILDIAG----TITTMKLQKLAYYSQAYSLATTGYPLFNEDFQAWRNGPVCPE 58

Query: 74  VYHRFK-YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
           ++   +  F     E ++  + ++           ++E +  K+   S   L  +   E+
Sbjct: 59  LFALHRGKFLIRKGEFVLPSTDKLNDDSLTDGQKLLVEKVCKKFAECSGSDLSAMTHRED 118

Query: 133 KTWRRLYDPNDPNTNRTITVEEITK 157
             W+  YD  +   +  I V++ITK
Sbjct: 119 -PWKNAYDATN---SSAICVQKITK 139


>gi|148284657|ref|YP_001248747.1| hypothetical protein OTBS_1191 [Orientia tsutsugamushi str.
           Boryong]
 gi|146740096|emb|CAM80257.1| hypothetical protein OTBS_1191 [Orientia tsutsugamushi str.
           Boryong]
          Length = 129

 Score =  138 bits (349), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 14  STIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           S   VA++F+     +    I  LK+Q+ +Y +    +    K +  E+ +AW+ GPV  
Sbjct: 11  SCFDVASYFLVLVDREAGDVITQLKLQKLVYFSQGVHLALFDKPLFKEDIEAWQNGPVVR 70

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +   F  F+++ I    ++ F I+      +  E++  I++ Y  H+   L+++     
Sbjct: 71  HLRSIFGSFEANAIPGPGEIDFSIY----TNQQKELIYKIYSSYGEHTASYLRDLTHLH- 125

Query: 133 KTWR 136
             W+
Sbjct: 126 SIWQ 129


>gi|149204320|ref|ZP_01881287.1| hypothetical protein RTM1035_18245 [Roseovarius sp. TM1035]
 gi|149142205|gb|EDM30252.1| hypothetical protein RTM1035_18245 [Roseovarius sp. TM1035]
          Length = 182

 Score =  138 bits (348), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 59/141 (41%), Gaps = 6/141 (4%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
             Y    +AN  +D+  K    I +L +Q+ +Y  H   + + K+ ++    +AW+ GPV
Sbjct: 2   SAYDPRTIANLMLDEADKRGWKITNLALQKLLYFAHGIHLTRNKRPLVSGYFEAWQYGPV 61

Query: 71  FVGVYHRFKYFDSHPI------EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQL 124
              VY  FK   + PI      +  +    R  PK  + EI +++  +   Y      +L
Sbjct: 62  HPAVYRAFKPSGAAPIVNRAVAKDPLTCKTRELPKPTDVEIIDLVSDVMRSYGHLPPGRL 121

Query: 125 QEIVQEENKTWRRLYDPNDPN 145
            ++   ++  W  + D     
Sbjct: 122 VDLSHAKDSPWSVIVDKARTG 142


>gi|224436575|ref|ZP_03657584.1| prophage ps3 protein01-like protein [Helicobacter cinaedi CCUG
           18818]
 gi|313143077|ref|ZP_07805270.1| prophage protein [Helicobacter cinaedi CCUG 18818]
 gi|313128108|gb|EFR45725.1| prophage protein [Helicobacter cinaedi CCUG 18818]
          Length = 175

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/159 (23%), Positives = 68/159 (42%), Gaps = 19/159 (11%)

Query: 15  TIAVANFFI---------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAW 65
            I VA  F+         D+  +    I +LK+Q+ +Y      +L   K + +E+ +AW
Sbjct: 3   AIEVAKAFVFLFQQQLLNDEAQEEGDTITNLKVQKLLYYAQAYSLLYYNKPLFNEKIEAW 62

Query: 66  KQGPVFVGVYHRFKY----FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHST 121
             GPV   V++  K          +  I  L+   F    N +  +I+ ++WNKY  ++ 
Sbjct: 63  PHGPVVKEVFNEIKKEIGENGCRNLGDIWHLTKENFN--LNDDDMDILLNVWNKYGKYTA 120

Query: 122 EQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMAD 160
            +L+ +  +E + +  +Y  +    N  IT   I    D
Sbjct: 121 SKLRNMTHDE-QPYLNVYVESK---NNEITQTSIKAYFD 155


>gi|257059424|ref|YP_003137312.1| phage-associated protein [Cyanothece sp. PCC 8802]
 gi|256589590|gb|ACV00477.1| uncharacterized phage-associated protein [Cyanothece sp. PCC 8802]
          Length = 196

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 68/154 (44%), Gaps = 13/154 (8%)

Query: 13  YSTIAVANFFIDKGVKYSIP--IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
            S + VA +FI +  +      I ++K+Q+ +Y T C  +    + +  EE QAW+ GPV
Sbjct: 2   ISPLEVAKYFIIRAYEEGRENHITNMKVQKLLYYTQCLHLALYNEPLFAEEIQAWRYGPV 61

Query: 71  FVGVYHRFKYFDSH--PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
               Y  +  F++   PI     L      +   QE  +++E +W  +  +    L ++ 
Sbjct: 62  CPPAYRFYSEFEAQQLPIPTQNKL------ETLTQEKLDLLEEVWQYFGEYHAYYLSDMT 115

Query: 129 QEENKTWRRLYD--PNDPNTNRTITVEEITKMAD 160
             E   W++      +  ++   I +E++  + +
Sbjct: 116 HLEF-PWKKARAGLSSYESSTNPILLEDMRLLGE 148


>gi|189183139|ref|YP_001936924.1| hypothetical protein OTT_0232 [Orientia tsutsugamushi str. Ikeda]
 gi|189179910|dbj|BAG39690.1| hypothetical protein OTT_0232 [Orientia tsutsugamushi str. Ikeda]
          Length = 148

 Score =  138 bits (347), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 64/145 (44%), Gaps = 10/145 (6%)

Query: 14  STIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           S   VA++F+     +    I  LK+Q  +Y      +    K +  E+ +AW+ GPV  
Sbjct: 11  SCFDVASYFLVLVDREAGDIITQLKLQNLVYFAQGVHLALFDKPLFKEDIEAWENGPVVR 70

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +   F  F+++ I    ++ F I+     ++  E++  I++ Y  H+   L+++     
Sbjct: 71  HLRSIFGGFEANAIPAPGEIDFSIY----TRQQKEVIYKIYSSYGEHTASYLRDLTYLH- 125

Query: 133 KTWRRLYDPNDPNTNRTITVEEITK 157
             W+          +R IT EE+ K
Sbjct: 126 SIWQEAI----IRPSRVITKEEMRK 146


>gi|225869434|ref|YP_002745382.1| hypothetical protein SZO_18870 [Streptococcus equi subsp.
           zooepidemicus]
 gi|225871436|ref|YP_002747383.1| hypothetical protein SEQ_2178 [Streptococcus equi subsp. equi 4047]
 gi|225700840|emb|CAW95560.1| hypothetical protein SEQ_2178 [Streptococcus equi subsp. equi 4047]
 gi|225702710|emb|CAX00835.1| hypothetical protein SZO_18870 [Streptococcus equi subsp.
           zooepidemicus]
          Length = 249

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/160 (25%), Positives = 72/160 (45%), Gaps = 20/160 (12%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
           Q++   S I VA FF+        P+ HL++Q+ +YL +   +L   +S+ DE+  A++ 
Sbjct: 87  QSDSKISAIDVAKFFLAM-----RPLSHLQLQKLVYLAYKTYLLAYGESLFDEKIVAFQY 141

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQ------------EIGEIMESIWNK 115
           GPV   VYH FK + S  I++     + +      Q            +I  ++  +  +
Sbjct: 142 GPVVEEVYHSFKKYGSEVIDIDDHTEYILKDIHLPQALGRMLLVEDAKKIVPVLLDVVKQ 201

Query: 116 YQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
           Y   +  +L ++   E   W+ ++ P     N  IT E I
Sbjct: 202 YGDLTGGELVKLTHSEKGPWQTVFRPQ---LNCEITDEVI 238


>gi|257438939|ref|ZP_05614694.1| putative prophage ps3 protein 01 [Faecalibacterium prausnitzii
           A2-165]
 gi|257198617|gb|EEU96901.1| putative prophage ps3 protein 01 [Faecalibacterium prausnitzii
           A2-165]
          Length = 340

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 10/173 (5%)

Query: 4   RTFTQTNPPYSTIAVAN-FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEP 62
              TQ    Y  + V     I         +  L +Q+ +Y    +      K + D   
Sbjct: 160 TAATQLENLYVAVPVELLAVIAYIFSALHEVTPLTLQKLLYYIQGNYAAIYDKPLFDAPC 219

Query: 63  QAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTE 122
           +AW  GPV+  VY+ F+ F  +PI+    +  +        E  E+++ + + +  +S +
Sbjct: 220 EAWVHGPVYRNVYNLFRDFKYNPIDDDRFVPLKESALPLTPEAKEVVDRVLDTFGMYSGK 279

Query: 123 QLQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI----TKMADGSNISPEN 168
            L+ I  +E   W   RR + P++  ++  I+++ +     K+ +  NI  E+
Sbjct: 280 VLESITHKE-APWLDARRGFLPDET-SHAEISLDAMKAYFKKVDEKYNIRTED 330


>gi|168206179|ref|ZP_02632184.1| prophage ps3 protein 01 [Clostridium perfringens E str. JGS1987]
 gi|170662328|gb|EDT15011.1| prophage ps3 protein 01 [Clostridium perfringens E str. JGS1987]
          Length = 141

 Score =  137 bits (345), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           Y+   +A + +D  ++   P+ +LK+Q+ +Y      +++K +   +EE + W+ GPV  
Sbjct: 3   YNVKDIAAYIVDYSIENGCPVSNLKLQKILYYVQAYFLIKKNEPCFEEEIECWRHGPVVR 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            VY  +K + +  I ++ D       K   +    ++  + + Y+ +S  ++ +   +E+
Sbjct: 63  EVYSEYKKYFNDNIFMVEDY------KEIEERDCNLINQVVDSYRKYSPWEMVDKTHQED 116

Query: 133 KTW 135
             W
Sbjct: 117 -PW 118


>gi|283783645|ref|YP_003374399.1| hypothetical protein HMPREF0424_1204 [Gardnerella vaginalis 409-05]
 gi|283442150|gb|ADB14616.1| conserved domain protein [Gardnerella vaginalis 409-05]
          Length = 153

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 29/145 (20%), Positives = 63/145 (43%), Gaps = 9/145 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   VA++ +D        I  +K+Q+  Y +    +      + +E+ QAW+ GPV   
Sbjct: 3   TIFNVASYILDITG----TITTMKLQKLAYYSQAYSLAATGHPLFNEDFQAWRNGPVCPE 58

Query: 74  VYHRFK-YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
           ++   +  F     E+++  + ++           ++E +  K+  +S   L  +   E+
Sbjct: 59  LFALHRGKFLIRKGELVIPNTEKLQDNSLTDVQKILVEKVCEKFAGYSGSDLSAMTHSED 118

Query: 133 KTWRRLYDPNDPNTNRTITVEEITK 157
             W+  YD  +   +  I V++ITK
Sbjct: 119 -PWKNAYDATN---SSAICVQKITK 139


>gi|224477005|ref|YP_002634611.1| putative phage-associated protein [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222421612|emb|CAL28426.1| putative phage-associated protein [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 151

 Score =  136 bits (343), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 23/149 (15%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKK-------SMLDEEPQAWKQGP 69
            +  +F+ +       +   K+Q+ +Y      V    +        + D++ +AW  GP
Sbjct: 7   KIVEWFLSQ-----QSMSPKKLQKMLYYAQAWCVTLSNETSEEIENKLFDDKFEAWVHGP 61

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   VY  +K +  + I  I +           ++I +++  + + Y + +  QL+ I  
Sbjct: 62  VIPEVYQTYKKYGYNNIPKIDE------NIQLEEDIEDVLIQVMDVYGNFNGNQLENITH 115

Query: 130 EENKTW---RRLYDPNDPNTNRTITVEEI 155
           +E K W   R  Y P + N N  IT EE+
Sbjct: 116 QE-KPWIDARIGYSPLE-NCNEIITEEEM 142


>gi|84390146|ref|ZP_00991408.1| Uncharacterized phage-associated protein [Vibrio splendidus 12B01]
 gi|84376800|gb|EAP93675.1| Uncharacterized phage-associated protein [Vibrio splendidus 12B01]
          Length = 155

 Score =  136 bits (343), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 60/134 (44%), Gaps = 7/134 (5%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
            +    YS + V+   +    +      +L++++  Y+ H   +   ++ ++ ++  AW+
Sbjct: 1   MKIYHTYSAVDVSLSLLKHAYEQGKCFSNLQLEKLTYVCHGLSLAHFQRPLVIDDVFAWR 60

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQE 126
            GP+   VY RFK +  + I    D+       + + E   I++ + ++    +  QL E
Sbjct: 61  FGPLVPSVYFRFKSYGVNVITEQGDV-------VLDAESESIVKDVVSQLGHLTGPQLME 113

Query: 127 IVQEENKTWRRLYD 140
           +   +   W +++D
Sbjct: 114 LTHRDGSPWHQVWD 127


>gi|300772213|ref|ZP_07082083.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300760516|gb|EFK57342.1| conserved hypothetical protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 169

 Score =  136 bits (343), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 34/140 (24%), Positives = 59/140 (42%), Gaps = 11/140 (7%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   +A FF+ K       +  LK+Q+ +Y +    V +    +  +  +AW  GPV   
Sbjct: 7   TANDIAPFFVKK------KVSPLKLQKLLYYSQVWYVKKFDLKLFSDPIKAWVFGPVVPV 60

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           ++++FK      I   +   F   P I  Q + + +E IWN Y   S  +L ++   E  
Sbjct: 61  IWNKFKIVRRSDIIAPI-AHFYPCPTILPQNVLDHLEEIWNSYGHLSGSELVDLTHSEY- 118

Query: 134 TW---RRLYDPNDPNTNRTI 150
            W   R+      P+ N  I
Sbjct: 119 PWNASRKGLLDTQPSDNEII 138


>gi|59801484|ref|YP_208196.1| putative phage associated protein [Neisseria gonorrhoeae FA 1090]
 gi|194099446|ref|YP_002002558.1| putative phage associated protein [Neisseria gonorrhoeae NCCP11945]
 gi|239999683|ref|ZP_04719607.1| putative phage associated protein [Neisseria gonorrhoeae 35/02]
 gi|240014427|ref|ZP_04721340.1| putative phage associated protein [Neisseria gonorrhoeae DGI18]
 gi|240016861|ref|ZP_04723401.1| putative phage associated protein [Neisseria gonorrhoeae FA6140]
 gi|240081450|ref|ZP_04725993.1| putative phage associated protein [Neisseria gonorrhoeae FA19]
 gi|240113644|ref|ZP_04728134.1| putative phage associated protein [Neisseria gonorrhoeae MS11]
 gi|240116382|ref|ZP_04730444.1| putative phage associated protein [Neisseria gonorrhoeae PID18]
 gi|240117609|ref|ZP_04731671.1| putative phage associated protein [Neisseria gonorrhoeae PID1]
 gi|240120854|ref|ZP_04733816.1| putative phage associated protein [Neisseria gonorrhoeae PID24-1]
 gi|240123163|ref|ZP_04736119.1| putative phage associated protein [Neisseria gonorrhoeae PID332]
 gi|240126046|ref|ZP_04738932.1| putative phage associated protein [Neisseria gonorrhoeae SK-92-679]
 gi|240127869|ref|ZP_04740530.1| putative phage associated protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|260439788|ref|ZP_05793604.1| putative phage associated protein [Neisseria gonorrhoeae DGI2]
 gi|268599707|ref|ZP_06133874.1| phage-associated protein [Neisseria gonorrhoeae MS11]
 gi|268602049|ref|ZP_06136216.1| phage-associated protein [Neisseria gonorrhoeae PID18]
 gi|268603315|ref|ZP_06137482.1| phage-associated protein [Neisseria gonorrhoeae PID1]
 gi|268681791|ref|ZP_06148653.1| phage-associated protein [Neisseria gonorrhoeae PID332]
 gi|268684637|ref|ZP_06151499.1| phage-associated protein [Neisseria gonorrhoeae SK-92-679]
 gi|268686264|ref|ZP_06153126.1| phage-associated protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291043051|ref|ZP_06568781.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293399347|ref|ZP_06643512.1| phage associated protein [Neisseria gonorrhoeae F62]
 gi|59718379|gb|AAW89784.1| hypothetical protein, putative phage associated protein [Neisseria
           gonorrhoeae FA 1090]
 gi|193934736|gb|ACF30560.1| putative phage associated protein [Neisseria gonorrhoeae NCCP11945]
 gi|268583838|gb|EEZ48514.1| phage-associated protein [Neisseria gonorrhoeae MS11]
 gi|268586180|gb|EEZ50856.1| phage-associated protein [Neisseria gonorrhoeae PID18]
 gi|268587446|gb|EEZ52122.1| phage-associated protein [Neisseria gonorrhoeae PID1]
 gi|268622075|gb|EEZ54475.1| phage-associated protein [Neisseria gonorrhoeae PID332]
 gi|268624921|gb|EEZ57321.1| phage-associated protein [Neisseria gonorrhoeae SK-92-679]
 gi|268626548|gb|EEZ58948.1| phage-associated protein [Neisseria gonorrhoeae SK-93-1035]
 gi|291013026|gb|EFE05002.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291610761|gb|EFF39871.1| phage associated protein [Neisseria gonorrhoeae F62]
 gi|317164954|gb|ADV08495.1| putative phage associated protein [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 179

 Score =  136 bits (343), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 49/126 (38%), Gaps = 7/126 (5%)

Query: 14  STIAVANFFID-KGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +   VA+FF+     +    I +LK+Q+ +Y      +    + +  E  + W+ GPV  
Sbjct: 3   NAYDVADFFLSPFEEEDGEQISNLKLQKLLYYAQGYALAILNRPLFAENIEHWQHGPVVP 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +Y  +K +   P+         I P     E   ++  +  +   ++   L+    +E 
Sbjct: 63  CIYRTYKKYGGSPLPAA-----HIEPDKYADEELVVLNRVRKEQGCYTAWALRNKTHQE- 116

Query: 133 KTWRRL 138
             W + 
Sbjct: 117 APWIQT 122


>gi|217977601|ref|YP_002361748.1| hypothetical protein Msil_1421 [Methylocella silvestris BL2]
 gi|217502977|gb|ACK50386.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 188

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 57/147 (38%), Gaps = 9/147 (6%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSI---PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQA 64
              PPY   AVAN  ++   K      PI +L +Q+ +Y  H   +++    ++    +A
Sbjct: 1   MIKPPYDPRAVANLLLELAAKEEEGPMPISNLALQKLLYFAHGHFLIRTGVPLVQGAFEA 60

Query: 65  WKQGPVFVGVYHRFKYFDSHPI------EVIMDLSFRIFPKIANQEIGEIMESIWNKYQS 118
           WK GPV   VY  FK     PI         M  +        ++++   ++ +   Y  
Sbjct: 61  WKYGPVHPAVYQAFKGEADQPIRTRATGRNPMTGAVYALEIPDDRQVRRHLKEVLRAYGH 120

Query: 119 HSTEQLQEIVQEENKTWRRLYDPNDPN 145
            S  +L +I       W  + +    +
Sbjct: 121 LSPGRLVDIAHAAKGPWATVVNKAKTS 147


>gi|33152650|ref|NP_874003.1| prophage ps3 protein01-like protein [Haemophilus ducreyi 35000HP]
 gi|33148874|gb|AAP96392.1| possible prophage ps3 protein01-like protein [Haemophilus ducreyi
           35000HP]
          Length = 132

 Score =  136 bits (342), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 26/114 (22%), Positives = 51/114 (44%), Gaps = 5/114 (4%)

Query: 20  NFFIDKGV--KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR 77
           N+F+ +    +    I +LKIQ+ +Y      +    K +  E+ QAW  GPV   +Y++
Sbjct: 16  NYFLSQCNSEENGDLISNLKIQKLVYYAQGFSLAINNKPLFSEKIQAWTHGPVTPELYNK 75

Query: 78  FKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
           +K + +  +         I     + E  +++  I + Y   S  +L+ +  EE
Sbjct: 76  YKQYGNGALPTT---DLDIDFDKFSNEEKDLLNDINDVYGQFSAWKLRNMTHEE 126


>gi|256851109|ref|ZP_05556498.1| phage associated protein [Lactobacillus jensenii 27-2-CHN]
 gi|260660533|ref|ZP_05861448.1| phage associated protein [Lactobacillus jensenii 115-3-CHN]
 gi|256616171|gb|EEU21359.1| phage associated protein [Lactobacillus jensenii 27-2-CHN]
 gi|260548255|gb|EEX24230.1| phage associated protein [Lactobacillus jensenii 115-3-CHN]
          Length = 275

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 56/136 (41%), Gaps = 7/136 (5%)

Query: 8   QTNPPYSTIAVANFFI------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
           +  P Y+ + +AN+ +       +  K   P+  +K+ + +Y  +   +   K  +    
Sbjct: 117 KIKPKYTAVQLANWLLVENYFERECNKNIDPLSQMKVIKLLYFAYGRYLASTKNKLFSSP 176

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIMESIWNKYQSHS 120
               + GPV   V+ +FK       E I   +   +  +  ++EI E++ ++  KY  ++
Sbjct: 177 IIHLQYGPVVTEVHEKFKGQTVLNDEKIEKGAIEDYNTVSQDEEISELLHAVNQKYIDYT 236

Query: 121 TEQLQEIVQEENKTWR 136
              L +I   +   W 
Sbjct: 237 AAGLSKITHRKGSPWS 252


>gi|119512866|ref|ZP_01631932.1| Putative prophage protein (ps3) [Nodularia spumigena CCY9414]
 gi|119462494|gb|EAW43465.1| Putative prophage protein (ps3) [Nodularia spumigena CCY9414]
          Length = 195

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 66/151 (43%), Gaps = 9/151 (5%)

Query: 13  YSTIAVANFFIDKGVKYSIP--IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
            + +  A +FI +  +  I   + ++K+Q+ +Y +    +    + + DEE QAW+ GPV
Sbjct: 2   INCLDAARYFIARAYEDGIEAEMTNMKVQKLLYYSQSLYLAVYDQPLFDEEIQAWRYGPV 61

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
               Y  +  F++      + +  +       Q    ++E IW  +  +   +L ++   
Sbjct: 62  CPPAYRFYSEFEAQ----QLPIPSQELLLQIPQNEKRLLEEIWGYFGGYHAYRLSDMTHL 117

Query: 131 ENKTWRRLYDPNDPNTNRT--ITVEEITKMA 159
           E   W++      PN + T  I +E++  + 
Sbjct: 118 EF-PWKKARQGLPPNASSTEPILLEDMKALG 147


>gi|189183561|ref|YP_001937346.1| hypothetical protein OTT_0654 [Orientia tsutsugamushi str. Ikeda]
 gi|189180332|dbj|BAG40112.1| hypothetical protein OTT_0654 [Orientia tsutsugamushi str. Ikeda]
          Length = 197

 Score =  135 bits (341), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 33/145 (22%), Positives = 65/145 (44%), Gaps = 10/145 (6%)

Query: 14  STIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           S   VA++F+     +    I  LK+Q+ +Y      +    K +  E+ +AW+ GPV  
Sbjct: 11  SCFDVASYFLVLVDREAGDVITQLKLQKLVYFAQGVHLALFDKHLFKEDIEAWENGPVVR 70

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +   F  F+++ I     + F I+      +  E++  I++ Y  H+   L+++    +
Sbjct: 71  HLRSIFGGFEANAIPAPGQIDFSIY----TNQQKELIYKIYSSYGEHTASYLRDLTHLHS 126

Query: 133 KTWRRLYDPNDPNTNRTITVEEITK 157
              + +  P+     R IT EE+ K
Sbjct: 127 ILQQAIIRPS-----RVITKEEMRK 146


>gi|288958028|ref|YP_003448369.1| hypothetical protein AZL_011870 [Azospirillum sp. B510]
 gi|288910336|dbj|BAI71825.1| hypothetical protein AZL_011870 [Azospirillum sp. B510]
          Length = 172

 Score =  135 bits (341), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 60/134 (44%), Gaps = 6/134 (4%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
           AVANF +D        + +L +Q+ +Y  H   ++   + ++  + +AW+ GPV   +Y 
Sbjct: 13  AVANFVLDFCEARGRKVTNLALQKIVYFCHVWSLIMLDRPLVKHQFEAWQYGPVLQYLYR 72

Query: 77  RFKYFDSHPIE------VIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
           +FK FD  PIE           + R+     + +   +++ I + Y   S   L E+   
Sbjct: 73  QFKAFDRRPIEGRATEIDPATGANRVVTYRFDDDTEHMLQEIVDFYSRISAGDLVELSHA 132

Query: 131 ENKTWRRLYDPNDP 144
               W ++++  + 
Sbjct: 133 AGSPWDQVWNHKES 146


>gi|282933766|ref|ZP_06339121.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
 gi|297205974|ref|ZP_06923369.1| XRE family transcriptional regulator [Lactobacillus jensenii
           JV-V16]
 gi|281302145|gb|EFA94392.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
 gi|297149100|gb|EFH29398.1| XRE family transcriptional regulator [Lactobacillus jensenii
           JV-V16]
          Length = 307

 Score =  135 bits (341), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 56/136 (41%), Gaps = 7/136 (5%)

Query: 8   QTNPPYSTIAVANFFI------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
           +  P Y+ + +AN+ +       +  K   P+  +K+ + +Y  +   +   K  +    
Sbjct: 149 KIKPKYTAVQLANWLLVENYFERECNKNIDPLSQMKVIKLLYFAYGRYLASTKNKLFSSP 208

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIMESIWNKYQSHS 120
               + GPV   V+ +FK       E I   +   +  +  ++EI E++ ++  KY  ++
Sbjct: 209 IIHLQYGPVVTEVHEKFKGQTVLNDEKIEKGAIEDYNTVSQDEEISELLHAVNQKYIDYT 268

Query: 121 TEQLQEIVQEENKTWR 136
              L +I   +   W 
Sbjct: 269 AAGLSKITHRKGSPWS 284


>gi|294671001|ref|ZP_06735857.1| hypothetical protein NEIELOOT_02708 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307488|gb|EFE48731.1| hypothetical protein NEIELOOT_02708 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 116

 Score =  135 bits (339), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 50/118 (42%), Gaps = 5/118 (4%)

Query: 14  STIAVANFFIDKGVK-YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +   VA + +    +     I +LK+Q+  Y +         K + +E  +AW  GPV  
Sbjct: 3   TAKDVAQYLLKLDEQHGGEGISNLKLQKLAYYSQGFFGAIYDKPLFNERVEAWTHGPVIP 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
            +YH +K   S+ I      +        ++E  E++  +++ +   S  +L+ +  E
Sbjct: 63  DLYHEYKCHGSNLIPSSGIPNE----TSLSKEEAELISEVYDVFGQFSAWKLRNMTHE 116


>gi|298252891|ref|ZP_06976685.1| uncharacterized phage-associated protein [Gardnerella vaginalis
           5-1]
 gi|297533255|gb|EFH72139.1| uncharacterized phage-associated protein [Gardnerella vaginalis
           5-1]
          Length = 147

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 59/140 (42%), Gaps = 9/140 (6%)

Query: 19  ANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF 78
           A++ +D        I  +K+Q+  Y +    +      + +E+ QAW+ GPV   ++   
Sbjct: 2   ASYILDIAG----TITTMKLQKLAYYSQAYSLATTGYPLFNEDFQAWRNGPVCPELFALH 57

Query: 79  K-YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
           +  F     E ++  + ++           ++E +  K+   S   L  +   E+  W+ 
Sbjct: 58  RGKFLIRKGEFVLPSTDKLNDDSLTDGQKLLVEKVCKKFAECSGSDLSAMTHRED-PWKN 116

Query: 138 LYDPNDPNTNRTITVEEITK 157
            YD  +   +  I V++ITK
Sbjct: 117 AYDATN---SSAICVQKITK 133


>gi|260664472|ref|ZP_05865324.1| phage associated protein [Lactobacillus jensenii SJ-7A-US]
 gi|313472083|ref|ZP_07812575.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 1153]
 gi|239530114|gb|EEQ69115.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 1153]
 gi|260561537|gb|EEX27509.1| phage associated protein [Lactobacillus jensenii SJ-7A-US]
          Length = 275

 Score =  134 bits (338), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 55/136 (40%), Gaps = 7/136 (5%)

Query: 8   QTNPPYSTIAVANFFI------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
           +  P Y+ + +AN+ +       +  K   P+  +K+ + +Y  +   +   K  +    
Sbjct: 117 KIKPKYTAVQLANWLLVENYFERECNKNIDPLSQMKVIKLLYFAYGRYLASTKNKLFSSP 176

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIMESIWNKYQSHS 120
               + GPV   V+ +FK       E I   +   +  +  + EI E++ ++  KY  ++
Sbjct: 177 IIHLQYGPVVTEVHEKFKGQTVLNDEKIEKGAIEDYNTVSQDGEISELLHAVNQKYIDYT 236

Query: 121 TEQLQEIVQEENKTWR 136
              L +I   +   W 
Sbjct: 237 AAGLSKITHRKGSPWS 252


>gi|254712605|ref|ZP_05174416.1| hypothetical protein BcetM6_04357 [Brucella ceti M644/93/1]
 gi|254715677|ref|ZP_05177488.1| hypothetical protein BcetM_04377 [Brucella ceti M13/05/1]
 gi|261217425|ref|ZP_05931706.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261320299|ref|ZP_05959496.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260922514|gb|EEX89082.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261292989|gb|EEX96485.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 185

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           PY   A+AN  +D+  +  I + +L +Q+ +Y  H   +++ K  ++    +AW+ GPV 
Sbjct: 7   PYDPRAIANLMLDEADRSGIQVTNLALQKLLYFAHSIFLIETKHPLVSGYFEAWQYGPVH 66

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPK------IANQEIGEIMESIWNKYQSHSTEQLQ 125
              Y  FK   S+PI+        +  +        +  +   +  I + Y   S  +L 
Sbjct: 67  PAAYSAFKTAGSYPIDFRATGQNVMTGEQAALELPEDLTVRRHLARIMSSYGQLSPGRLV 126

Query: 126 EIVQEENKTWRRLYD 140
           +I   +   W  + D
Sbjct: 127 DISHAKGAPWDFIVD 141


>gi|62317337|ref|YP_223190.1| hypothetical protein BruAb2_0400 [Brucella abortus bv. 1 str.
           9-941]
 gi|225629298|ref|ZP_03787331.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237816891|ref|ZP_04595883.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254690835|ref|ZP_05154089.1| hypothetical protein Babob68_11893 [Brucella abortus bv. 6 str.
           870]
 gi|254695855|ref|ZP_05157683.1| hypothetical protein Babob3T_14760 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698617|ref|ZP_05160445.1| hypothetical protein Babob28_13199 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700044|ref|ZP_05161872.1| hypothetical protein Bsuib55_04177 [Brucella suis bv. 5 str. 513]
 gi|254703164|ref|ZP_05164992.1| hypothetical protein Bsuib36_04362 [Brucella suis bv. 3 str. 686]
 gi|254705690|ref|ZP_05167518.1| hypothetical protein BpinM_01443 [Brucella pinnipedialis
           M163/99/10]
 gi|254710922|ref|ZP_05172733.1| hypothetical protein BpinB_11810 [Brucella pinnipedialis B2/94]
 gi|254732064|ref|ZP_05190642.1| hypothetical protein Babob42_12999 [Brucella abortus bv. 4 str.
           292]
 gi|256015595|ref|YP_003105604.1| putative phage-associated protein [Brucella microti CCM 4915]
 gi|256029304|ref|ZP_05442918.1| hypothetical protein BpinM2_01368 [Brucella pinnipedialis
           M292/94/1]
 gi|256043706|ref|ZP_05446629.1| hypothetical protein Bmelb1R_04397 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256058993|ref|ZP_05449204.1| hypothetical protein Bneo5_01358 [Brucella neotomae 5K33]
 gi|256111251|ref|ZP_05452282.1| hypothetical protein Bmelb3E_01433 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256157499|ref|ZP_05455417.1| hypothetical protein BcetM4_01398 [Brucella ceti M490/95/1]
 gi|256253523|ref|ZP_05459059.1| hypothetical protein BcetB_04342 [Brucella ceti B1/94]
 gi|256256019|ref|ZP_05461555.1| hypothetical protein Babob9C_01348 [Brucella abortus bv. 9 str.
           C68]
 gi|256262266|ref|ZP_05464798.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260167604|ref|ZP_05754415.1| putative phage-associated protein [Brucella sp. F5/99]
 gi|260544571|ref|ZP_05820392.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260564894|ref|ZP_05835379.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567907|ref|ZP_05838376.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260756415|ref|ZP_05868763.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260759847|ref|ZP_05872195.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260763086|ref|ZP_05875418.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260882237|ref|ZP_05893851.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261220653|ref|ZP_05934934.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261313110|ref|ZP_05952307.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261318504|ref|ZP_05957701.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261322937|ref|ZP_05962134.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261750526|ref|ZP_05994235.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261753784|ref|ZP_05997493.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261757026|ref|ZP_06000735.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265986303|ref|ZP_06098860.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265990127|ref|ZP_06102684.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265992763|ref|ZP_06105320.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265995997|ref|ZP_06108554.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|62197530|gb|AAX75829.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|225615794|gb|EEH12843.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|237787704|gb|EEP61920.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|255998255|gb|ACU49942.1| putative phage-associated protein [Brucella microti CCM 4915]
 gi|260097842|gb|EEW81716.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260152537|gb|EEW87630.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260154572|gb|EEW89653.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260670165|gb|EEX57105.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260673507|gb|EEX60328.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676523|gb|EEX63344.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260871765|gb|EEX78834.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260919237|gb|EEX85890.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261297727|gb|EEY01224.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261298917|gb|EEY02414.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261302136|gb|EEY05633.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261737010|gb|EEY25006.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261740279|gb|EEY28205.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261743537|gb|EEY31463.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262550294|gb|EEZ06455.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262763633|gb|EEZ09665.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000796|gb|EEZ13486.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263091983|gb|EEZ16289.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264658500|gb|EEZ28761.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 185

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           PY   A+AN  +D+  +  I + +L +Q+ +Y  H   +++ K  ++    +AW+ GPV 
Sbjct: 7   PYDPRAIANLMLDEADRSGIQVTNLALQKLLYFAHSIFLIETKHPLVSGYFEAWQYGPVH 66

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPK------IANQEIGEIMESIWNKYQSHSTEQLQ 125
              Y  FK   S+PI+        +  +        +  +   +  I + Y   S  +L 
Sbjct: 67  PAAYSAFKTAGSYPIDFRATGQNVMTGEQAALELPEDLTVRRHLARIMSSYGQLSPGRLV 126

Query: 126 EIVQEENKTWRRLYD 140
           +I   +   W  + D
Sbjct: 127 DISHAKGAPWDFIVD 141


>gi|17988803|ref|NP_541436.1| hypothetical protein BMEII0458 [Brucella melitensis bv. 1 str. 16M]
 gi|261216275|ref|ZP_05930556.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297249377|ref|ZP_06933078.1| hypothetical protein BAYG_02125 [Brucella abortus bv. 5 str. B3196]
 gi|17984622|gb|AAL53700.1| hypothetical protein BMEII0458 [Brucella melitensis bv. 1 str. 16M]
 gi|260917882|gb|EEX84743.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|297173246|gb|EFH32610.1| hypothetical protein BAYG_02125 [Brucella abortus bv. 5 str. B3196]
          Length = 183

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 6/135 (4%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           PY   A+AN  +D+  +  I + +L +Q+ +Y  H   +++ K  ++    +AW+ GPV 
Sbjct: 5   PYDPRAIANLMLDEADRSGIQVTNLALQKLLYFAHSIFLIETKHPLVSGYFEAWQYGPVH 64

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPK------IANQEIGEIMESIWNKYQSHSTEQLQ 125
              Y  FK   S+PI+        +  +        +  +   +  I + Y   S  +L 
Sbjct: 65  PAAYSAFKTAGSYPIDFRATGQNVMTGEQAALELPEDLTVRRHLARIMSSYGQLSPGRLV 124

Query: 126 EIVQEENKTWRRLYD 140
           +I   +   W  + D
Sbjct: 125 DISHAKGAPWDFIVD 139


>gi|227501664|ref|ZP_03931713.1| possible phage-associated protein [Corynebacterium accolens ATCC
           49725]
 gi|227077689|gb|EEI15652.1| possible phage-associated protein [Corynebacterium accolens ATCC
           49725]
          Length = 149

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 54/137 (39%), Gaps = 4/137 (2%)

Query: 11  PPYSTIAVANFFIDKGVKYSI-PIDHLKIQQFIYLTHCDVV-LQKKKSMLDEEPQAWKQG 68
             ++   +A + +    +     +  LKIQ+ +Y      +       + +E  +AW  G
Sbjct: 2   KQFTARQIAEWLVAWAEETEEADLTPLKIQKLLYYAKGLYMRASGGVPLFNERMEAWAHG 61

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV V +YH  K +   PI+         F     + + + +  +WNKY  +S   L+   
Sbjct: 62  PVVVDIYHELKKYGKSPID-PDTFISDDFNWDDYRPVEDTLIEVWNKYGPYSAWALRNKT 120

Query: 129 QEENKTWRRLYDPNDPN 145
             E   W++ +   +  
Sbjct: 121 HTE-SPWKKNFVEEERG 136


>gi|229817872|ref|ZP_04448154.1| hypothetical protein BIFANG_03158 [Bifidobacterium angulatum DSM
           20098]
 gi|229784772|gb|EEP20886.1| hypothetical protein BIFANG_03158 [Bifidobacterium angulatum DSM
           20098]
          Length = 168

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 63/156 (40%), Gaps = 11/156 (7%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
           +I VAN FI +     I I +L + + +Y    + + +  K + +++ +AW  GPV   V
Sbjct: 3   SIQVANAFILRHGSD-IDITNLVLNKLVYFAQVESLRETGKPLFEDKIEAWPYGPVEKNV 61

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y  F+ +  + I               ++    +++    KY   +   L      +N  
Sbjct: 62  YFAFQKYGRNRIPKPEGE------VTKDERTLSVVDRTARKYGFLTAFDLVGFSHRKNSA 115

Query: 135 WRRLYDPNDPNTNRTITVEEITKMADGSNISPENVV 170
           W+ +Y       N  IT + I    DG    P+N +
Sbjct: 116 WKNVY---REGENVEITNDAILASDDGLTF-PKNTL 147


>gi|238855034|ref|ZP_04645363.1| phage associated protein [Lactobacillus jensenii 269-3]
 gi|282934074|ref|ZP_06339354.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
 gi|238832405|gb|EEQ24713.1| phage associated protein [Lactobacillus jensenii 269-3]
 gi|281301876|gb|EFA94140.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
          Length = 307

 Score =  134 bits (337), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 55/136 (40%), Gaps = 7/136 (5%)

Query: 8   QTNPPYSTIAVANFFI------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
           +  P Y+ + +AN+ +       +  K   P+  +K+ + +Y  +   +   K  +    
Sbjct: 149 KIKPKYTAVQLANWLLVENYFERECNKNIDPLSQMKVIKLLYFAYGRYLASTKNKLFSSP 208

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIMESIWNKYQSHS 120
               + GPV   V+ +FK       E I   +   +  +  + EI E++ ++  KY  ++
Sbjct: 209 IIHLQYGPVVTEVHEKFKGQTVLNDEKIEKGAIEDYNTVSQDGEISELLHAVNQKYIDYT 268

Query: 121 TEQLQEIVQEENKTWR 136
              L +I   +   W 
Sbjct: 269 AAGLSKITHRKGSPWS 284


>gi|283769251|ref|ZP_06342155.1| toxin-antitoxin system, antitoxin component, Xre domain protein
           [Bulleidia extructa W1219]
 gi|283104227|gb|EFC05606.1| toxin-antitoxin system, antitoxin component, Xre domain protein
           [Bulleidia extructa W1219]
          Length = 151

 Score =  133 bits (336), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 53/147 (36%), Gaps = 11/147 (7%)

Query: 8   QTNPPYSTIAVANFFIDK-----GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEP 62
                Y    VA +F++          +  I +LK+Q+ +Y      +    + + +E  
Sbjct: 1   MEKKGYKANYVAKWFLNYNRLIMSESDADLISNLKLQKLLYYAQGCFLACFDRPLFNEPI 60

Query: 63  QAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTE 122
            AW+ GPV   VY  +K   ++ I    D       +  +         ++N +  +S  
Sbjct: 61  VAWEHGPVVESVYQEYKVNRANGIVFDEDFINEFDDEEESLLEE-----VYNTFAKYSAW 115

Query: 123 QLQEIVQEENKTWRRLYDPNDPNTNRT 149
            L+ +  +E   W       + + N  
Sbjct: 116 GLRNMTHQE-TPWINTQQSGEISQNSI 141


>gi|331003171|ref|ZP_08326679.1| hypothetical protein HMPREF0491_01541 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330412927|gb|EGG92306.1| hypothetical protein HMPREF0491_01541 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 335

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 30/138 (21%), Positives = 57/138 (41%), Gaps = 5/138 (3%)

Query: 23  IDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFD 82
           I    +    I  L +Q+ +Y           + + +E+ +AW  GPV+  VY  F+ F 
Sbjct: 171 IAYIFEKLEEITPLMLQKLLYFIQGVYSALYGRPIFEEDCRAWVHGPVYPEVYELFRDFK 230

Query: 83  SHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW---RRLY 139
            +PIE                    ++E + N +  +  + L++I   E + W   R+ Y
Sbjct: 231 YNPIEDARFALLNGTKDALTDNEKRVIELVVNTFGMYGGKVLEKITHNE-EPWIEARKGY 289

Query: 140 DPNDPNTNRTITVEEITK 157
             + P +N  ++ E I +
Sbjct: 290 GDSIP-SNEILSKERIMQ 306


>gi|306817761|ref|ZP_07451502.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239]
 gi|304649410|gb|EFM46694.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239]
          Length = 208

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 57/134 (42%), Gaps = 5/134 (3%)

Query: 14  STIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
              AVA + +    +   P +  LK+ + +YL   + +    + ++D + +A++ GPV  
Sbjct: 28  DPQAVAEYILMLDSRREDPDVTQLKLHKLLYLAQANYLASTGRRLMDSDVEAFRHGPVID 87

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +   +K +D   I      S +        +  + +  IW  YQ +S   L+ +   ++
Sbjct: 88  AIRSTYKPYDRDIIVNRHKPSKK---TTLPPDAADFLNRIWEMYQDNSASYLRNLTHRQD 144

Query: 133 KTWRRLYDPNDPNT 146
             WR  Y   + +T
Sbjct: 145 -PWRDNYVEGESHT 157


>gi|225351691|ref|ZP_03742714.1| hypothetical protein BIFPSEUDO_03288 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225158035|gb|EEG71318.1| hypothetical protein BIFPSEUDO_03288 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 168

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 66/156 (42%), Gaps = 11/156 (7%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
           +I VAN FI +     I I +L + + +Y    + +    K + +++ +AW  GPV   V
Sbjct: 3   SIQVANAFILRHGSD-IDITNLVLNKLVYFAQVESLRATGKPLFEDKIEAWPYGPVERNV 61

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y  F+ +  + I      + +      +++   +++    KY   +   L      +N  
Sbjct: 62  YFTFQKYGRNRILKPEGETAK------DEQALSVVDGTAKKYGFLTAFDLVRFSHRKNSA 115

Query: 135 WRRLYDPNDPNTNRTITVEEITKMADGSNISPENVV 170
           W+ +Y   +   N  IT + I    DG    P+N +
Sbjct: 116 WKNVYREEE---NVEITNDAILASDDGLTF-PKNTL 147


>gi|291520067|emb|CBK75288.1| Uncharacterized phage-associated protein [Butyrivibrio fibrisolvens
           16/4]
          Length = 140

 Score =  133 bits (335), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 63/135 (46%), Gaps = 7/135 (5%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           YS + ++ + + + +K   PI +L +Q+ +Y    D + +K      +  +AW+ GPV  
Sbjct: 2   YSAVDLSKYVVSRCIKKENPISNLHLQKILYYIQKDFLCKKGDIAFPDTIEAWQFGPVVP 61

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            VY+ F  + + PI    D+S        +++   I+++I ++       +L     + N
Sbjct: 62  IVYYYFCAYGAMPITDYYDVSI-------DEDDSFIIDTIIDEKCIKDPWELVAETHKPN 114

Query: 133 KTWRRLYDPNDPNTN 147
             W ++Y   + N N
Sbjct: 115 GAWDQVYKNGNGNHN 129


>gi|262381010|ref|ZP_06074148.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|262296187|gb|EEY84117.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
          Length = 169

 Score =  133 bits (334), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 77/151 (50%), Gaps = 17/151 (11%)

Query: 14  STIAVANFFIDKGVKYSIP--IDHLKIQQFIYLTHCDVVLQKKKSMLDEEP---QAWKQG 68
             IA+AN+FIDK  +   P  +  L++ +++Y+ +   +    +S+L+E     +AW+ G
Sbjct: 4   DAIAIANYFIDKAKETYPPYELTLLRLVKYVYIAYGFGLALLDRSILNERFDKVEAWRYG 63

Query: 69  PVFVGVYHRFKYFDSHPIEVI------MDLSFRIF---PKIANQEIGEIMESIWNKYQSH 119
           PV   VYH FK+  + PI          D +  ++   PK+ ++ I  I++ +W++Y+  
Sbjct: 64  PVIPSVYHSFKHNQNRPITDKSSILSYEDDNGNLYFDVPKVKDEGIIMILDFVWDRYKDK 123

Query: 120 STEQLQEIVQEENKTWRRLYDPNDPNTNRTI 150
           S   L EI+ ++   W+  Y      +N  I
Sbjct: 124 SVHDLIEILHKDGTPWKFCY---KEGSNVEI 151


>gi|167648674|ref|YP_001686337.1| hypothetical protein Caul_4719 [Caulobacter sp. K31]
 gi|167351104|gb|ABZ73839.1| uncharacterized phage-associated protein-like protein [Caulobacter
           sp. K31]
          Length = 166

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 58/156 (37%), Gaps = 17/156 (10%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           Y  + +AN F+         +  + +Q+  Y+ H        + ++ ++ +AW  GPV  
Sbjct: 3   YRAVEIANEFLRLPGAADR-LTQMHLQKLTYIAHGWNWAINNEPLIADDIEAWSFGPVVR 61

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRI-------------FPKIANQEIGEIMESIWNKYQSH 119
            +Y   K+F + PI  ++                   +         +++E +W +Y   
Sbjct: 62  DLYEHTKFFGTQPIGRLISPDDSQVARFFGKTGDAAPYRADLTDRERQVIEQVWARYSGL 121

Query: 120 STEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
           +  +L E+  +    W + +       N  I  + I
Sbjct: 122 NAIRLSELTHQPGTPWFQAF---QRGRNTRIDEDAI 154


>gi|294783258|ref|ZP_06748582.1| phage-associated protein [Fusobacterium sp. 1_1_41FAA]
 gi|294480136|gb|EFG27913.1| phage-associated protein [Fusobacterium sp. 1_1_41FAA]
          Length = 152

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 32/146 (21%), Positives = 64/146 (43%), Gaps = 4/146 (2%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
            Y  + +A + I    K  + I +L++Q+ ++    + + ++   +     +AW+ GPV 
Sbjct: 3   KYDALDIAKYIIRWCDKNKLRITNLQLQKILFFIQKESIRKRGYGIFSNRIEAWQYGPVV 62

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPK-IANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
             V+++F  F +  + +  DL   + PK I + +  EI+E I  +Y   S   L      
Sbjct: 63  PDVFYQFAGFGAMKLVLYEDLFSDVSPKDIIDDQSKEIIEGILREYIHVSPWDLVAKSHV 122

Query: 131 ENKTWRRLYDPNDPNTNRTITVEEIT 156
            N  W       +      IT ++I+
Sbjct: 123 SNGAWANSISMGEKYP---ITDQDIS 145


>gi|269977797|ref|ZP_06184754.1| putative phage-associated protein [Mobiluncus mulieris 28-1]
 gi|269933967|gb|EEZ90544.1| putative phage-associated protein [Mobiluncus mulieris 28-1]
          Length = 201

 Score =  133 bits (334), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 56/134 (41%), Gaps = 5/134 (3%)

Query: 14  STIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
              AVA + +    +   P +  LK+ + +YL   + +    + ++D + +A++ GPV  
Sbjct: 21  DPQAVAEYILMLDSRREDPDVTQLKLHKLLYLAQANYLASTGRRLMDSDVEAFRHGPVID 80

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            +   +K +D   I      S +        +  + +  IW  YQ +S   L+ +   ++
Sbjct: 81  AIRSTYKPYDRDIIVNRRKPSKK---TTLPPDAADFLNRIWEMYQDNSASYLRNLTHRQD 137

Query: 133 KTWRRLYDPNDPNT 146
             WR  Y     +T
Sbjct: 138 -PWRDNYVEGKSHT 150


>gi|212716276|ref|ZP_03324404.1| hypothetical protein BIFCAT_01192 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660788|gb|EEB21363.1| hypothetical protein BIFCAT_01192 [Bifidobacterium catenulatum DSM
           16992]
          Length = 168

 Score =  132 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 65/156 (41%), Gaps = 11/156 (7%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
           +I VAN FI +     I I +L + + +Y    + +    K + +++ +AW  GPV   V
Sbjct: 3   SIQVANAFILRHGSD-IDITNLVLNKLVYFAQVESLRATGKPLFEDKIEAWPYGPVERNV 61

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y  F+ +  + I      + +      +++   +++    KY   +   L      +N  
Sbjct: 62  YFTFQKYGRNRILKPEGETAK------DEQALSVVDGTAKKYGFLTAFDLVGFSHRKNSA 115

Query: 135 WRRLYDPNDPNTNRTITVEEITKMADGSNISPENVV 170
           W+ +Y       N  IT + I    DG    P+N +
Sbjct: 116 WKNVY---REGENVEITNDAILASDDGLTF-PKNTL 147


>gi|167461417|ref|ZP_02326506.1| putative phage-associated protein [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322383513|ref|ZP_08057287.1| hypothetical protein PL1_1439 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321152200|gb|EFX45032.1| hypothetical protein PL1_1439 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 249

 Score =  132 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 40/163 (24%), Positives = 72/163 (44%), Gaps = 22/163 (13%)

Query: 9   TNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQG 68
            +       VA F +      ++ + HLK+Q+ +Y  + D +L   K +  E   A++ G
Sbjct: 89  EDQELKAYDVAKFIVS-----TVQVSHLKLQKLLYYVYADFLLATGKKLFKEPIVAFEYG 143

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFP----------KIANQEIG----EIMESIWN 114
           PV   V+H++K   S  I+   D  F I+           ++A+ E G      +  + +
Sbjct: 144 PVVEEVFHKYKVHGSSEIDYKEDEYFCIYTDEFAVTPSFMRVASSEHGIYAVGFILKVLD 203

Query: 115 KYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITK 157
           KY+S+S  +L +   +    W+R+Y       N  IT E I +
Sbjct: 204 KYESYSAGELVKKTHQVGGPWKRVYV---KGMNYEITDELIKR 243


>gi|253682420|ref|ZP_04863217.1| conserved hypothetical protein [Clostridium botulinum D str. 1873]
 gi|253562132|gb|EES91584.1| conserved hypothetical protein [Clostridium botulinum D str. 1873]
          Length = 335

 Score =  132 bits (333), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 36/156 (23%), Positives = 68/156 (43%), Gaps = 12/156 (7%)

Query: 2   KKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
            +R FT  N      +V  + + K     + I  L +Q+ +Y       +   + + + +
Sbjct: 156 DQRAFTIENEE-KIDSVVKYILYKC----VDITPLALQKLLYYCQGFYKVFNGEYLFNND 210

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHST 121
            +AW  GPV+  +YH +K +  +PIE  ++ +         +   EI+++I      +S 
Sbjct: 211 CEAWVHGPVYKSIYHEYKNYGYNPIEENIEFN----HGELTEIEREIIDNIIINLGCYSG 266

Query: 122 EQLQEIVQEENKTWRRLYDPNDPN--TNRTITVEEI 155
           + L++I   E   WR      D N  ++R I  E I
Sbjct: 267 KILEKITHSE-MPWRTTRKGLDANELSDRIINKELI 301


>gi|300864696|ref|ZP_07109552.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300337302|emb|CBN54700.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 210

 Score =  132 bits (333), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 37/155 (23%), Positives = 70/155 (45%), Gaps = 11/155 (7%)

Query: 7   TQTNP-PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAW 65
           TQTN    + + +AN+FI    K    I+  K+Q+ +Y      +   +  + DE+ QAW
Sbjct: 51  TQTNSEKLTCVDIANYFIWLASKTDREINVYKLQKLVYYAQAWHLGVYETLLFDEDFQAW 110

Query: 66  KQGPVFVGVYHRFK-YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQL 124
             GPV   +  +++  F+  PI   ++          +++I E +E +   Y  +  E L
Sbjct: 111 IHGPVIPDLLEKYQYQFNWEPIVEKIEKPK------LSEQIEEFIEEVAEAYFEYDDETL 164

Query: 125 QEIVQEENKTWRRLY--DPNDPNTNRTITVEEITK 157
           + ++  E K W       P + + +  I+ E + K
Sbjct: 165 ERMICSE-KPWLEARGDLPREESCHAIISQESMKK 198


>gi|258513790|ref|YP_003190012.1| phage-associated protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257777495|gb|ACV61389.1| Putative phage-associated protein [Desulfotomaculum acetoxidans DSM
           771]
          Length = 334

 Score =  132 bits (332), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 33/150 (22%), Positives = 59/150 (39%), Gaps = 11/150 (7%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
           Q N       V  + + +       I  L +Q+ +Y             +  E+ +AW  
Sbjct: 161 QKNETSKVDKVIGYLLFRC----EDITPLALQKALYYIQGFYYAFMDSFLFTEDCEAWVH 216

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           GPV+  +Y+R+  +   PIE   +    +F          +++SI   +  +S + L+  
Sbjct: 217 GPVYREIYNRYSSYRFDPIESNDEFDVSVF----TDAEKAVIDSIIQNFCCYSGKILERF 272

Query: 128 VQEENKTW--RRLYDPNDPNTNRTITVEEI 155
              E   W   R   P D ++NR I+ E I
Sbjct: 273 THSE-MPWIKTRGNLPADTHSNRKISKEII 301


>gi|293557209|ref|ZP_06675758.1| hypothetical protein EfmE1039_2500 [Enterococcus faecium E1039]
 gi|291600632|gb|EFF30935.1| hypothetical protein EfmE1039_2500 [Enterococcus faecium E1039]
          Length = 158

 Score =  132 bits (331), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 54/137 (39%), Gaps = 18/137 (13%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKK-------SMLDEEPQAWKQGPVFVG 73
           +F+ K       +   K+Q+ +Y  +   ++   +        + D + QAW  GPV   
Sbjct: 13  WFLSK-----QSMSPKKLQKMLYYAYSWGLVLLNEDPENLDNKLFDAQFQAWVHGPVIPE 67

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y  +K +    I               + E+ +++  ++  Y   S  QL+ +   E +
Sbjct: 68  IYSEYKTYGFRDIPKKEFGFGE--DLALDSEVEDVLNQVFEVYSEFSGNQLENLTHSE-E 124

Query: 134 TWRRLYD---PNDPNTN 147
            W+       P DP+TN
Sbjct: 125 PWQEARKDCLPMDPSTN 141


>gi|172036018|ref|YP_001802519.1| hypothetical protein cce_1103 [Cyanothece sp. ATCC 51142]
 gi|171697472|gb|ACB50453.1| unknown [Cyanothece sp. ATCC 51142]
          Length = 196

 Score =  131 bits (330), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 28/153 (18%), Positives = 64/153 (41%), Gaps = 13/153 (8%)

Query: 14  STIAVANFFIDKGVKYSIP--IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
             + +A +FI +  +      + ++K+Q+ +Y + C  +    + +  +E QAW+ GPV 
Sbjct: 3   DPLEIAKYFIIRAYEDGREYQMTNMKVQKLLYYSQCLHLALYDEPLFSQEIQAWRYGPVC 62

Query: 72  VGVYHRFKYFDSH--PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
              Y  +  F++   PI     L      +    E  E++E +W  +  +    L ++  
Sbjct: 63  PPAYRFYSEFEAKQLPIPQQDKL------ETLTPEKKELLEEVWLYFGEYHAYYLSDMTH 116

Query: 130 EENKTWRRLYDPNDPNTN--RTITVEEITKMAD 160
            E   W++             TI ++++  + +
Sbjct: 117 LEF-PWKKARKGLSSYERSTNTIDLKDMKLLGE 148


>gi|224543434|ref|ZP_03683973.1| hypothetical protein CATMIT_02643 [Catenibacterium mitsuokai DSM
           15897]
 gi|224523561|gb|EEF92666.1| hypothetical protein CATMIT_02643 [Catenibacterium mitsuokai DSM
           15897]
          Length = 204

 Score =  130 bits (328), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 56/124 (45%), Gaps = 8/124 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLD-EEPQAWKQGPVFV 72
               VA++F+ KG      + + KIQ+  Y      +    + + D  E +AW  GPV  
Sbjct: 55  DITDVADWFLLKGN-----MSNKKIQKLCYYAEAWSLTLLDQDIADHSEFEAWVHGPVNP 109

Query: 73  GVYHRFKYFDSHPIEVIM-DLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
            +Y  FK +  H +++   +        +   E  E++E++W+ Y  +  +QL+ +   E
Sbjct: 110 TLYQTFKGYGWHELKITNREEVMARMENLFTPEQVEVLEAVWDTYGEYGADQLEALTHTE 169

Query: 132 NKTW 135
            + W
Sbjct: 170 -RPW 172


>gi|315575459|gb|EFU87650.1| conserved hypothetical protein [Enterococcus faecalis TX0309B]
 gi|315580100|gb|EFU92291.1| conserved hypothetical protein [Enterococcus faecalis TX0309A]
          Length = 254

 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/163 (23%), Positives = 65/163 (39%), Gaps = 20/163 (12%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
           +++     + +A FF+  G      + +LK+Q+ IY ++   +++  K + DE   A+K 
Sbjct: 89  ESDKKIDVMDIAKFFLSFG-----SLTNLKLQKLIYFSYATHLVRTGKKLFDEPIVAFKY 143

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSF-------------RIFPKIANQEIGEIMESIWN 114
           GPV   VYH +K F    I +  D                +I    ++ EI   +  +  
Sbjct: 144 GPVVKDVYHIYKDFGRESINIEDDGPKFHISEFSIPVSLAKIALNESSSEILLTLTEVIE 203

Query: 115 KYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITK 157
            Y   +  +L  I       W   Y   D   +  IT E I K
Sbjct: 204 SYWDKTASKLVNISHVAGGPWDHAYK--DGKHDVIITDELIKK 244


>gi|228982581|ref|ZP_04142840.1| Uncharacterized phage-associated protein [Bacillus thuringiensis
           Bt407]
 gi|228776764|gb|EEM25072.1| Uncharacterized phage-associated protein [Bacillus thuringiensis
           Bt407]
          Length = 156

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 63/129 (48%), Gaps = 7/129 (5%)

Query: 14  STIAVANFFIDKG-VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
             + +A +FI KG       + + K+ + +Y +    +  + K +  EE   ++ GP+  
Sbjct: 7   DVLEIAKYFIFKGKNSEKYRVTNTKLHKLLYFSQGFHLAIENKPIFLEEIYMFEHGPLIK 66

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            V+ +++ +  H I    +  F       NQE  E ++ IWN ++ ++++ L+EI+   +
Sbjct: 67  SVHEKYRKYTYHTIPEECNDDFS-----FNQETREFLDDIWNLFKLYTSKVLEEIITN-D 120

Query: 133 KTWRRLYDP 141
           + W+R  + 
Sbjct: 121 EPWKRAREN 129


>gi|332686858|ref|YP_004456632.1| phage protein [Melissococcus plutonius ATCC 35311]
 gi|332370867|dbj|BAK21823.1| phage protein [Melissococcus plutonius ATCC 35311]
          Length = 199

 Score =  130 bits (326), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 33/151 (21%), Positives = 59/151 (39%), Gaps = 20/151 (13%)

Query: 9   TNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQG 68
              PY  I VA++ ID   +  I I++LK+Q+ +Y      ++  +K + DE  Q W+ G
Sbjct: 18  NQRPYLAIYVADYIIDLCDQKGIEINNLKLQKIMYYLQARYLIDTEKPLFDENIQKWRYG 77

Query: 69  PVFVGVYHRFKYFDSHPIEVIM-------------------DLSFRIFPKIANQEIGEIM 109
           PV   VYH +K   +  I+                              ++  +E  E++
Sbjct: 78  PVIPSVYHEYKDKGAANIDKKDIGFIVRDPKENEVANFLGYYFKEEYTSEMIIKEDREVI 137

Query: 110 ESIWNKYQSHSTEQLQEIVQEENKTWRRLYD 140
             + N  + ++   L +    E   W    D
Sbjct: 138 GEVVNALKDYTGFDLVKFTH-EQSIWHEYKD 167


>gi|239621772|ref|ZP_04664803.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|239514963|gb|EEQ54830.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
          Length = 159

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 50/138 (36%), Gaps = 3/138 (2%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   VAN  + +       +  +K+Q+ ++   C       + +L E  Q W+ GPV   
Sbjct: 7   TPTTVANSILRRAFGTDEHVTPMKLQKLLFFVTCLYQRYTGRRLLTESFQPWQYGPVCRS 66

Query: 74  VYHRFKYFDSHPIEVIMDLS---FRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
           VY  FK F   PI      +        + ++  + + +  +W      S  +L  +   
Sbjct: 67  VYDEFKGFGGKPINRYAQDALGKVTAVDESSSPSLRKALNLVWENMGDLSAVKLSRVTHR 126

Query: 131 ENKTWRRLYDPNDPNTNR 148
            N  W +    +    + 
Sbjct: 127 PNSAWSQAVAGHKTFISN 144


>gi|268595496|ref|ZP_06129663.1| phage-associated protein [Neisseria gonorrhoeae 35/02]
 gi|268597550|ref|ZP_06131717.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268548885|gb|EEZ44303.1| phage-associated protein [Neisseria gonorrhoeae 35/02]
 gi|268551338|gb|EEZ46357.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
          Length = 173

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 47/121 (38%), Gaps = 7/121 (5%)

Query: 19  ANFFID-KGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR 77
           A+FF+     +    I +LK+Q+ +Y      +    + +  E  + W+ GPV   +Y  
Sbjct: 2   ADFFLSPFEEEDGEQISNLKLQKLLYYAQGYALAILNRPLFAENIEHWQHGPVVPCIYRT 61

Query: 78  FKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
           +K +   P+         I P     E   ++  +  +   ++   L+    +E   W +
Sbjct: 62  YKKYGGSPLPAA-----HIEPDKYADEELVVLNRVRKEQGCYTAWALRNKTHQE-APWIQ 115

Query: 138 L 138
            
Sbjct: 116 T 116


>gi|159904495|ref|YP_001548157.1| putative prophage protein (ps3) [Methanococcus maripaludis C6]
 gi|159885988|gb|ABX00925.1| putative prophage protein (ps3) [Methanococcus maripaludis C6]
          Length = 161

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 61/151 (40%), Gaps = 17/151 (11%)

Query: 9   TNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSML-DEEPQAWKQ 67
           T   Y+   +AN+F+ K       + H K+Q+  Y           K ++ ++  +AW  
Sbjct: 10  TQRTYTIFELANWFLSKS-----SMTHKKLQKLCYYAVAWHYALYDKQLISNDTFEAWVH 64

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           GPV   +Y +++ +  +PI    +          + +  + +E ++  Y+     QL+  
Sbjct: 65  GPVSRELYEKYRGYAWNPIGQRSEAP------NFDADDNQYLEILYETYKHLDGHQLEAR 118

Query: 128 VQEENKTWRRLYD---PNDPNTNRTITVEEI 155
             EE   W+         DP +N  I  E +
Sbjct: 119 THEE-LPWKEARKGLGELDP-SNNIINPETM 147


>gi|125974149|ref|YP_001038059.1| phage-associated protein-like protein [Clostridium thermocellum
           ATCC 27405]
 gi|125714374|gb|ABN52866.1| Uncharacterized phage-associated protein-like protein [Clostridium
           thermocellum ATCC 27405]
          Length = 332

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 34/137 (24%), Positives = 61/137 (44%), Gaps = 11/137 (8%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY 80
           + + K       I  L +Q+ +Y         + + + +E+ +AW  GPV+  VY+R+  
Sbjct: 174 YLLYKC----EDITPLALQKALYYVQGFYYAFEGRFLFEEDCEAWVHGPVYRDVYNRYSS 229

Query: 81  FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD 140
           +   PIE +      +F          I++S+   +  +S + L++    E K WR   D
Sbjct: 230 YRFDPIESVEAFDESVF----TTAEKAILDSVIKNFCCYSGKILEKFTHLE-KPWRYTRD 284

Query: 141 --PNDPNTNRTITVEEI 155
             P D ++NR I  E I
Sbjct: 285 GLPVDAHSNRVIPKELI 301


>gi|298252897|ref|ZP_06976691.1| uncharacterized phage-associated protein [Gardnerella vaginalis
           5-1]
 gi|297533261|gb|EFH72145.1| uncharacterized phage-associated protein [Gardnerella vaginalis
           5-1]
          Length = 147

 Score =  129 bits (325), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 28/140 (20%), Positives = 59/140 (42%), Gaps = 9/140 (6%)

Query: 19  ANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF 78
           A + +D        I  +K+Q+  Y +    +      + +E+ QAW+ GPV   ++   
Sbjct: 2   AAYILDITG----TITTMKLQKLAYYSQAYSLAATGHPLFNEDFQAWRNGPVCPELFALH 57

Query: 79  K-YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
           +  F     E+++  + ++           ++E +  K+  +S   L  +   E+  W+ 
Sbjct: 58  RGKFLIRKGELVLPNTEKLQDNSLTDVQKILVEKVCEKFAGYSGSDLSAMTHSED-PWKN 116

Query: 138 LYDPNDPNTNRTITVEEITK 157
            YD  +      I V++ITK
Sbjct: 117 AYDGAN---GSAICVQKITK 133


>gi|306835838|ref|ZP_07468835.1| XRE family transcriptional regulator [Corynebacterium accolens ATCC
           49726]
 gi|304568312|gb|EFM43880.1| XRE family transcriptional regulator [Corynebacterium accolens ATCC
           49726]
          Length = 149

 Score =  128 bits (323), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 52/131 (39%), Gaps = 4/131 (3%)

Query: 11  PPYSTIAVANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVV-LQKKKSMLDEEPQAWKQG 68
             Y+   +A + +    +     +  LKIQ+ +Y      +       + +E  +AW  G
Sbjct: 2   KQYTAHQIAEWLVAWAEETEEAELTPLKIQKLLYYAKGLYMRASGGVPLFNERMEAWAHG 61

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV V +Y   K +   PI+         F     + + + +  +WNKY  +S   L+   
Sbjct: 62  PVVVDIYRELKKYGKSPID-PDTFISDDFNWDDYRPVEDTLIDVWNKYGPYSAWALRNKT 120

Query: 129 QEENKTWRRLY 139
             E   W++ +
Sbjct: 121 HTE-SPWKKNF 130


>gi|146276480|ref|YP_001166639.1| phage-associated protein-like protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554721|gb|ABP69334.1| Uncharacterized phage-associated protein-like protein [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 178

 Score =  128 bits (323), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 55/147 (37%), Gaps = 6/147 (4%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
              AVAN  + +  +       + +Q+  Y  H   +L     M+  E +A + GP+   
Sbjct: 4   DARAVANEILSRAWELGFEPTQIDVQKITYFLHGHHLLDHGVPMVQTEFEAMQYGPIQRI 63

Query: 74  VYHRFKYFDSHPIEVIMDLSF------RIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           +   F+ +   PI  + +            P+I +  I E ++     Y    + +L ++
Sbjct: 64  LLDSFRKWADQPIGELAEKFDPVRRVHEQLPRIVDNAILETIDRYLAAYLCLPSFELVDM 123

Query: 128 VQEENKTWRRLYDPNDPNTNRTITVEE 154
               N  W +  D    + N  + + +
Sbjct: 124 THARNTPWSKTVDAARNSVNIGMRISD 150


>gi|320536603|ref|ZP_08036624.1| conserved domain protein [Treponema phagedenis F0421]
 gi|320146547|gb|EFW38142.1| conserved domain protein [Treponema phagedenis F0421]
          Length = 139

 Score =  128 bits (323), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 31/141 (21%), Positives = 66/141 (46%), Gaps = 8/141 (5%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            + VA + I++      PI +L++Q+ +Y      + +  +   D+  +AW+ GPV   V
Sbjct: 3   AMVVAQYIINRCTIEGNPISNLQLQKILYYVQVACLQELGEPCFDDPIEAWQFGPVVRAV 62

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y+++  F + PI+   D        I++     I++++ ++ ++     L        K 
Sbjct: 63  YYQYCGFGAFPIDWEYD------SIISDSRKKTIIDTVIDEKKNLPPWALVFDDYSPGKA 116

Query: 135 WRRLYDPNDPNTNRTITVEEI 155
           W R+Y  N P    TI++ ++
Sbjct: 117 WSRVYKNNSP--KATISLRDM 135


>gi|237750673|ref|ZP_04581153.1| prophage ps3 protein [Helicobacter bilis ATCC 43879]
 gi|229373763|gb|EEO24154.1| prophage ps3 protein [Helicobacter bilis ATCC 43879]
          Length = 175

 Score =  128 bits (322), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 38/179 (21%), Positives = 67/179 (37%), Gaps = 32/179 (17%)

Query: 14  STIAVANFFI-----------------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS 56
           + + VAN+F+                  +    +  I HLK+Q+ +Y      +    K 
Sbjct: 3   NVVNVANYFLLLNKRRYEKISSEDDKDSRFQTEADMITHLKLQKLVYYAQGLYLAYFNKP 62

Query: 57  MLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKY 116
           +  +  +AW+ GPV   +YH FK +  + +  + D          +     I++  + +Y
Sbjct: 63  LFTQSVEAWRHGPVVNDLYHIFKPYHKNDLMPLADK-INENDLQLDDNEKFIIKMTFKRY 121

Query: 117 QSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKK 175
              S   L++   EE   W   Y   + N N  I  E +              VEQIK+
Sbjct: 122 GGLSANTLRDKTHEEPT-WLNTY---ELNKNNVIDNELMKSF----------FVEQIKQ 166


>gi|210622827|ref|ZP_03293371.1| hypothetical protein CLOHIR_01319 [Clostridium hiranonis DSM 13275]
 gi|210154044|gb|EEA85050.1| hypothetical protein CLOHIR_01319 [Clostridium hiranonis DSM 13275]
          Length = 327

 Score =  128 bits (322), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 32/139 (23%), Positives = 57/139 (41%), Gaps = 11/139 (7%)

Query: 19  ANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF 78
           + + I K       +  L +Q+ +Y             + +E+ +AW  GPV+  VY RF
Sbjct: 167 SKYIIKKCG----DVTPLSLQKMLYYVQGFYYAFFNSFLFEEDCEAWIHGPVYKDVYDRF 222

Query: 79  KYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW--R 136
           K +  + IE   +L       +       I++S+   +  +S + L+E    E K W   
Sbjct: 223 KDYRYNQIESEENLDE----LLFTSLEISILDSVIKNFGCYSGKILEEFTHTE-KPWLVA 277

Query: 137 RLYDPNDPNTNRTITVEEI 155
           R   P +  +   I+ E I
Sbjct: 278 RGNIPQNKKSQNIISKESI 296


>gi|301320700|gb|ADK69343.1| conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides
           SC str. Gladysdale]
          Length = 150

 Score =  127 bits (320), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 54/126 (42%), Gaps = 12/126 (9%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGP 69
           P YS   ++++F+ K       +   K+Q+  Y           + +L +   QAW  GP
Sbjct: 3   PKYSYKDISDWFLSK-----ESMTPKKLQKLTYYAEAWAYALFDEGILSDTSFQAWIHGP 57

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   ++  +K +  + I    +  ++      ++   E+++++W+ Y   +  +L+ I  
Sbjct: 58  VSPELWRDYKDYGWNEIPKKENNDYK-----LDKNTLELLDAVWSTYGERTGYELEAISH 112

Query: 130 EENKTW 135
            E   W
Sbjct: 113 SE-TPW 117


>gi|317473126|ref|ZP_07932424.1| hypothetical protein HMPREF1011_02774 [Anaerostipes sp. 3_2_56FAA]
 gi|316899350|gb|EFV21366.1| hypothetical protein HMPREF1011_02774 [Anaerostipes sp. 3_2_56FAA]
          Length = 150

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 28/149 (18%), Positives = 56/149 (37%), Gaps = 9/149 (6%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
              VA + + K      P+  +K+++  Y      +      + DEE +AW  GPV   +
Sbjct: 7   VFDVAKYILHK----KGPMTTMKLEKLTYYCQAWSLAWDDVPLFDEEFEAWANGPVCPQL 62

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           +   K+     ++  +         + +++  E M+++   Y     + L E+  +E   
Sbjct: 63  FE--KHRGLFVVDEDIFTDSGSIQNVFSEDELETMDNVLEYYGDKEPQWLSELTHKE-AP 119

Query: 135 WRRLYDPNDPN--TNRTITVEEITKMADG 161
           W+       P    N  IT E +     G
Sbjct: 120 WKIARAGCAPGAYCNEVITKESMQSYYGG 148


>gi|300869079|ref|ZP_07113680.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300332936|emb|CBN58876.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 159

 Score =  127 bits (319), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 27/142 (19%), Positives = 62/142 (43%), Gaps = 10/142 (7%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            +A+++I         + + K+Q+ +Y      +  +   + DE+ QAW  GP    +++
Sbjct: 12  KLADYYIWFANDVGSYLSNQKLQKLLYYAQAWYLAFEDTPLFDEDFQAWVHGPTIPALFY 71

Query: 77  RFKY-FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
            +K  F   PI   ++           +E+ + ++ + ++Y      +L+ +V+ E+  W
Sbjct: 72  EYKEQFGFKPILKEVEKPE------FPEEVQKFLDDLSDEYFFLDAYELELMVRRED-PW 124

Query: 136 RRLY--DPNDPNTNRTITVEEI 155
            +     P D   +  IT E +
Sbjct: 125 IKARGDLPRDQPCHAIITKELM 146


>gi|307271322|ref|ZP_07552601.1| hypothetical protein HMPREF9514_00077 [Enterococcus faecalis
           TX0855]
 gi|306512071|gb|EFM81062.1| hypothetical protein HMPREF9514_00077 [Enterococcus faecalis
           TX0855]
          Length = 182

 Score =  127 bits (318), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 32/147 (21%), Positives = 60/147 (40%), Gaps = 20/147 (13%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
           + PY  + VA++ ID   K+ I I++LK+Q+ +Y      +++  + ++DEE Q WK GP
Sbjct: 2   SKPYLAMYVADYIIDYCNKHDIEINNLKLQKVMYYLQAKSLVETNEPLIDEELQKWKYGP 61

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSF-------------------RIFPKIANQEIGEIME 110
           V   VYH +K   +  I +                            P++  Q+    + 
Sbjct: 62  VVPTVYHEYKNNGAGNIGISDIGPILRKARVNEKANFLGRYVQEEYSPELIEQDDRNSIN 121

Query: 111 SIWNKYQSHSTEQLQEIVQEENKTWRR 137
            + N    ++  +L          W+ 
Sbjct: 122 EVVNSLSDYTGFELVNETHGH-SIWKN 147


>gi|16127745|ref|NP_422309.1| hypothetical protein CC_3515 [Caulobacter crescentus CB15]
 gi|221236566|ref|YP_002519003.1| hypothetical protein CCNA_03630 [Caulobacter crescentus NA1000]
 gi|13425245|gb|AAK25477.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965739|gb|ACL97095.1| hypothetical protein CCNA_03630 [Caulobacter crescentus NA1000]
          Length = 188

 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/148 (27%), Positives = 60/148 (40%), Gaps = 8/148 (5%)

Query: 6   FTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAW 65
            TQ        AVAN  +DK     IPI +L +Q+ +Y  H   ++ K + +++   +AW
Sbjct: 4   LTQDPQSVDARAVANLLLDKAAALDIPISNLALQKLLYFAHGRFLVDKGRPLVNGFFEAW 63

Query: 66  KQGPVFVGVYHRFKYFDSHPI------EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSH 119
           K GPV   VY  F       I      + I+     I     +Q+I E +E +       
Sbjct: 64  KFGPVHPVVYRCFSANGPKYIINRAIKKDILSGLHIIVSPPRDQDIHEGIERVLLTMGRM 123

Query: 120 STEQLQEIVQEENKTWRRLYDPNDPNTN 147
           S  QL  +       W  +   N P TN
Sbjct: 124 SASQLVAVSHASGGPWDVI--ANGPGTN 149


>gi|313678592|ref|YP_004056332.1| hypothetical protein MBOVPG45_0501 [Mycoplasma bovis PG45]
 gi|312950116|gb|ADR24711.1| conserved hypothetical protein [Mycoplasma bovis PG45]
          Length = 150

 Score =  126 bits (317), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 30/132 (22%), Positives = 58/132 (43%), Gaps = 12/132 (9%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQG 68
           N  YS   V+N+F+ K       +   K+Q+  Y           + +L +   QAW  G
Sbjct: 2   NKKYSYKDVSNWFLSK-----ESMTPKKLQKLTYYAEAWANALLGEGILSDTAFQAWVHG 56

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV   ++H +K +  + IE +         +  ++ I E+++++W  Y   S  +L+ I 
Sbjct: 57  PVSPELWHDYKEYGWNEIEQLKP-----NDEKFSKNILELLDAVWITYGDKSGYELEAIS 111

Query: 129 QEENKTWRRLYD 140
             E + W +  +
Sbjct: 112 HSE-EPWLKARN 122


>gi|42560746|ref|NP_975197.1| putative prophage protein (ps3) [Mycoplasma mycoides subsp.
           mycoides SC str. PG1]
 gi|42492242|emb|CAE76839.1| Putative prophage protein (ps3) [Mycoplasma mycoides subsp.
           mycoides SC str. PG1]
          Length = 191

 Score =  126 bits (317), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 60/148 (40%), Gaps = 14/148 (9%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGP 69
           P YS   ++++F+ K       +   K+Q+  Y           + +L +   QAW  GP
Sbjct: 44  PKYSYKNISDWFLSK-----ESMTPKKLQKLTYYAEAWAYALFDEGILSDTSFQAWIHGP 98

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   ++  +K +  + I    +  ++      ++   E+++++W+ Y   +  +L+ I  
Sbjct: 99  VSPELWREYKDYGWNEIPKKENNDYK-----LDKNTLELLDAVWSTYGERTGYELEAISH 153

Query: 130 EENKTWRRLYDPNDPNTNRT--ITVEEI 155
            E   W       +     T  I  E++
Sbjct: 154 SE-TPWINARKGLEELETSTKLIKPEDM 180


>gi|313665379|ref|YP_004047250.1| hypothetical protein MSB_A0506 [Mycoplasma leachii PG50]
 gi|312949417|gb|ADR24013.1| conserved hypothetical protein [Mycoplasma leachii PG50]
          Length = 150

 Score =  126 bits (317), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 61/148 (41%), Gaps = 14/148 (9%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGP 69
           P YS   ++++F+ K       +   K+Q+  Y           + +L +   QAW  GP
Sbjct: 3   PKYSYKDISDWFLSK-----ESMTPKKLQKLTYYAEAWAYALFDEGILSDTSFQAWIHGP 57

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   ++  +K +  + I    +  ++      ++   E+++++W+ Y   +  +L+ I  
Sbjct: 58  VSPELWRDYKVYGWNEIPKKENNDYK-----LDKNTLELLDAVWSTYGERTGYELEAISH 112

Query: 130 EENKTWRRLYDPND--PNTNRTITVEEI 155
            E   W       +    + + I  E++
Sbjct: 113 SE-TPWINARKGLEELEASTKLIKPEDM 139


>gi|159904805|ref|YP_001548467.1| putative prophage protein (ps3) [Methanococcus maripaludis C6]
 gi|159886298|gb|ABX01235.1| putative prophage protein (ps3) [Methanococcus maripaludis C6]
          Length = 153

 Score =  126 bits (316), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 30/154 (19%), Positives = 58/154 (37%), Gaps = 19/154 (12%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE-EPQAW 65
              N       VA +F++K       + H K+Q+  Y           K ++   E +AW
Sbjct: 1   MDNNCTIQIFDVAKWFLNK-----ESMSHKKLQKLCYYALSWYSAVYDKELIPTVEFEAW 55

Query: 66  KQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
             GPV   +Y  +K +    I    +          ++E+   ++SI+  Y   S ++L+
Sbjct: 56  VHGPVIRELYENYKSYKFFDIPKETEKPD------FSKELNNFLDSIYETYGEMSGDELE 109

Query: 126 EIVQEENKTWRRL------YDPNDPNTNRTITVE 153
            +  +E + W         Y+ +    N  I  +
Sbjct: 110 SLTHQE-EPWINARMGLKDYESSKNIINNEIIKK 142


>gi|326560181|gb|EGE10569.1| phage-associated protein [Moraxella catarrhalis 7169]
 gi|326565730|gb|EGE15892.1| phage-associated protein [Moraxella catarrhalis BC1]
          Length = 170

 Score =  126 bits (316), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 35/152 (23%), Positives = 61/152 (40%), Gaps = 19/152 (12%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
               PY+ I VAN+ + + ++   P+ HLK+Q+ +Y      +    K ++ E    W+ 
Sbjct: 1   MIKAPYNPIDVANYIVAEAIRREKPVTHLKLQKLLYYVVAKYLQTHNKPLIAENVVKWQY 60

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA-----------------NQEIGEIME 110
           GPV   VYH+FK   S  I  + +       K                   + E  ++  
Sbjct: 61  GPVVKSVYHQFKILGSLEITELCEYIESKDDKKLFSVKWANVDANVKTLENDPEFAKVAN 120

Query: 111 SIWNKYQSHSTEQLQEIVQEENKTWRRLYDPN 142
           ++ +   S S   L +I   E   WR  ++P 
Sbjct: 121 TVIDDLLSVSAFGLVDITHAE-AAWRN-FEPE 150


>gi|301320789|gb|ADK69432.1| conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides
           SC str. Gladysdale]
          Length = 150

 Score =  125 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 60/148 (40%), Gaps = 14/148 (9%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGP 69
           P YS   ++++F+ K       +   K+Q+  Y           + +L +   QAW  GP
Sbjct: 3   PKYSYKNISDWFLSK-----ESMTPKKLQKLTYYAEAWAYALFDEGILSDTSFQAWIHGP 57

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   ++  +K +  + I    +  ++      ++   E+++++W+ Y   +  +L+ I  
Sbjct: 58  VSPELWREYKDYGWNEIPKKENNDYK-----LDKNTLELLDAVWSTYGERTGYELEAISH 112

Query: 130 EENKTWRRLYDPNDPNTNRT--ITVEEI 155
            E   W       +     T  I  E++
Sbjct: 113 SE-TPWINARKGLEELETSTKLIKPEDM 139


>gi|218280922|ref|ZP_03487532.1| hypothetical protein EUBIFOR_00090 [Eubacterium biforme DSM 3989]
 gi|218217778|gb|EEC91316.1| hypothetical protein EUBIFOR_00090 [Eubacterium biforme DSM 3989]
          Length = 177

 Score =  125 bits (315), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 32/148 (21%), Positives = 59/148 (39%), Gaps = 10/148 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSML-DEEPQAWKQGPVFV 72
               VAN+F+ K       + H KIQ+  Y             +  + E QAW  GPV +
Sbjct: 26  DITDVANWFLLK-----EDMSHKKIQKLCYYAEAWSETLLDAPICKNNEFQAWIHGPVNL 80

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRI-FPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
            +++ +K +    I +    S         +    EI+ S+W+ Y ++S + L+     E
Sbjct: 81  KLWNIYKDYGWSLIHLQCTKSEEDSLFSKFSDSQLEILNSVWHSYGAYSADTLEAQTHSE 140

Query: 132 NKTWRRLYDPND--PNTNRTITVEEITK 157
              W+            ++ I+VE + +
Sbjct: 141 -TPWQEQRGNLQMFAPCSKVISVETMKR 167


>gi|256384054|gb|ACU78624.1| CdsE [Mycoplasma mycoides subsp. capri str. GM12]
 gi|256384886|gb|ACU79455.1| CdsE [Mycoplasma mycoides subsp. capri str. GM12]
 gi|296455308|gb|ADH21543.1| cdse [synthetic Mycoplasma mycoides JCVI-syn1.0]
          Length = 151

 Score =  125 bits (315), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 65/148 (43%), Gaps = 13/148 (8%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGP 69
             YS   ++++F+ K       + H K+Q+  Y          K  +L++   QAW  GP
Sbjct: 3   KKYSYKDISDWFLAK-----ESMTHKKLQKLTYYAEAWSWALLKHGILNDTAFQAWIHGP 57

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   ++  +K +  + I      +  +F    +++  ++++++W  Y   S  +L+ +  
Sbjct: 58  VSPELWEVYKNYGWNDIPKKDLRNDYLF----DEKTLDVLDAVWTTYGQKSGYELECLSH 113

Query: 130 EENKTWRRLYDP--NDPNTNRTITVEEI 155
            E+  W++  +       +N  I  E++
Sbjct: 114 SED-PWKKARNGLLEFQPSNNVINSEDM 140


>gi|331703477|ref|YP_004400164.1| hypothetical protein MLC_4580 [Mycoplasma mycoides subsp. capri LC
           str. 95010]
 gi|328802032|emb|CBW54186.1| Conserved hypothetical protein [Mycoplasma mycoides subsp. capri LC
           str. 95010]
          Length = 153

 Score =  125 bits (314), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 65/148 (43%), Gaps = 13/148 (8%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGP 69
             YS   ++++F+ K       + H K+Q+  Y          K  +L++   QAW  GP
Sbjct: 5   KKYSYKDISDWFLAK-----ESMTHKKLQKLTYYAEAWSWALLKHGILNDTAFQAWIHGP 59

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   ++  +K +  + I      +  +F    +++  ++++++W  Y   S  +L+ +  
Sbjct: 60  VSPELWEVYKNYGWNDIPKKDLRNDYLF----DEKTLDVLDAVWTTYGQKSGYELECLSH 115

Query: 130 EENKTWRRLYDP--NDPNTNRTITVEEI 155
            E+  W++  +       +N  I  E++
Sbjct: 116 SED-PWKKARNGLLEFQPSNNVINSEDM 142


>gi|27363593|ref|NP_759121.1| hypothetical protein VV1_0109 [Vibrio vulnificus CMCP6]
 gi|27359709|gb|AAO08648.1| Uncharacterized phage-associated protein [Vibrio vulnificus CMCP6]
          Length = 191

 Score =  125 bits (314), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 31/177 (17%), Positives = 72/177 (40%), Gaps = 12/177 (6%)

Query: 19  ANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF 78
           A   + +  +  I + +LK+Q+  Y      + Q ++ + DE+ +AW  GPV   +Y  +
Sbjct: 8   AKALLQRASENGIQVSNLKLQKLAYYCQGYHLAQYEEPLFDEDLKAWDHGPVVRSLYEEY 67

Query: 79  KYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW-RR 137
           + +    I   +  +        +    + ++ +     +    QL+E    E   W   
Sbjct: 68  QTYKKGTITASVGNAIC----ELSDRAVQTIDFVLMTLGNMGAWQLREKSHRE-APWLAH 122

Query: 138 LYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVK 194
           +   +     +TIT +E+       +   + + EQ  + +    D   A +ES++++
Sbjct: 123 VSKESKKVDYQTITHQELI------DFFAQELNEQHDRLLSIHMDRMEAAMESEVIE 173


>gi|237741819|ref|ZP_04572300.1| prophage ps3 protein 01 [Fusobacterium sp. 4_1_13]
 gi|229429467|gb|EEO39679.1| prophage ps3 protein 01 [Fusobacterium sp. 4_1_13]
          Length = 151

 Score =  125 bits (314), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 57/150 (38%), Gaps = 18/150 (12%)

Query: 13  YSTIAVANFFIDKG-------VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAW 65
           Y    +A++FI           + +  I ++K+Q+ ++      +  K + +   E  AW
Sbjct: 2   YDVNKIADWFIWYNEYIRNFKDEDTDNISNMKLQKLLFYAQSAFLAIKGQPLFKNEILAW 61

Query: 66  KQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
           + GPV   +Y ++K   +  I        +   K        ++  I+N +  +S   L+
Sbjct: 62  EHGPVIKEIYDKYKNKGNQGITEYNVDDIKDISKDDT----NLLIDIYNLFAEYSAWGLR 117

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
            +   E   W+          N  I  +++
Sbjct: 118 NLTHSE-TPWK------STKRNEVIKTDKM 140


>gi|294102139|ref|YP_003553997.1| prophage ps3 protein 01 [Aminobacterium colombiense DSM 12261]
 gi|293617119|gb|ADE57273.1| prophage ps3 protein 01 [Aminobacterium colombiense DSM 12261]
          Length = 143

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 24/146 (16%), Positives = 56/146 (38%), Gaps = 12/146 (8%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S   VA + ++K       +  +K+Q+ +Y +    ++     + DEE +AW  GPV   
Sbjct: 3   SVFDVAKYILEK----YGAVSAMKLQKLVYYSQAWSLVWDDDPLFDEEIEAWANGPVVRE 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y + +      I  +                 + +  + + Y   + ++L ++  +E  
Sbjct: 59  LYEKHRG-----IFKVHVDMMSGCSGNLTDNEKDTINIVCDFYNKKNAQELSDMTHQEG- 112

Query: 134 TWRRLYDPNDPNTN--RTITVEEITK 157
            W+      +      R I+ E + +
Sbjct: 113 PWKDARFGLEERERGSRIISKESMAE 138


>gi|291522557|emb|CBK80850.1| Uncharacterized phage-associated protein [Coprococcus catus GD/7]
          Length = 144

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 60/139 (43%), Gaps = 7/139 (5%)

Query: 14  STIAVANFFIDKG-VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
             +  A + +     +    +  +K+Q+ +YL+     +   K++  E+  AW+ GP   
Sbjct: 3   DILEAARYLVYLSYQEDRHSLTPVKLQKILYLSQGWSFVWDSKALFPEDFCAWEYGPANE 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            VY  FK +    I     +S      +A+++  + +E++WN+Y   +   L +++  + 
Sbjct: 63  KVYETFKKYGRSEISAAEGISG-----VADKDARDTLEAVWNEYGKRTAYDLVDLICSQ- 116

Query: 133 KTWRRLYDPNDPNTNRTIT 151
             W+     N   TN  I 
Sbjct: 117 TPWKNARADNIRITNACIC 135


>gi|224541600|ref|ZP_03682139.1| hypothetical protein CATMIT_00771 [Catenibacterium mitsuokai DSM
           15897]
 gi|224525512|gb|EEF94617.1| hypothetical protein CATMIT_00771 [Catenibacterium mitsuokai DSM
           15897]
          Length = 332

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 56/131 (42%), Gaps = 4/131 (3%)

Query: 23  IDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFD 82
           I    K    +  L +Q+ +YL            M  E  QAW  GPV+  VYH FK F 
Sbjct: 171 IAYLFKGLNEVTPLMLQKLLYLIQGTSYALYDHPMFIEHSQAWVHGPVYPDVYHLFKQFS 230

Query: 83  SHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW---RRLY 139
            +PI+    + F       ++E   +++ + + Y  +S + L+ I   ++  W   R+ Y
Sbjct: 231 FNPIDDDRFVLFEELENTLSEEECHVIDLVIHTYGLYSAKVLETITHTQD-PWISARKGY 289

Query: 140 DPNDPNTNRTI 150
           +   P+    I
Sbjct: 290 EGTIPSHEPII 300


>gi|291558343|emb|CBL37143.1| Uncharacterized phage-associated protein [butyrate-producing
           bacterium SSC/2]
          Length = 145

 Score =  124 bits (312), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 67/147 (45%), Gaps = 6/147 (4%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           Y+ + VA++ + +      P+ +L++Q+ +Y    + + +  +    ++ QA + GP   
Sbjct: 2   YNAVDVASYIVGRCANLGRPVTNLQLQKILYYVQLNFLRRFDECAFWDDIQALRHGPAVK 61

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            VY+++  +  + I   +  + +   +   ++  E+++ + +        +L E  Q+  
Sbjct: 62  EVYYKYNIWGRNEI---VPRAVQSAKETFLEKDRELIDRVTDACLLLDPWELVERSQKAG 118

Query: 133 KTWRRLYDPNDPNTNRTITVEEITKMA 159
             W R +   D N ++ I  E + K A
Sbjct: 119 GPWHRSF---DGNLDKVIPKELMKKYA 142


>gi|16271827|ref|NP_438164.1| hypothetical protein phiNIH1.1_51 [Temperate phage phiNIH1.1]
 gi|19746216|ref|NP_607352.1| hypothetical protein spyM18_1241 [Streptococcus pyogenes MGAS8232]
 gi|21910743|ref|NP_665011.1| hypothetical protein SpyM3_1207 [Streptococcus pyogenes MGAS315]
 gi|28876321|ref|NP_795600.1| hypothetical protein SpyM3_1207 [Streptococcus pyogenes phage
           315.4]
 gi|28895567|ref|NP_801917.1| hypothetical protein SPs0655 [Streptococcus pyogenes SSI-1]
 gi|71903887|ref|YP_280690.1| phage protein [Streptococcus pyogenes MGAS6180]
 gi|94990811|ref|YP_598911.1| phage protein [Streptococcus pyogenes MGAS10270]
 gi|139473391|ref|YP_001128107.1| hypothetical protein SpyM50531 [Streptococcus pyogenes str.
           Manfredo]
 gi|16156219|gb|AAL15093.1| hypothetical protein-phage associated [temperate phage PhiNIH1.1]
 gi|19748400|gb|AAL97851.1| hypothetical phage protein [Streptococcus pyogenes MGAS8232]
 gi|21904947|gb|AAM79814.1| conserved hypothetical protein - phage-associated [Streptococcus
           pyogenes MGAS315]
 gi|28810816|dbj|BAC63750.1| hypothetical protein (phage associated) [Streptococcus pyogenes
           SSI-1]
 gi|71802982|gb|AAX72335.1| phage protein [Streptococcus pyogenes MGAS6180]
 gi|94544319|gb|ABF34367.1| phage protein [Streptococcus pyogenes MGAS10270]
 gi|134271638|emb|CAM29869.1| hypothetical phage protein [Streptococcus pyogenes str. Manfredo]
          Length = 174

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/158 (24%), Positives = 69/158 (43%), Gaps = 18/158 (11%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            + VAN+ I+   K    I++LK+Q+ +Y  +   +L+    + +E  + WK GPV   V
Sbjct: 3   ALFVANYIIEYSNKKGYKINNLKLQKLLYFVNVRNILENGAPLFEESMEKWKYGPVVPDV 62

Query: 75  YHRFKYFD------SHPIEVIMDLSFRIFPKIANQEIGE----------IMESIWNKYQS 118
           YH +K F          I   ++ S   F ++++ EI E          ++E+  +    
Sbjct: 63  YHEYKRFGAFSISTDEMIMEYVEFSVSPFGELSDLEITEYDSQKVENTQLIENTVDALHG 122

Query: 119 HSTEQLQEIVQEENKTWRRLYDP-NDPNTNRTITVEEI 155
               +L +I  +    W++  D   D       T+EEI
Sbjct: 123 FGPFELVDITHDH-TPWKKYEDRIMDGVQGIKYTIEEI 159


>gi|209559953|ref|YP_002286425.1| phage-associated protein [Streptococcus pyogenes NZ131]
 gi|209541154|gb|ACI61730.1| Uncharacterized phage-associated protein [Streptococcus pyogenes
           NZ131]
          Length = 174

 Score =  123 bits (310), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 38/158 (24%), Positives = 69/158 (43%), Gaps = 18/158 (11%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            + VAN+ I+   K    I++LK+Q+ +Y  +   +L+    + +E  + WK GPV   V
Sbjct: 3   ALFVANYIIEYSNKKGYKINNLKLQKLLYFVNVRNILENGTPLFEESMEKWKYGPVVPDV 62

Query: 75  YHRFKYFD------SHPIEVIMDLSFRIFPKIANQEIGE----------IMESIWNKYQS 118
           YH +K F          I   ++ S   F ++++ EI E          ++E+  +    
Sbjct: 63  YHEYKRFGAFSISTDEMIMEYVEFSVSPFGELSDLEITEYDSQKVENTQLIENTVDALHG 122

Query: 119 HSTEQLQEIVQEENKTWRRLYDP-NDPNTNRTITVEEI 155
               +L +I  +    W++  D   D       T+EEI
Sbjct: 123 FGPFELVDITHDH-TPWKKYEDRIMDGVQGIKYTIEEI 159


>gi|146298683|ref|YP_001193274.1| phage-associated protein [Flavobacterium johnsoniae UW101]
 gi|146153101|gb|ABQ03955.1| Uncharacterized phage-associated protein [Flavobacterium johnsoniae
           UW101]
          Length = 156

 Score =  123 bits (308), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 57/131 (43%), Gaps = 8/131 (6%)

Query: 19  ANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR 77
            ++ I +   + S  ++HLK+Q+ +Y      +        D + QAW  GPV   +Y R
Sbjct: 8   CDYIIFRLKSEESGSLNHLKLQKLLYYVQSWHLAFYGTRFFDGKFQAWIHGPVNRAIYDR 67

Query: 78  FK--YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
           FK   +    I+ + DLS          E+ E ++ +   Y   S   L+    +E + W
Sbjct: 68  FKDTKYMYSTID-LDDLSDTEITTKLPLEVKEHIDVVLETYAGFSDTDLESKTHQE-EPW 125

Query: 136 ---RRLYDPND 143
              R+ + P++
Sbjct: 126 INARKGFKPSE 136


>gi|213692364|ref|YP_002322950.1| hypothetical protein Blon_1491 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|213523825|gb|ACJ52572.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320458503|dbj|BAJ69124.1| hypothetical phage protein [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 145

 Score =  123 bits (308), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 28/146 (19%), Positives = 55/146 (37%), Gaps = 12/146 (8%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S   VA + +DK       +  +K+++  Y +    ++  ++ +  E  +AW  GPV   
Sbjct: 3   SIFDVAAYVLDKLG----VMTTMKLEKLCYYSQAWSLVWDERRLFPERFEAWANGPVCPD 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +YH  K         I        P   +++    ++++   Y      QL E+   E +
Sbjct: 59  LYHAHKGMF-----KITRGDIHGDPSNIDEDGINTIDAVLKAYGKMGAYQLSELTHSE-R 112

Query: 134 TWRRL--YDPNDPNTNRTITVEEITK 157
            W+      P     N  IT   + +
Sbjct: 113 PWKDARGNLPQGAICNTEITEAAMAE 138


>gi|257125735|ref|YP_003163849.1| prophage protein [Leptotrichia buccalis C-1013-b]
 gi|257049674|gb|ACV38858.1| putative prophage protein [Leptotrichia buccalis C-1013-b]
          Length = 144

 Score =  123 bits (308), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 49/124 (39%), Gaps = 12/124 (9%)

Query: 13  YSTIAVANFFIDKG-----VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
           Y    +AN+F+         + +  + +LK Q+ +Y      +  K   +      AW  
Sbjct: 2   YDVKDIANWFLIYNSYMETNQGADGMSNLKFQKLLYYAQSAYLALKNAPLFSNNIVAWNH 61

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           G V   +Y ++K   S  I+    +         ++E  +I+  ++N +  +S   L+ +
Sbjct: 62  GSVVEEIYQKYKKCSSDDIKEFDKVDI-------DKETEKILTEVYNVFGEYSAWGLRNL 114

Query: 128 VQEE 131
              E
Sbjct: 115 THTE 118


>gi|256847418|ref|ZP_05552864.1| prophage ps3 protein 01 [Lactobacillus coleohominis 101-4-CHN]
 gi|256716082|gb|EEU31057.1| prophage ps3 protein 01 [Lactobacillus coleohominis 101-4-CHN]
          Length = 156

 Score =  122 bits (307), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 35/163 (21%), Positives = 62/163 (38%), Gaps = 15/163 (9%)

Query: 13  YSTIAVANFFIDKGVK------YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
           Y+   + N+   K             +  +K+ + +Y      +    K M D +  AWK
Sbjct: 2   YNVFEIVNWLRVKNNADMRQNPNIEELTQMKVMKLLYYIQAASLSITNKRMFDNDIVAWK 61

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIG-EIMESIWNKYQSHSTEQLQ 125
            GPV   V+ ++K +    +  I D   R + K+ +      I+ SI++ Y   S   L 
Sbjct: 62  YGPVVEAVHEKYKGY-RGIVGEITDEDLRDYSKLQSDATASSILNSIYDVYGYSSAYDLM 120

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPEN 168
                E K W+      +   +  I+ E I     G  +S E+
Sbjct: 121 RQTHRE-KPWK------ETPQSEVISDESIKNFYSGVFVSDED 156


>gi|295112182|emb|CBL28932.1| Uncharacterized phage-associated protein [Synergistetes bacterium
           SGP1]
          Length = 139

 Score =  122 bits (306), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 32/145 (22%), Positives = 59/145 (40%), Gaps = 9/145 (6%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            + +A + + K VK S  I +L++Q+ +Y    D + +  +    +  +AW  GPV   V
Sbjct: 3   ALDLAKYIVTKCVKDSCAISNLQLQKILYFIQKDFLCR-GEFAFLDAIEAWPFGPVVPAV 61

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y+ F  F S  I    +            +    ++ I    +      L E    +N  
Sbjct: 62  YYHFCIFGSMSITTAYE------GITIEAKDRARIDPIVEAKRVLPPWDLVEDTHRKNGA 115

Query: 135 WRRLYDPNDPNTNRTITVEEITKMA 159
           W ++Y   D   NR +   ++ K+A
Sbjct: 116 WDQIYQ--DGAGNRKVIPPDLIKVA 138


>gi|37523466|ref|NP_926843.1| hypothetical protein glr3897 [Gloeobacter violaceus PCC 7421]
 gi|35214470|dbj|BAC91838.1| glr3897 [Gloeobacter violaceus PCC 7421]
          Length = 142

 Score =  122 bits (305), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 25/146 (17%), Positives = 57/146 (39%), Gaps = 13/146 (8%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +    A + ++K       I  +K+Q+ +Y +    ++     + DE  +AW  GPV   
Sbjct: 3   TADDAAAYILNKLGA----ITAMKLQKLLYYSQAWSLVWDDHPLFDERIEAWANGPVIPA 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y + +       + ++       P     +  E ++++   Y   S++ L ++  +E  
Sbjct: 59  IYEQHRG------QYLVTEWLAGNPGNLGSDAIETIDAVLKVYGDKSSQWLSDLTHKE-A 111

Query: 134 TWRRLYD--PNDPNTNRTITVEEITK 157
            WR      P      + IT   + +
Sbjct: 112 PWRDARLGIPTGVPCKQEITQASMAE 137


>gi|291529520|emb|CBK95106.1| Uncharacterized phage-associated protein [Eubacterium rectale
           M104/1]
          Length = 144

 Score =  122 bits (305), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 65/145 (44%), Gaps = 4/145 (2%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           Y  + ++ + I+K V  +IPI ++++Q+ +Y    + +   KK M  +E +AW  GPV  
Sbjct: 2   YKALDISKYIINKCVNDNIPISNMQLQKILYCIQRECLQLYKKEMFVDEIEAWPFGPVIP 61

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            VY+ +  F ++PI +    S        +     ++     K +      L E V  + 
Sbjct: 62  EVYYMYCGFGANPIRIR---SAADCRNNISNADLVLINYTVEKIRILKPWNLTEDVHRKG 118

Query: 133 KTWRRLYDPNDPNTNRTITVEEITK 157
             +  +YD N    +R I  + I K
Sbjct: 119 HAYDIIYD-NGLGNHRVIPKDLIKK 142


>gi|313678298|ref|YP_004056038.1| hypothetical protein MBOVPG45_0188 [Mycoplasma bovis PG45]
 gi|312950310|gb|ADR24905.1| conserved hypothetical protein (ICEB-2 encoded) [Mycoplasma bovis
           PG45]
          Length = 150

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 58/132 (43%), Gaps = 12/132 (9%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQG 68
           +  YS   ++ +F+ K       +   K+Q+  Y           + +L +   QAW  G
Sbjct: 2   SKKYSYKDISGWFLSK-----ESMTPKKLQKLTYYAEAWANALLGEGILSDTAFQAWVHG 56

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV   +++ +K +  + IE +         +  N+ I E+++++W  Y S S  +L+ I 
Sbjct: 57  PVSPELWNDYKEYGWNEIEQLKP-----NDEKFNKNILELLDAVWTTYGSKSGYELEAIS 111

Query: 129 QEENKTWRRLYD 140
             E + W +  +
Sbjct: 112 HSE-EPWLKARN 122


>gi|148377907|ref|YP_001256783.1| putative prophage protein (ps3) [Mycoplasma agalactiae PG2]
 gi|148291953|emb|CAL59344.1| Putative prophage protein (ps3) [Mycoplasma agalactiae PG2]
          Length = 150

 Score =  121 bits (304), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 26/148 (17%), Positives = 60/148 (40%), Gaps = 14/148 (9%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGP 69
             YS   ++ +F+ K       +   K+Q+  Y             +L +   QAW  GP
Sbjct: 3   NKYSYKDISGWFLSK-----ESMTPKKLQKLTYYAEAWAYALLDDGILKDTAFQAWIHGP 57

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   ++  ++ +  + IE       +      ++ + E+++++W  Y   S  +L+ +  
Sbjct: 58  VSPELWKDYRDYGWNEIEKKAFDESK-----LDKNVLELLDAVWTTYGDKSGYELEAVSH 112

Query: 130 EENKTWRRLYDPND--PNTNRTITVEEI 155
            E + W+           +NR I+ +++
Sbjct: 113 SE-EPWKNARKGLGEFEASNRLISPDDM 139


>gi|291320632|ref|YP_003515897.1| putative prophage protein (ps3) [Mycoplasma agalactiae]
 gi|290752968|emb|CBH40943.1| Putative prophage protein (ps3) [Mycoplasma agalactiae]
          Length = 150

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 61/149 (40%), Gaps = 14/149 (9%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQG 68
           +  YS   ++ +F+ K       +   K+Q+  Y             +L++   QAW  G
Sbjct: 2   SNKYSYKDISGWFLSK-----ESMTPKKLQKLTYYAEAWAYALLDDGILNDTAFQAWIHG 56

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV   ++  ++ +    IE       +      ++ + E+++++W  Y   S  +L+ + 
Sbjct: 57  PVSPELWKDYRNYGWDEIEKKAFDESK-----LDKNVLELLDAVWTTYGDKSGYELEAVS 111

Query: 129 QEENKTWRRLYDPND--PNTNRTITVEEI 155
             E + W+           +NR I+ +++
Sbjct: 112 HSE-EPWKNARKGLGEFEASNRLISPDDM 139


>gi|288801930|ref|ZP_06407371.1| phage protein [Prevotella melaninogenica D18]
 gi|288335365|gb|EFC73799.1| phage protein [Prevotella melaninogenica D18]
          Length = 156

 Score =  121 bits (303), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 64/146 (43%), Gaps = 15/146 (10%)

Query: 14  STIAVANFFIDK-GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
               +A++   +   +Y   ID +K+ + +YLT  + +++  + + +++ +AWK GPV  
Sbjct: 3   DVQQIASYISQRYEKEYGRQIDEMKLHKLLYLTQREAIIETGEPLFEDQFEAWKYGPVLY 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            V+  F+            L   +  +    +  ++ + +++ Y    +  L  +   E 
Sbjct: 63  SVHKAFQ---------TDKLHGEMLSEETIGKYKKVFDKVFSSYAPKDSWSLSTLSHGEY 113

Query: 133 KTWRRL---YDPNDPNTNRTITVEEI 155
             WR+    YDP D      I VE+I
Sbjct: 114 S-WRKAREGYDP-DSACRAKIRVEDI 137


>gi|291320225|ref|YP_003515486.1| hypothetical protein MAGa3150 [Mycoplasma agalactiae]
 gi|291320401|ref|YP_003515664.1| hypothetical protein MAGa5000 [Mycoplasma agalactiae]
 gi|291320588|ref|YP_003515852.1| hypothetical protein MAGa6950 [Mycoplasma agalactiae]
 gi|98985914|emb|CAJ32617.1| CDSE [Mycoplasma agalactiae]
 gi|290752557|emb|CBH40529.1| CDSE [Mycoplasma agalactiae]
 gi|290752735|emb|CBH40710.1| CDSE [Mycoplasma agalactiae]
 gi|290752923|emb|CBH40898.1| CDSE [Mycoplasma agalactiae]
          Length = 150

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 56/129 (43%), Gaps = 12/129 (9%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGP 69
             YS   ++N+F+ K       +   K+Q+  Y             +L++   QAW   P
Sbjct: 3   KKYSYKDISNWFLSK-----ESMTPKKLQKLTYYAEAWAYALLDDGILNDTAFQAWIHSP 57

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   +++ +K +  + I+  +    +      ++ + E+++++W  Y   S  +L+ I  
Sbjct: 58  VSPELWNDYKEYGWNEIKQKVFDESK-----LDKNVLELLDAVWTTYGDKSGYELEAITH 112

Query: 130 EENKTWRRL 138
            E + W++ 
Sbjct: 113 LE-EPWKKA 120


>gi|237751053|ref|ZP_04581533.1| prophage ps3 protein [Helicobacter bilis ATCC 43879]
 gi|229373498|gb|EEO23889.1| prophage ps3 protein [Helicobacter bilis ATCC 43879]
          Length = 138

 Score =  120 bits (301), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 31/145 (21%), Positives = 58/145 (40%), Gaps = 10/145 (6%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
              VA + +    K    + +L++Q+ +Y    D + + KKS++D+  +AW+ GPV   V
Sbjct: 3   ASDVAKYILKNSSKR---LSNLELQKTLYFAEVDFIKEHKKSLIDDNFEAWQFGPVVRDV 59

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y  ++ + ++ I    D+         +    E +     +  + S   L      E   
Sbjct: 60  YMEYRDYGANSI----DVPDNQEKLDLSDAEKETIAKTIKQCNNKSYWDLVGETHREGGA 115

Query: 135 WRRLYDPNDPNTNRTITVEEITKMA 159
           W + Y        + I  E I K A
Sbjct: 116 WDKTY---QKGQKKIIDKELIRKEA 137


>gi|326565556|gb|EGE15722.1| phage-associated protein [Moraxella catarrhalis 103P14B1]
 gi|326573356|gb|EGE23324.1| phage-associated protein [Moraxella catarrhalis 101P30B1]
          Length = 217

 Score =  119 bits (299), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 61/154 (39%), Gaps = 16/154 (10%)

Query: 3   KRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEP 62
           K+       PY+ + VAN+ + + +K   P+ HLK+Q+ +Y             +++E+ 
Sbjct: 46  KKGVVMIKAPYNPMDVANYIVAEAIKREKPVTHLKLQKLLYYVVAKYAKTYNTILINEDI 105

Query: 63  QAWKQGPVFVGVYHRFKYFDSHPIEVIM--------------DLSFRIFPKIANQEIGEI 108
             W+ GPV   VYH FK      I   +              D+         ++ + + 
Sbjct: 106 VKWQYGPVVKSVYHYFKLHGDRIITKPIAYLESAEIFNLKFTDVDVNNAQLGNDKRLVDT 165

Query: 109 MESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPN 142
           +  + N     +  +L E   +E   WR  ++P 
Sbjct: 166 VGQVLNDTDLLTAYELVERTHKE-PAWRN-FEPE 197


>gi|157311186|ref|YP_001469231.1| hypothetical protein P9_gp51 [Streptococcus phage P9]
 gi|119104335|gb|ABL61080.1| hypothetical protein [Streptococcus phage P9]
          Length = 173

 Score =  119 bits (299), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 14/136 (10%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            + VAN+ I+   K   PI++LK+Q+ +Y  +   +L+    + +E  + WK GPV   V
Sbjct: 3   ALFVANYIIEYSNKKGYPINNLKLQKLLYFVNVRNILENGAPLFEESMEKWKYGPVVPDV 62

Query: 75  YHRFKYFDSHPI---EVIMDLSFRIFPKIANQEIGE----------IMESIWNKYQSHST 121
           YH +K F +  I   E+IM+         A+ EI E          ++E+      +   
Sbjct: 63  YHEYKRFGAFSISTDEMIMEYVEFSHSPFADLEITEYNPENVENTGLIENTVAALNNRDP 122

Query: 122 EQLQEIVQEENKTWRR 137
            +L  I       W++
Sbjct: 123 FELVNITHRH-TPWKK 137


>gi|326955259|gb|AEA28954.1| hypothetical protein Psed_6886 [Pseudonocardia dioxanivorans
           CB1190]
          Length = 153

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 51/123 (41%), Gaps = 12/123 (9%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            VA + + K      P+  +K+Q+ +Y      ++  ++ M   E QAW  GPV   +Y 
Sbjct: 6   DVAAYILSKHG----PMTAMKLQKLVYYCQAWHLVWAEQPMFSSEIQAWANGPVVYDLYK 61

Query: 77  RFKY-FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
             +  F  +P E+  D      P   +      +++I + Y   S   L E+   E+  W
Sbjct: 62  LHRGRFTLNPGEIPGD------PDALDGHEKYTVDAIIDAYGDKSAHWLSELTHAED-PW 114

Query: 136 RRL 138
           R  
Sbjct: 115 RNA 117


>gi|300812871|ref|ZP_07093266.1| putative toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
 gi|300496207|gb|EFK31334.1| putative toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus delbrueckii subsp. bulgaricus
           PB2003/044-T3-4]
          Length = 307

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 52/134 (38%), Gaps = 7/134 (5%)

Query: 10  NPPYSTIAVANF------FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQ 63
            P ++ + +AN+      F  +  +   P+  +K+ + +Y  +   +++    +      
Sbjct: 151 QPKFTAVQLANWLRVENYFGRELDENVEPLTQMKLIKLLYFAYGRYLVKTHNKLFTSSIV 210

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA-NQEIGEIMESIWNKYQSHSTE 122
             + GPV   V+ +FK             +F  +  ++ + +I  ++  +   Y ++S  
Sbjct: 211 HLQYGPVITEVHSKFKGLTVLDTGKPSKEAFDDYNLVSKDSDISHLLRLVNEDYINYSAS 270

Query: 123 QLQEIVQEENKTWR 136
            L +   +    W 
Sbjct: 271 GLSQKTHQPGSPWS 284


>gi|258509050|ref|YP_003171801.1| phage-related infection protein [Lactobacillus rhamnosus GG]
 gi|257148977|emb|CAR87950.1| Phage-related infection protein [Lactobacillus rhamnosus GG]
 gi|259650341|dbj|BAI42503.1| hypothetical phage protein [Lactobacillus rhamnosus GG]
          Length = 309

 Score =  119 bits (298), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 19/139 (13%), Positives = 54/139 (38%), Gaps = 7/139 (5%)

Query: 5   TFTQTNPPYSTIA------VANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSML 58
           T  + N  ++ +       V N+F  K    +  +  +K+ + +Y      + +    + 
Sbjct: 149 TSLKHNTEFTALQLTNWFRVRNYFSLKTDPNAEELTQMKVVKLLYFAFGRWIAKTGGELF 208

Query: 59  DEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA-NQEIGEIMESIWNKYQ 117
             +  A   GPV   V+ ++        + +   +F  F  +  +++I +++  + N ++
Sbjct: 209 TSKIIAMPYGPVVEDVHKKYNGRRGIVPQTLEKSAFEDFNLVQSDRKIADLLRKVDNDFR 268

Query: 118 SHSTEQLQEIVQEENKTWR 136
            ++   L  +   +   W 
Sbjct: 269 GYTAAGLVHLTHRKGSPWD 287


>gi|301300644|ref|ZP_07206833.1| hypothetical protein HMPREF9269_0365 [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|300851752|gb|EFK79447.1| hypothetical protein HMPREF9269_0365 [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 168

 Score =  118 bits (297), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 55/130 (42%), Gaps = 7/130 (5%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S +AVANF I    K   P+ +LK+Q+ ++      + +    +++     W+ GPV   
Sbjct: 9   SPMAVANFIIGVAKKEDKPVTNLKLQKVLFFLQGYCLSEYDTPLINGNFSKWRYGPVEEE 68

Query: 74  VYHRFKYFDSHPIE------VIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           VY  FKY+   PIE          + F         E  +I++ + +K     T +L  +
Sbjct: 69  VYGDFKYYGPAPIENKSIYFNKEKIEFYSEEVNLPNEFKKILQEVISKMLDVETWELVNL 128

Query: 128 VQEENKTWRR 137
               +  W+ 
Sbjct: 129 THYHSS-WKD 137


>gi|260888667|ref|ZP_05899930.1| toxin-antitoxin system, antitoxin component, Xre family
           [Selenomonas sputigena ATCC 35185]
 gi|330839922|ref|YP_004414502.1| hypothetical protein Selsp_2096 [Selenomonas sputigena ATCC 35185]
 gi|260861599|gb|EEX76099.1| toxin-antitoxin system, antitoxin component, Xre family
           [Selenomonas sputigena ATCC 35185]
 gi|329747686|gb|AEC01043.1| hypothetical protein Selsp_2096 [Selenomonas sputigena ATCC 35185]
          Length = 144

 Score =  118 bits (297), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 26/144 (18%), Positives = 52/144 (36%), Gaps = 11/144 (7%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +    A + + K  +    I   K+Q+  Y      +    K +  E+ +AW+ GPV   
Sbjct: 3   NVFDAARYILLKTGE----ISTWKLQKLCYYAQAWTLAWTGKPLFPEDFEAWRNGPVCRP 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           ++ R K        V  D            +  + ++++ + Y +    QL+     E  
Sbjct: 59  LFARHKG----MYSVTEDFLPDGNIDALTADEKDSIDTVLSAYGAMEPYQLRAQTHAE-T 113

Query: 134 TWRRLYDPND--PNTNRTITVEEI 155
            W+      D    ++  I+ E I
Sbjct: 114 PWKAARGSLDEMAFSDSVISKEAI 137


>gi|283955465|ref|ZP_06372962.1| hypothetical protein C414_000470009 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283793038|gb|EFC31810.1| hypothetical protein C414_000470009 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 143

 Score =  118 bits (296), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 30/146 (20%), Positives = 67/146 (45%), Gaps = 9/146 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S + +A + + K  K    + +L++Q+ +Y T  D + +  K ++ +E +AWK GPV   
Sbjct: 3   SALDLAKYILKKSNKE---LSNLELQKTLYFTELDYIKKFNKHLIKDEFEAWKYGPVSRE 59

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY  ++ + ++ I+            I +++  +++++  N     +   L E   ++  
Sbjct: 60  VYCEYRNYGANSIDKPEQ---ENLSGILDKDELDVIDTAINNCNQETYWDLVERSHKKGG 116

Query: 134 TWRRLYDPNDPNTNRTITVEEITKMA 159
            W + +     ++   I  E I K A
Sbjct: 117 AWEKSF---KEDSKEIIKKELIKKEA 139


>gi|326559800|gb|EGE10206.1| phage-associated protein [Moraxella catarrhalis 46P47B1]
          Length = 239

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 33/154 (21%), Positives = 61/154 (39%), Gaps = 16/154 (10%)

Query: 3   KRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEP 62
           ++       PY+ I VAN+ + + VK   P+ HLK+Q+ +Y             +++E+ 
Sbjct: 68  EKGVVMIKAPYNPIDVANYIVAEAVKREKPVTHLKLQKLLYYVVAKYAKTYNTILINEDI 127

Query: 63  QAWKQGPVFVGVYHRFKYFDSHPIEVIM--------------DLSFRIFPKIANQEIGEI 108
             W+ GPV   VYH FK      I   +              D+         ++ + + 
Sbjct: 128 VKWQYGPVVKSVYHYFKLHGDRIITKPIAYLESAEIFNLKFTDVDANNAQLGNDKRLVDA 187

Query: 109 MESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPN 142
           +  + N     +  +L E   +E   WR  ++P 
Sbjct: 188 VGQVLNDTDLLTAYELVERTHKE-PAWRN-FEPE 219


>gi|291459459|ref|ZP_06598849.1| putative prophage ps3 protein 01 [Oribacterium sp. oral taxon 078
           str. F0262]
 gi|291417916|gb|EFE91635.1| putative prophage ps3 protein 01 [Oribacterium sp. oral taxon 078
           str. F0262]
          Length = 169

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 54/149 (36%), Gaps = 14/149 (9%)

Query: 9   TNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQG 68
           T  P     +A  F+         + H K+Q+  Y      +     ++LDE  +AW  G
Sbjct: 25  TKHPGDIFDMATAFLSI-----ESMSHKKLQKLCYYAKAWYLALYDMNILDENFEAWVHG 79

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
            V   +Y R+K +    I  + + S         +E       I++ Y     ++L+ + 
Sbjct: 80  AVQPDLYQRYKIYGFSYIPKVANTSE------IPEEFLSFSREIFDSYGELDGDELERLN 133

Query: 129 QEENKTWRRLYDPNDPN--TNRTITVEEI 155
             E   W        P    N  I+ +++
Sbjct: 134 HTE-APWLNARGELKPWQNCNEVISEDDM 161


>gi|153873089|ref|ZP_02001787.1| phage-associated protein [Beggiatoa sp. PS]
 gi|152070447|gb|EDN68215.1| phage-associated protein [Beggiatoa sp. PS]
          Length = 158

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 31/151 (20%), Positives = 64/151 (42%), Gaps = 13/151 (8%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   +A + + K      P+  +K+Q+ +Y +    ++  +K + DE+ +AW  GPV   
Sbjct: 17  TVFDIARYILKK----YGPMSAMKLQKLVYYSQAWSLVWDEKPLFDEQIEAWTNGPVVRE 72

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y+  K      I+  +  S        N++  + +  +   Y   S + L +    E +
Sbjct: 73  LYNEHK--GMFLIDKTLLKSKE--KHKLNEDQKDTINEVLKAYSGKSAQWLSDQTHSE-Q 127

Query: 134 TW---RRLYDPNDPNTNRTITVEEITKMADG 161
            W   R     N+    RTIT+  + +  +G
Sbjct: 128 PWILAREGLSENERG-GRTITLASMAEYYEG 157


>gi|326570377|gb|EGE20417.1| phage-associated protein [Moraxella catarrhalis BC8]
          Length = 167

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 32/149 (21%), Positives = 59/149 (39%), Gaps = 16/149 (10%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
               PY+ I VAN+ + + +K   P+ HLK+Q+ +Y             +++E+   W+ 
Sbjct: 1   MIKAPYNPIDVANYIVAEAIKREKPVTHLKLQKLLYYVVAKYAKTYNTILINEDIVKWQY 60

Query: 68  GPVFVGVYHRFKYFDSHPIEVIM--------------DLSFRIFPKIANQEIGEIMESIW 113
           GPV   VYH FK      I   +              D+         ++ + + +  + 
Sbjct: 61  GPVVKSVYHYFKLHGDRIITKPIAYLESAEIFNLKFTDVDVNNAQLGNDKRLVDTVGQVL 120

Query: 114 NKYQSHSTEQLQEIVQEENKTWRRLYDPN 142
           N     +  +L E   +E   WR  ++P 
Sbjct: 121 NDTDLLTAYELVERTHKE-PAWRN-FEPE 147


>gi|188528286|ref|YP_001910973.1| Uncharacterized phage-associated protein [Helicobacter pylori
           Shi470]
 gi|188144526|gb|ACD48943.1| Uncharacterized phage-associated protein [Helicobacter pylori
           Shi470]
          Length = 145

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 68/149 (45%), Gaps = 6/149 (4%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +T+ +A + +    K    + +L++Q+ +Y T  D + +  K ++ ++ +AWK GPV   
Sbjct: 3   NTLELAKYILKHSNKE---LSNLELQKTLYFTELDYIKKFDKHLVSDDFEAWKYGPVARE 59

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY+ ++ + ++ I+   +       +   ++  E +     K    S   L +   +E+ 
Sbjct: 60  VYYEYRNYGANSIDKPKE---ETLSQNLREDELETINHSIKKCNEKSYWDLVKESHKEDG 116

Query: 134 TWRRLYDPNDPNTNRTITVEEITKMADGS 162
            W + +  +         +++  K A+G+
Sbjct: 117 AWHKSFKEDRKEIISKDLIKQEAKQANGN 145


>gi|110801844|ref|YP_697682.1| prophage ps3 protein 01 [Clostridium perfringens SM101]
 gi|110682345|gb|ABG85715.1| putative prophage ps3 protein 01 [Clostridium perfringens SM101]
          Length = 335

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 53/119 (44%), Gaps = 9/119 (7%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
           +V N+ + +       I  L +Q+ +Y          KK M +E  +AW  GPVF  +Y+
Sbjct: 170 SVVNYLLCEC----EDITPLALQKILYYIQGFYYAFLKKFMFEENCEAWVHGPVFRNIYY 225

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
           ++K +   PI    +   + F    ++++  I++S+      +S + L+     E   W
Sbjct: 226 KYKEYRFDPI--KEESINKQFDLSISEKV--IIDSVIKNLGCYSGKVLEAFTHAE-MPW 279


>gi|317179695|dbj|BAJ57483.1| uncharacterized phage-associated protein [Helicobacter pylori F30]
          Length = 145

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 67/149 (44%), Gaps = 6/149 (4%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           + + +A + + +  K    + +L++Q+ +Y T  D + +  K ++ ++ +AWK GPV   
Sbjct: 3   NALELAKYILKRSNKE---LSNLELQKTLYFTELDYIKKFDKHLVSDDFEAWKYGPVARE 59

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY+ ++ + ++ I+   +       +   ++  E +     K    S   L +   +E+ 
Sbjct: 60  VYYEYRNYGANSIDKPKE---ETLSQNLRKDELETINYSIEKCNEKSYWDLVKESHKEDG 116

Query: 134 TWRRLYDPNDPNTNRTITVEEITKMADGS 162
            W + +  +         ++   K A+G+
Sbjct: 117 AWHKSFKEDRKEVISKDLIKREAKQANGN 145


>gi|331092230|ref|ZP_08341058.1| hypothetical protein HMPREF9477_01701 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330401662|gb|EGG81241.1| hypothetical protein HMPREF9477_01701 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 145

 Score =  117 bits (294), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 9/145 (6%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           YS + +A + +    K   PI +L++Q+ +Y      +  + +   DEE  AW+ GPV  
Sbjct: 3   YSALNIAKYVVTFCFKRGNPISNLQLQKILYYIQGYSLALRDEEAFDEEIVAWQYGPVIK 62

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            VY  F  + + PIE    +      +I +QE  +++  I     +    +L E    E 
Sbjct: 63  AVYDFFSIYAAMPIENSFRI------EIEDQEFEKMIRVIALDKMNIPVWKLVEQTHNE- 115

Query: 133 KTWRRLYDPNDPNTNRTITVEEITK 157
             W+  Y          I  E I +
Sbjct: 116 APWK--YTTELFGMGSVIPKEYIRR 138


>gi|208435383|ref|YP_002267049.1| hypothetical protein HPG27_1440 [Helicobacter pylori G27]
 gi|208433312|gb|ACI28183.1| hypothetical protein HPG27_1440 [Helicobacter pylori G27]
          Length = 145

 Score =  117 bits (293), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 27/149 (18%), Positives = 68/149 (45%), Gaps = 6/149 (4%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +T+ +A + +    K    + +L++Q+ +Y T  D + +  K ++ ++ +AWK GPV   
Sbjct: 3   NTLELAKYILKHSNKE---LSNLELQKTLYFTELDYIKKFDKHLVSDDFEAWKYGPVARE 59

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY+ ++ + ++ I+   +       +   ++  E +     K    S   L +   +E+ 
Sbjct: 60  VYYEYRNYGANSIDKPKE---ESLSQNLRKDELETINRSIEKCNKKSYWDLVKESHKEDG 116

Query: 134 TWRRLYDPNDPNTNRTITVEEITKMADGS 162
            W + +  +         +++  K A+G+
Sbjct: 117 AWHKSFKEDGKEIISKGLIKQEAKQANGN 145


>gi|237709229|ref|ZP_04539710.1| phage-associated protein [Bacteroides sp. 9_1_42FAA]
 gi|237726530|ref|ZP_04557011.1| phage-associated protein [Bacteroides sp. D4]
 gi|256840936|ref|ZP_05546444.1| phage-associated protein [Parabacteroides sp. D13]
 gi|270295253|ref|ZP_06201454.1| phage-associated protein [Bacteroides sp. D20]
 gi|282877647|ref|ZP_06286462.1| conserved hypothetical protein [Prevotella buccalis ATCC 35310]
 gi|294776637|ref|ZP_06742106.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
 gi|299148741|ref|ZP_07041803.1| toxin-antitoxin system, antitoxin component, Xre family
           [Bacteroides sp. 3_1_23]
 gi|301309629|ref|ZP_07215570.1| toxin-antitoxin system, antitoxin component, Xre family
           [Bacteroides sp. 20_3]
 gi|317475394|ref|ZP_07934658.1| hypothetical protein HMPREF1016_01640 [Bacteroides eggerthii
           1_2_48FAA]
 gi|325299634|ref|YP_004259551.1| phage-associated protein [Bacteroides salanitronis DSM 18170]
 gi|229435056|gb|EEO45133.1| phage-associated protein [Bacteroides dorei 5_1_36/D4]
 gi|229456925|gb|EEO62646.1| phage-associated protein [Bacteroides sp. 9_1_42FAA]
 gi|256738208|gb|EEU51534.1| phage-associated protein [Parabacteroides sp. D13]
 gi|270274500|gb|EFA20361.1| phage-associated protein [Bacteroides sp. D20]
 gi|281300219|gb|EFA92573.1| conserved hypothetical protein [Prevotella buccalis ATCC 35310]
 gi|294449552|gb|EFG18083.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
 gi|298513502|gb|EFI37389.1| toxin-antitoxin system, antitoxin component, Xre family
           [Bacteroides sp. 3_1_23]
 gi|300832373|gb|EFK63002.1| toxin-antitoxin system, antitoxin component, Xre family
           [Bacteroides sp. 20_3]
 gi|316908422|gb|EFV30112.1| hypothetical protein HMPREF1016_01640 [Bacteroides eggerthii
           1_2_48FAA]
 gi|324319187|gb|ADY37078.1| phage-associated protein [Bacteroides salanitronis DSM 18170]
          Length = 159

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 59/148 (39%), Gaps = 6/148 (4%)

Query: 14  STIAVANFFIDKGVKYSI--PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           S   + ++ I +         + +LK+Q+ +Y          KK M D E +AW  GPV 
Sbjct: 3   SIHDITDYIILRVKSEDRFASLINLKLQKLLYYVQAWSYGINKKPMFDGEFEAWIHGPVN 62

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             +Y+RF        E+ +D          + E  E ++ I   Y  +S  +L+ +   E
Sbjct: 63  REIYNRFNSTKYLYSEINID-DCMNHNVSLSSEDAEFIDFILENYLKYSGAELERLSHNE 121

Query: 132 NKTWRRLYDPNDPN--TNRTITVEEITK 157
              W       + N   ++ IT E + +
Sbjct: 122 -MPWIETRGDLNVNERCDKVITPELMIE 148


>gi|119668697|emb|CAL23835.1| hypothetical mobile element-associated protein [Staphylococcus
           aureus]
          Length = 244

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 31/165 (18%), Positives = 68/165 (41%), Gaps = 22/165 (13%)

Query: 4   RTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQ 63
           +   ++    + + +A + +        P   LK+Q+ +Y+ +    L +K  +  E   
Sbjct: 82  KNVAKSPHGLNAMDIARYILML-----KPTTPLKLQKLLYIVYERYFLNRKIELFKERFL 136

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMD-------------LSFRIFPKIANQEIGEIME 110
           A+  GPV   VY  ++   S  +    D             ++++IF +  ++ I  +++
Sbjct: 137 AFDYGPVVKEVYSVYRGQ-SDVLTEKDDQSVYSVISNATTPITYKIFREEDSEYISSLIK 195

Query: 111 SIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
            + ++Y   S   + E   ++N  W + Y       N  ITV+ I
Sbjct: 196 DVIDEYDGVSAWDMVEKTHKKNTAWDKAY---KLGQNSPITVDLI 237


>gi|227530350|ref|ZP_03960399.1| phage associated protein [Lactobacillus vaginalis ATCC 49540]
 gi|227349730|gb|EEJ40021.1| phage associated protein [Lactobacillus vaginalis ATCC 49540]
          Length = 307

 Score =  117 bits (292), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 17/136 (12%), Positives = 52/136 (38%), Gaps = 7/136 (5%)

Query: 8   QTNPPYSTIAVANF------FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
           +  P ++ + +AN+      F         P+  +K+ + +Y+ +   +   +  +    
Sbjct: 149 KEKPKFTAVQLANWLRVENYFERDSDLNIDPLTQMKVIKLLYIAYGRFLAATRNKLFSST 208

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIMESIWNKYQSHS 120
              ++ GP+   V+ +F       I+     +   +  +  + EI +++  +   Y +++
Sbjct: 209 IVHFQYGPLITEVHDKFNGQSVLDIDKPDKEAMDDYNLVSQDGEIVDLLSKVNEDYINYN 268

Query: 121 TEQLQEIVQEENKTWR 136
             +L +        W 
Sbjct: 269 AARLSKQTHRPGSPWD 284


>gi|315227132|ref|ZP_07868919.1| conserved hypothetical protein [Parascardovia denticolens DSM
           10105]
 gi|315119582|gb|EFT82715.1| conserved hypothetical protein [Parascardovia denticolens DSM
           10105]
          Length = 161

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 58/156 (37%), Gaps = 10/156 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           + + VA++ +         +  +K+Q+  Y +    ++   + + DE+ QAW  GPV   
Sbjct: 9   TVVDVASYIL----NNYGSLTTMKLQKLAYYSQAQSLVMTGRPLFDEDFQAWMNGPVVPS 64

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           ++   K           +      P+  + E   I++++ +     +  +L     +E+ 
Sbjct: 65  LFRLHKGRFFVDPGFFDEFGS---PEKLSDEQKSIIDAVSSVLVRQTGRELSARTHDED- 120

Query: 134 TWRRLYDPNDPN--TNRTITVEEITKMADGSNISPE 167
            W+       P       IT   I      + + PE
Sbjct: 121 PWKDARGDCKPGDFCQTVITKAVIKDYYSKNPVIPE 156


>gi|294787309|ref|ZP_06752562.1| putative toxin-antitoxin system, antitoxin component, Xre family
           [Parascardovia denticolens F0305]
 gi|294484665|gb|EFG32300.1| putative toxin-antitoxin system, antitoxin component, Xre family
           [Parascardovia denticolens F0305]
          Length = 155

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 58/156 (37%), Gaps = 10/156 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           + + VA++ +         +  +K+Q+  Y +    ++   + + DE+ QAW  GPV   
Sbjct: 3   TVVDVASYIL----NNYGSLTTMKLQKLAYYSQAQSLVMTGRPLFDEDFQAWMNGPVVPS 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           ++   K           +      P+  + E   I++++ +     +  +L     +E+ 
Sbjct: 59  LFRLHKGRFFVDPGFFDEFGS---PEKLSDEQKSIIDAVSSVLVRQTGRELSARTHDED- 114

Query: 134 TWRRLYDPNDPN--TNRTITVEEITKMADGSNISPE 167
            W+       P       IT   I      + + PE
Sbjct: 115 PWKDARGDCKPGDFCQTVITKAVIKDYYSKNPVIPE 150


>gi|225870235|ref|YP_002746182.1| phage protein [Streptococcus equi subsp. equi 4047]
 gi|225699639|emb|CAW93312.1| hypothetical phage protein [Streptococcus equi subsp. equi 4047]
          Length = 180

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 66/142 (46%), Gaps = 21/142 (14%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            + VAN+ I+    +++ I++L+IQ+ +Y  +   +++    +  ++ + WK GPV   V
Sbjct: 4   ALFVANYIIEYCNDHNLEINNLRIQKLLYFINARNLVENGSPLFQDKIEKWKFGPVVPKV 63

Query: 75  YHRFKYFDSHPIEV------IMDLSFRIFP--------------KIANQEIGEIMESIWN 114
           YH +K F +  I        I   +F + P              +  +    +++ES   
Sbjct: 64  YHEYKRFGASTITKDDISAQIWKFNFEVSPFGEESPIEVLTYNKEEFSDSQIQLIESTIL 123

Query: 115 KYQSHSTEQLQEIVQEENKTWR 136
             + +ST +L ++  E++  W+
Sbjct: 124 ALKKYSTFKLVDLTHEDDM-WK 144


>gi|238855367|ref|ZP_04645679.1| prophage ps3 protein 01 [Lactobacillus jensenii 269-3]
 gi|260664917|ref|ZP_05865768.1| prophage ps3 protein 01 [Lactobacillus jensenii SJ-7A-US]
 gi|282934597|ref|ZP_06339844.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
 gi|313472536|ref|ZP_07813026.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 1153]
 gi|238832028|gb|EEQ24353.1| prophage ps3 protein 01 [Lactobacillus jensenii 269-3]
 gi|239529971|gb|EEQ68972.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 1153]
 gi|260561400|gb|EEX27373.1| prophage ps3 protein 01 [Lactobacillus jensenii SJ-7A-US]
 gi|281301349|gb|EFA93646.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
          Length = 183

 Score =  116 bits (291), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 22/131 (16%), Positives = 56/131 (42%), Gaps = 8/131 (6%)

Query: 13  YSTIAVANFFIDKGVK-------YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAW 65
           Y+   V N+F  K V+        + P+  +K+ + +Y      +++  + + D +  AW
Sbjct: 2   YNVFKVVNWFRLKNVEELVSEDVNAEPLTQMKVMKLLYYAQATFLVKYGQRLFDSDILAW 61

Query: 66  KQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
           K GPV   V+ +++        +  +         +++   +++ +++  + S+S   L 
Sbjct: 62  KFGPVVAEVHDKYRGRRIIVESISYEAYQDFSTLESDKRASQVLNAVYIAFGSYSASTLM 121

Query: 126 EIVQEENKTWR 136
           +    E   W+
Sbjct: 122 KKTHTE-MPWK 131


>gi|83319679|ref|YP_424466.1| hypothetical protein MCAP_0493 [Mycoplasma capricolum subsp.
           capricolum ATCC 27343]
 gi|83283565|gb|ABC01497.1| hypothetical protein MCAP_0493 [Mycoplasma capricolum subsp.
           capricolum ATCC 27343]
          Length = 131

 Score =  116 bits (290), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 51/126 (40%), Gaps = 9/126 (7%)

Query: 33  IDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGPVFVGVYHRFKYFDSHPIEVIMD 91
           +   K+Q+  Y           + +L +   QAW  GPV   ++  +K +  + I    +
Sbjct: 1   MTPKKLQKLTYYAEAWAYALFDEGILSDTSFQAWIHGPVSPELWRDYKNYGWNEIPKKEN 60

Query: 92  LSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPND--PNTNRT 149
             ++      ++   E+++++W+ Y   +  +L+ I   E   W       +    + + 
Sbjct: 61  NDYK-----LDKNTLELLDAVWSTYGERTGYELEAISHSE-TPWINARKGLEELEASTKL 114

Query: 150 ITVEEI 155
           I  E++
Sbjct: 115 IKPEDM 120


>gi|325996551|gb|ADZ51956.1| Uncharacterized phage-associated protein [Helicobacter pylori 2018]
 gi|325998140|gb|ADZ50348.1| putative phage-associated protein [Helicobacter pylori 2017]
          Length = 148

 Score =  115 bits (289), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 29/141 (20%), Positives = 58/141 (41%), Gaps = 12/141 (8%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            +  A   I+  +    PI +LK+Q+ +Y+   +        ++ E+ QAW  GPV   V
Sbjct: 3   ALDAAKILINLSLDNQKPITNLKLQKMLYIAQAES----DSKLIKEDFQAWDYGPVIPDV 58

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y  F    S PI    ++     P   ++E  + +  I+N+Y+      +     ++   
Sbjct: 59  YRNFCINGSTPITKREEI-----PNNIDREKEKELAKIYNQYKDADAWNMVRATHQKESA 113

Query: 135 WRRLYDPNDPNTNRTITVEEI 155
           W + +        + I  ++I
Sbjct: 114 WSKHHV---KGMRKVIKRDDI 131


>gi|259503003|ref|ZP_05745905.1| xre family toxin-antitoxin system [Lactobacillus antri DSM 16041]
 gi|259169041|gb|EEW53536.1| xre family toxin-antitoxin system [Lactobacillus antri DSM 16041]
          Length = 307

 Score =  115 bits (289), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 17/136 (12%), Positives = 53/136 (38%), Gaps = 7/136 (5%)

Query: 8   QTNPPYSTIAVANF------FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
           +  P ++ + +AN+      F         P+  +K+ + +Y+ +   ++  +  +    
Sbjct: 149 KEQPKFTAVQLANWLRVENYFERDSNLNIDPLTQMKVIKLLYIAYGRFLVATRNKLFSST 208

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIMESIWNKYQSHS 120
              ++ GP+   V+ +F       I+     +   +  +  + EI +++  +   Y +++
Sbjct: 209 IVHFQYGPLVTEVHDKFNGQTVLDIDKPDKEAMDDYSLVSQDSEIVDLLSKVNEDYINYN 268

Query: 121 TEQLQEIVQEENKTWR 136
             +L +        W 
Sbjct: 269 AARLSKQTHRAGSPWD 284


>gi|291561172|emb|CBL39971.1| Uncharacterized phage-associated protein [butyrate-producing
           bacterium SS3/4]
          Length = 148

 Score =  115 bits (289), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 23/105 (21%), Positives = 46/105 (43%), Gaps = 7/105 (6%)

Query: 32  PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMD 91
            + + KIQ+  Y  +   +    + +   + +AW  GPV   +YH +K +    I     
Sbjct: 16  SMSNKKIQKICYYAYSWYLTLYGEQLAPFQFEAWVHGPVSRELYHYYKSYGWSDIPQYHG 75

Query: 92  LSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
           L       + + E+      IW  Y S+S ++L+++  +E   W+
Sbjct: 76  L------VMVDNEMAAFARKIWTLYGSYSADELEQMSHKEY-PWQ 113


>gi|300362024|ref|ZP_07058201.1| XRE family transcriptional regulator [Lactobacillus gasseri JV-V03]
 gi|300354643|gb|EFJ70514.1| XRE family transcriptional regulator [Lactobacillus gasseri JV-V03]
          Length = 156

 Score =  115 bits (288), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 13  YSTIAVANFFIDKGVKY------SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
           Y    + N+   +          +  +  +K  + +Y      ++   K M D +  AWK
Sbjct: 2   YDVFKIVNWLRVRNNADLRTDLNAEELTQMKAMKLLYYIQAASLVVTNKRMFDNDIVAWK 61

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA-NQEIGEIMESIWNKYQSHSTEQLQ 125
            GPV   V+H++       +  I       + ++  + E   I+ SI++ Y   S   L 
Sbjct: 62  YGPVVEEVHHKYAGC-RGIVGQISKQDVEDYKELENDDEAAAILNSIYDTYGHSSAYDLM 120

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
                E + W+      +   N+ I+ ++I
Sbjct: 121 RQTHSE-RPWQ------ETTRNQVISDKKI 143


>gi|256851089|ref|ZP_05556478.1| prophage ps3 protein 01 [Lactobacillus jensenii 27-2-CHN]
 gi|260660513|ref|ZP_05861428.1| prophage ps3 protein 01 [Lactobacillus jensenii 115-3-CHN]
 gi|282933745|ref|ZP_06339100.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
 gi|297205953|ref|ZP_06923348.1| XRE family transcriptional regulator [Lactobacillus jensenii
           JV-V16]
 gi|256616151|gb|EEU21339.1| prophage ps3 protein 01 [Lactobacillus jensenii 27-2-CHN]
 gi|260548235|gb|EEX24210.1| prophage ps3 protein 01 [Lactobacillus jensenii 115-3-CHN]
 gi|281302124|gb|EFA94371.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
 gi|297149079|gb|EFH29377.1| XRE family transcriptional regulator [Lactobacillus jensenii
           JV-V16]
          Length = 183

 Score =  115 bits (288), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 25/162 (15%), Positives = 64/162 (39%), Gaps = 14/162 (8%)

Query: 13  YSTIAVANFFIDKGVK-------YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAW 65
           Y+   V N+F  K V+          P+  +K+ + +Y      +++  + + D +  AW
Sbjct: 2   YNVFKVVNWFRLKNVEELVSEDVNVEPLTQMKVMKLLYYAQATFLVKYGQRLFDSDILAW 61

Query: 66  KQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
           K GPV   V+ +++   +    +  +         ++    +++ +++  + S+S   L 
Sbjct: 62  KFGPVIAEVHDKYRGKRNIVESISYEAYQDFNTLESDIRASQVLNAVYIAFGSYSASTLM 121

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPE 167
           +    E   W+        +    I  +++ K    + +  E
Sbjct: 122 KKTHTE-MPWK------STSQGAKIEDDKMEKFYKETGLDTE 156


>gi|217031865|ref|ZP_03437368.1| hypothetical protein HPB128_199g73 [Helicobacter pylori B128]
 gi|298735512|ref|YP_003728033.1| hypothetical protein HPB8_12 [Helicobacter pylori B8]
 gi|216946517|gb|EEC25119.1| hypothetical protein HPB128_199g73 [Helicobacter pylori B128]
 gi|298354697|emb|CBI65569.1| conserved hypothetical protein [Helicobacter pylori B8]
          Length = 145

 Score =  115 bits (288), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 26/150 (17%), Positives = 67/150 (44%), Gaps = 9/150 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           + + +A + +    K    + +L++Q+ +Y T  D + +  K ++ ++ +AW+ G V   
Sbjct: 3   NALELAKYILKHSDKE---LSNLELQKTLYFTELDYIKKFDKHLVSDDFEAWRYGSVARE 59

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY+ ++ + ++PI+   +       +   ++  E +     K    S   L +   +E+ 
Sbjct: 60  VYYEYRNYGANPIDKPKE---ETLSQNLRKDELETINRSIEKCNKKSYWDLVKESHKEDG 116

Query: 134 TWRRLYDPNDPNTNRTITVEEITKMADGSN 163
            W + +     +    I+ + I + A  +N
Sbjct: 117 AWHKSF---KEDRKEIISKDLIRQEAKQTN 143


>gi|167757363|ref|ZP_02429490.1| hypothetical protein CLORAM_02913 [Clostridium ramosum DSM 1402]
 gi|167703538|gb|EDS18117.1| hypothetical protein CLORAM_02913 [Clostridium ramosum DSM 1402]
          Length = 182

 Score =  115 bits (288), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 49/129 (37%), Gaps = 7/129 (5%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
              Y  + ++   I    +  + I +L++Q+ +Y    + + +  K    +  + W+ GP
Sbjct: 42  KSKYDALELSKKVISLAEENGLYISNLQLQKVMYYIQGNFMKEFNKKAFLDNIECWEYGP 101

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V   ++  F  +   PI  I             ++   ++ SI     S +  +L +   
Sbjct: 102 VIKKIWSTFNVYGRSPIRGINS------QLNITEDEKCLIISILKDKLSMNVWRLVDETH 155

Query: 130 EENKTWRRL 138
           +E   W+  
Sbjct: 156 DE-LPWKNA 163


>gi|254227208|ref|ZP_04920709.1| conserved hypothetical protein [Vibrio cholerae V51]
 gi|125620267|gb|EAZ48700.1| conserved hypothetical protein [Vibrio cholerae V51]
          Length = 105

 Score =  115 bits (288), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 50/112 (44%), Gaps = 7/112 (6%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
            +    YS + VA   +    +      +L++Q+  Y+ H   +   ++ ++ ++  AWK
Sbjct: 1   MKAYHTYSAVDVAWSLLKHAKEQGKCFSNLQLQKLTYVCHGLSLAHFQRPLVVDDVFAWK 60

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQS 118
            GPV   VY RFK + S+ I    D+       + + E   I++ + ++   
Sbjct: 61  FGPVVPSVYFRFKSYGSNVITEQCDV-------VLDHESESIVKDVVSQLGH 105


>gi|15673914|ref|NP_268089.1| prophage ps3 protein 01 [Lactococcus lactis subsp. lactis Il1403]
 gi|281492411|ref|YP_003354391.1| phage Cro/CI transcriptional regulator [Lactococcus lactis subsp.
           lactis KF147]
 gi|12724972|gb|AAK06030.1|AE006424_1 prophage ps3 protein 01 [Lactococcus lactis subsp. lactis Il1403]
 gi|281376075|gb|ADA65566.1| Phage protein, transcriptional regulator, Cro/CI family
           [Lactococcus lactis subsp. lactis KF147]
          Length = 306

 Score =  115 bits (287), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 59/151 (39%), Gaps = 15/151 (9%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
             + N  + K  +Y   +  +K+ + +Y      +    K +      AWK GPV   +Y
Sbjct: 158 FRIKNIILQKSDEYVEDLTQMKVMKLVYYAQAVSLHWYGKPLFSNPILAWKHGPVVQEIY 217

Query: 76  HRFKYFDSHPI------EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           + +    S+ I      E+  +L         N+++ +++  +  +  S+S   L++   
Sbjct: 218 NEY--HGSYSIVEDLRSEIPEELLKNYNELSVNKKMSKVLNFVQEQLGSYSAWTLRDKTH 275

Query: 130 EENKTWRRLYDPNDPNTNRTITVEEITKMAD 160
            E + W       +   +  I+ + I K  D
Sbjct: 276 NE-EPW------INTIQSSVISNKSIKKYFD 299


>gi|13095679|ref|NP_076800.1| Orf21 [Lactococcus phage bIL311]
 gi|12831101|gb|AAK08453.1|AF323672_21 Orf21 [Lactococcus phage bIL311]
          Length = 306

 Score =  114 bits (286), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 59/151 (39%), Gaps = 15/151 (9%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
             + N  + K  +Y   +  +K+ + +Y      +    K +      AWK GPV   +Y
Sbjct: 158 FRIKNIILQKSDEYVEDLTQMKVMKLVYYAQAVSLHWYGKPLFSNPILAWKHGPVVQEIY 217

Query: 76  HRFKYFDSHPI------EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           + +    S+ I      E+  +L         N+++ +++  +  +  S+S   L++   
Sbjct: 218 NEY--HGSYSIVEDLRSEIPEELLKNYNELSVNKKMSKVLNFVQEQLGSYSAWTLRDKTH 275

Query: 130 EENKTWRRLYDPNDPNTNRTITVEEITKMAD 160
            E + W       +   +  I+ + I K  D
Sbjct: 276 NE-EPW------INTIQSSVISNKSIKKYFD 299


>gi|315037425|ref|YP_004030993.1| phage Cro/CI transcriptional regulator [Lactobacillus amylovorus
           GRL 1112]
 gi|312275558|gb|ADQ58198.1| phage Cro/CI transcriptional regulator [Lactobacillus amylovorus
           GRL 1112]
          Length = 157

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/151 (19%), Positives = 58/151 (38%), Gaps = 15/151 (9%)

Query: 13  YSTIAVANFFIDKGVKY------SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
           Y+   V N+   +          +  +  +K  + +Y      ++   K M D +  AWK
Sbjct: 2   YNVFQVVNWLRVRNNADLRIDPNAEELTQMKAMKLLYYIQAASLVFTGKRMFDNDIVAWK 61

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLS-FRIFPKIANQE-IGEIMESIWNKYQSHSTEQL 124
            GPV   V++++K       ++  D      +  + N + +  I+ +I++ Y   S   L
Sbjct: 62  YGPVVTEVHNKYKGQRGIVGDIGNDPQALEDYKTLQNDKGVSYILNNIYDIYGHSSAHDL 121

Query: 125 QEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
                 E K W+      D   +  I+ + I
Sbjct: 122 MVQTHSE-KPWQ------DTPQSSVISDQAI 145


>gi|288904688|ref|YP_003429909.1| phage-associated protein [Streptococcus gallolyticus UCN34]
 gi|288731413|emb|CBI12965.1| putative phage-associated protein [Streptococcus gallolyticus
           UCN34]
          Length = 179

 Score =  114 bits (285), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 62/142 (43%), Gaps = 20/142 (14%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            + VAN+ I+   + +  I++LK+Q+ +Y  +   +L+    + +E  + WK GPV   V
Sbjct: 4   ALFVANYIIEYSNERNYEINNLKLQKLLYFINARCLLENDVPIFEESFEKWKFGPVVPQV 63

Query: 75  YHRFKYFDSHPIEVI----------------MDLSFRIFPKIANQEI---GEIMESIWNK 115
           YH +K F +  I                    +   +I  +  +       E+++S  + 
Sbjct: 64  YHEYKGFGAFNIPKSDIVREKHTIDFGRNPFENNKLKISTEYYDSNDIQHKELIQSTVDS 123

Query: 116 YQSHSTEQLQEIVQEENKTWRR 137
            +  +  +L E   E+N  W++
Sbjct: 124 LKGFTPFELVENTHEQN-IWKK 144


>gi|153952144|ref|YP_001398842.1| prophage ps3 protein 01 [Campylobacter jejuni subsp. doylei 269.97]
 gi|152939590|gb|ABS44331.1| prophage ps3 protein 01 [Campylobacter jejuni subsp. doylei 269.97]
          Length = 165

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/151 (24%), Positives = 61/151 (40%), Gaps = 9/151 (5%)

Query: 15  TIAVANFFI-----DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
            I VA + I           S  +  LK+Q+ +Y +         K + DEE +AW+ GP
Sbjct: 3   AIDVAKYLIAVNEQKNSDDESNSLSKLKLQKLLYYSQGYYSALYNKPLFDEEIRAWEHGP 62

Query: 70  VFVGVYHRFKYFDSHPIEVI-MDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           V   VY  FK  + + I     ++      K  + E  E +  ++     +S  +L+E  
Sbjct: 63  VVKEVYDHFKNLNGNIIPASRENIPNEQELKNMSSEQQETINEVYELMGQYSAWKLREKT 122

Query: 129 QEENKTWRRLYDPNDP--NTNRTITVEEITK 157
             E   W   YD  +   +    I+ E+I K
Sbjct: 123 HSE-SPWLETYDEKNKMNDEKNIISKEKIKK 152


>gi|325289327|ref|YP_004265508.1| phage-associated protein-like protein [Syntrophobotulus glycolicus
           DSM 8271]
 gi|324964728|gb|ADY55507.1| phage-associated protein-like protein [Syntrophobotulus glycolicus
           DSM 8271]
          Length = 332

 Score =  113 bits (283), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 57/140 (40%), Gaps = 11/140 (7%)

Query: 18  VANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR 77
           V ++ + +       I  L +Q+ +Y          +  +  E+ +AW  GP +  +Y R
Sbjct: 172 VVDYLLSRCQ----DITPLSLQKALYYAQGFFYAFYRTYLFTEDCEAWVHGPAYPKIYRR 227

Query: 78  FKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW-- 135
           +  +   PIE + ++         + E   +++SI      +S + L+     E   W  
Sbjct: 228 YSNYCFDPIEGVDEVEAS----ALSGEDQLLLDSIVKHVCCYSGKTLEAFTHTE-TPWVL 282

Query: 136 RRLYDPNDPNTNRTITVEEI 155
            R   P +  +NR +T E I
Sbjct: 283 ARAGLPAEALSNRPVTKESI 302


>gi|325000070|ref|ZP_08121182.1| hypothetical protein PseP1_14940 [Pseudonocardia sp. P1]
          Length = 135

 Score =  113 bits (282), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 54/130 (41%), Gaps = 8/130 (6%)

Query: 36  LKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFR 95
           +K+Q+  Y +    ++ ++  + D E +AW  GPV   VY  +K           D    
Sbjct: 1   MKLQKLCYYSQAWHLVWREIPLFDSEVEAWANGPV---VYDLYKLHRGKFTLSGPDDIRG 57

Query: 96  IFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD----PNDPNTNRTIT 151
             P+  ++     +E++ + Y   S   L E+   E+  WR   +     +    N  I+
Sbjct: 58  GNPEALDEHERFAIETVLDAYGDKSAHWLSELTHAED-PWRLAREQEGLADRERGNAVIS 116

Query: 152 VEEITKMADG 161
           ++ + +  DG
Sbjct: 117 LDSMFEYYDG 126


>gi|223984060|ref|ZP_03634216.1| hypothetical protein HOLDEFILI_01508 [Holdemania filiformis DSM
           12042]
 gi|223963979|gb|EEF68335.1| hypothetical protein HOLDEFILI_01508 [Holdemania filiformis DSM
           12042]
          Length = 335

 Score =  112 bits (281), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 30/164 (18%), Positives = 63/164 (38%), Gaps = 20/164 (12%)

Query: 32  PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMD 91
            I  L +Q+ +Y           + +  E  +AW  GPV+  +Y+R++ +   PI     
Sbjct: 183 DITPLTLQKALYYIQGFYYAFHNEFLFSENCEAWIHGPVYRDIYNRYRTYHFDPIIPCAP 242

Query: 92  LSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD--PNDPNTNRT 149
           L          +    ++  +   +  +  + L++   +E+  W       P   +  R 
Sbjct: 243 L----VSPAMTEVEAAVINCVVQYFCCYGGKTLEQFTHQED-PWLNARKDLPKLTSARRI 297

Query: 150 ITVEEI----TKMADGSNIS-PENVVEQIKKPVRFDSDSEFATL 188
           I  E I     ++ +  N+  PE+        +RF ++  F T+
Sbjct: 298 IPKESIGDYFMRLKEKYNMEKPED--------IRFYAEDRFLTI 333


>gi|194466406|ref|ZP_03072393.1| phage protein [Lactobacillus reuteri 100-23]
 gi|194453442|gb|EDX42339.1| phage protein [Lactobacillus reuteri 100-23]
          Length = 192

 Score =  112 bits (281), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/142 (23%), Positives = 54/142 (38%), Gaps = 16/142 (11%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
             PY+ + VANF +D   K   PI ++ + + +Y      +    K +  E  + W  GP
Sbjct: 24  KKPYNAMDVANFLVDFFNKKGTPITNIMLLKILYYLQAFYLT-HDKKLFVENIEKWGYGP 82

Query: 70  VFVGVYHRFKYFDSHPIEVIM-------------DLSFRIFPKIANQEIGEIMESIWNKY 116
           V   VY  FK   +  I                 D S R   +   ++I  I   I+ +Y
Sbjct: 83  VVPVVYSYFKDNGAATITKTESYVVKNDDELLLLDPSMRKLDEADEKKISWIANKIFERY 142

Query: 117 QSHSTEQLQEIVQEENKTWRRL 138
             ++  +L E+   E   W   
Sbjct: 143 -HNNPFELVEVTHREPM-WSES 162


>gi|255034589|ref|YP_003085210.1| phage-associated protein [Dyadobacter fermentans DSM 18053]
 gi|254947345|gb|ACT92045.1| phage-associated protein [Dyadobacter fermentans DSM 18053]
          Length = 165

 Score =  111 bits (279), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 25/136 (18%), Positives = 53/136 (38%), Gaps = 13/136 (9%)

Query: 32  PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFK-------YFDSH 84
            + HLK+Q+ +Y      +   +  + +++ +AW  GPV   V+   K            
Sbjct: 26  DMSHLKLQKLLYYAQAYHLAYFENPLTEDDFEAWVHGPVSRKVFDLLKDKSLLYVDLKYV 85

Query: 85  PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW---RRLYDP 141
           P E     +  + P    +E  + +  +  ++   S  +L+ +   E   W   R+ ++P
Sbjct: 86  PEEGTQSPAGYLQP-SLTKEQIDWVNYVLGEFSGLSGPELEALTHSE-APWIDARKGFEP 143

Query: 142 NDPNTNRTITVEEITK 157
            D   N  I    + +
Sbjct: 144 ADR-CNNIIPKPAMAE 158


>gi|293189228|ref|ZP_06607951.1| hypothetical protein HMPREF0970_00262 [Actinomyces odontolyticus
           F0309]
 gi|292821691|gb|EFF80627.1| hypothetical protein HMPREF0970_00262 [Actinomyces odontolyticus
           F0309]
          Length = 177

 Score =  111 bits (279), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 27/145 (18%), Positives = 57/145 (39%), Gaps = 13/145 (8%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S + VA + +++       +  +K+Q+  + +    + Q   S+  E+ +AW+ GPV   
Sbjct: 32  SIVDVATYILERTG----TVTTMKLQKLAFYSQAQHLAQYGSSLFPEDFEAWRGGPVAPE 87

Query: 74  VYHRFKY-FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
           +Y   +  F   P E+                   +++S+ +     +  +L E    E 
Sbjct: 88  LYALHRGMFLIRPGEL-----VSGGSSALTDAERALIDSVCSALGDMTGAELSERTHLE- 141

Query: 133 KTWRRLYDPNDPN--TNRTITVEEI 155
             W    +   P+  +N  IT E +
Sbjct: 142 SPWLDAREGLAPSVPSNAVITQEAM 166


>gi|322388275|ref|ZP_08061879.1| phage-associated protein family protein [Streptococcus infantis
           ATCC 700779]
 gi|321140947|gb|EFX36448.1| phage-associated protein family protein [Streptococcus infantis
           ATCC 700779]
          Length = 332

 Score =  111 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/142 (21%), Positives = 59/142 (41%), Gaps = 10/142 (7%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
             V ++ + K  +    I  L +Q+ +Y         KK  +   + +AW  GPV+  VY
Sbjct: 166 TQVIHYLLSKNNE----ITPLALQKLLYYVQGFYFAFKKDYIFLSDCEAWVHGPVYRDVY 221

Query: 76  HRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
            ++  F  +PI++ ++ +              +++SI   +   + + L+E   EE + W
Sbjct: 222 FKYSSFGYNPIQLNLNSNPGDGLTFF---ERSLIDSILKNFAIFNGKVLEEFTHEE-EPW 277

Query: 136 --RRLYDPNDPNTNRTITVEEI 155
              R     +  +N  I  E I
Sbjct: 278 LTMRGDSKAEEPSNEVIPKELI 299


>gi|227543484|ref|ZP_03973533.1| prophage ps3 protein 01 [Lactobacillus reuteri CF48-3A]
 gi|300910156|ref|ZP_07127616.1| XRE family transcriptional regulator [Lactobacillus reuteri SD2112]
 gi|77745371|gb|ABB02586.1| uncharacterized phage-associated protein [Lactobacillus reuteri]
 gi|227186508|gb|EEI66579.1| prophage ps3 protein 01 [Lactobacillus reuteri CF48-3A]
 gi|300892804|gb|EFK86164.1| XRE family transcriptional regulator [Lactobacillus reuteri SD2112]
          Length = 159

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/165 (21%), Positives = 60/165 (36%), Gaps = 16/165 (9%)

Query: 13  YSTIAVANFFIDKGVK------YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
           Y    V N+   +             +  +K+ + +Y      +    K M D +  AWK
Sbjct: 2   YDVFKVVNWLRVRNNADMRQNPNIEELSQMKVMKLLYYIQAASLSISGKRMFDNDIVAWK 61

Query: 67  QGPVFVGVYHRF---KYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
            GPV   V+ ++   +   +    +            A+++   I+ SI++ Y   S   
Sbjct: 62  YGPVVEAVHRKYSGCRGIVNSNYPITPQDLEDYKELQADEQASSILNSIYDVYGYSSAYD 121

Query: 124 LQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPEN 168
           L      E K W++      P+ NR I  + I     G  IS EN
Sbjct: 122 LMRQTHSE-KPWQQT-----PH-NRVIKDKYIKDFYSGVFISDEN 159


>gi|313472927|ref|ZP_07813415.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 1153]
 gi|313448921|gb|EFR61245.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 1153]
          Length = 151

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 13  YSTIAVANFFIDK------GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
           Y    + N+   +          +  +  +K  + +Y      ++     M  ++  AW+
Sbjct: 2   YDVFKIVNWLRVRNNADLQANPNAEELTQMKAMKLLYYIQAASLVVTGHRMFKDDIVAWR 61

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA-NQEIGEIMESIWNKYQSHSTEQLQ 125
            GP    V++++       +  + + S   + ++  + +  +I+ SI++ Y   S   L 
Sbjct: 62  YGPAVESVHNKY-IHQRGIVGYVDNQSLNDYRELQSDSQTADILNSIYDIYGHSSAYDLM 120

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
                E K W+      +   +  I+ ++I
Sbjct: 121 RQTHSE-KPWK------ETKQSEVISDDKI 143


>gi|116511895|ref|YP_809111.1| phage-associated protein [Lactococcus lactis subsp. cremoris SK11]
 gi|116107549|gb|ABJ72689.1| Uncharacterized phage-associated protein [Lactococcus lactis subsp.
           cremoris SK11]
          Length = 303

 Score =  111 bits (278), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 59/151 (39%), Gaps = 15/151 (9%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
             + N  + K  +Y   +  +K+ + +Y      +    K +      AWK GPV   ++
Sbjct: 155 FRIKNIILQKSDEYVEDLTQMKVMKLVYYAQAVSLHWYGKPIFSNPILAWKHGPVVQEIF 214

Query: 76  HRFKYFDSHPI------EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           + +    S+ I      E+  +L         N+++ +++  +  +  S+S   L++   
Sbjct: 215 NEY--HGSYSIVEDLRSEIPEELLKNYNELSVNKKMNKVLNFVQEQLGSYSAWTLRDKTH 272

Query: 130 EENKTWRRLYDPNDPNTNRTITVEEITKMAD 160
            E + W       +   +  I+ + I K  D
Sbjct: 273 NE-EPW------INTIQSSVISNKSIKKYFD 296


>gi|238854550|ref|ZP_04644887.1| prophage ps3 protein 01 [Lactobacillus jensenii 269-3]
 gi|282932368|ref|ZP_06337801.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
 gi|238832843|gb|EEQ25143.1| prophage ps3 protein 01 [Lactobacillus jensenii 269-3]
 gi|281303525|gb|EFA95694.1| toxin-antitoxin system, antitoxin component, Xre family
           [Lactobacillus jensenii 208-1]
          Length = 158

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 13  YSTIAVANFFIDK------GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
           Y    + N+   +          +  +  +K  + +Y      ++     M  ++  AW+
Sbjct: 2   YDVFKIVNWLRVRNNADLQANPNAEELTQMKAMKLLYYIQAASLVVTGHRMFKDDIVAWR 61

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA-NQEIGEIMESIWNKYQSHSTEQLQ 125
            GP    V++++       +  + + S   + ++  + +  +I+ SI++ Y   S   L 
Sbjct: 62  YGPAVESVHNKY-IHQRGIVGYVDNQSLNDYRELQSDSQTADILNSIYDIYGHSSAYDLM 120

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
                E K W+      +   +  I+ ++I
Sbjct: 121 RQTHSE-KPWK------ETKQSEVISDDKI 143


>gi|294782259|ref|ZP_06747585.1| conserved hypothetical protein [Fusobacterium sp. 1_1_41FAA]
 gi|294480900|gb|EFG28675.1| conserved hypothetical protein [Fusobacterium sp. 1_1_41FAA]
          Length = 142

 Score =  110 bits (276), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 56/138 (40%), Gaps = 7/138 (5%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +  + +A F + +      PI +L++Q+ +Y      + ++ +++  +  +AW+ GPV  
Sbjct: 2   FDAVQLAWFILRRCANSGTPISNLQLQKMLYFLQRANLQRENEALFFQNIRAWQFGPVVR 61

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            VY+ F  F S  I     +     P   +  +   +    ++  +     L +   ++ 
Sbjct: 62  EVYYTFSVFSSLKI-----IPEDSDPNPVDIILEPFLLEEIDRRSTQRPWDLVDETHQKG 116

Query: 133 KTWRRLYDPNDPNTNRTI 150
             W  ++   D   N  I
Sbjct: 117 GAWDIIF--RDGLGNDKI 132


>gi|238852887|ref|ZP_04643290.1| prophage ps3 protein 01 [Lactobacillus gasseri 202-4]
 gi|282851964|ref|ZP_06261324.1| toxin-antitoxin system, antitoxin component, Xre domain protein
           [Lactobacillus gasseri 224-1]
 gi|238834479|gb|EEQ26713.1| prophage ps3 protein 01 [Lactobacillus gasseri 202-4]
 gi|282556973|gb|EFB62575.1| toxin-antitoxin system, antitoxin component, Xre domain protein
           [Lactobacillus gasseri 224-1]
          Length = 158

 Score =  110 bits (274), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 22/150 (14%), Positives = 57/150 (38%), Gaps = 15/150 (10%)

Query: 13  YSTIAVANFFIDK------GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
           Y    + N+   +          +  +  +K  + +Y      ++     M  ++  AWK
Sbjct: 2   YDVFKIVNWLRVRNNADLQADPNAEELTQMKAMKLLYYIQAASLVVTGHRMFKDDIVAWK 61

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA-NQEIGEIMESIWNKYQSHSTEQLQ 125
            GP    V++++       +  + + S   + ++  + +  +I+ SI++ Y   S   L 
Sbjct: 62  YGPAVESVHNKY-IHQRGIVGYVDNQSLNDYRELQSDSQTADILNSIYDIYGHSSAYDLM 120

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
                E + W+      +   +  I+ ++I
Sbjct: 121 RQTHSE-RPWK------ETKQSEVISDDKI 143


>gi|317479190|ref|ZP_07938326.1| hypothetical protein HMPREF1007_01442 [Bacteroides sp. 4_1_36]
 gi|316904634|gb|EFV26452.1| hypothetical protein HMPREF1007_01442 [Bacteroides sp. 4_1_36]
          Length = 151

 Score =  110 bits (274), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 2/124 (1%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           YS + +A++F+ + +K  IPI ++ + + IY  H      K K ++D+   AW  GPV  
Sbjct: 2   YSGLVIADYFVRECLKKRIPITNMSVLKMIYFAHGFYYALKGKKLVDDPFYAWPWGPVEK 61

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             Y  FK + S PI    D + +   K+ A++++   +        +     L +   E 
Sbjct: 62  KTYDCFKKYVSSPIIATSDTTDKELAKLDADKDLTSFLNQFLPL-ANIDPFLLSQKSHEA 120

Query: 132 NKTW 135
              W
Sbjct: 121 GGPW 124


>gi|197294475|ref|YP_001799016.1| phage-associated protein [Candidatus Phytoplasma australiense]
 gi|197294810|ref|YP_001799351.1| phage-associated protein [Candidatus Phytoplasma australiense]
 gi|171853802|emb|CAM11738.1| Uncharacterized phage-associated protein [Candidatus Phytoplasma
           australiense]
 gi|171854137|emb|CAM12128.1| Uncharacterized phage-associated protein [Candidatus Phytoplasma
           australiense]
          Length = 185

 Score =  109 bits (273), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/150 (21%), Positives = 69/150 (46%), Gaps = 3/150 (2%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
            +     +   VAN+ I K    +  + H+K+ + IY ++   +++ KK ++ E P+AWK
Sbjct: 4   MKQTKKINVFDVANYIIIKFKNNNQNLTHMKLHKLIYFSYVKYLIEYKKRLILEHPKAWK 63

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQE 126
            GP+F  +Y   K +   PI   +    R    I +++  + ++ +    +  + ++L  
Sbjct: 64  YGPIFGELYVVLKDYFEKPIVKPL-CDGRSQKIITDEKRKKNIDEVLLLCKDKTGKELAN 122

Query: 127 IVQEENKTWRRLYDPND-PNTNRTITVEEI 155
           I  ++       Y      N + TI+ E++
Sbjct: 123 ISHQQ-SPQDETYHYYRYKNNDSTISDEDL 151


>gi|257453083|ref|ZP_05618382.1| putative prophage protein (ps3) [Fusobacterium sp. 3_1_5R]
 gi|317059620|ref|ZP_07924105.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
 gi|313685296|gb|EFS22131.1| conserved hypothetical protein [Fusobacterium sp. 3_1_5R]
          Length = 150

 Score =  109 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 32/154 (20%), Positives = 59/154 (38%), Gaps = 23/154 (14%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEP--Q 63
           YS   +A +F          +   K+Q+  +  +   +             ++ + P  +
Sbjct: 2   YSIYQIAGWF----FSKEYAMSSKKLQKLCWYAYSWYIALNSDPEDGHLERLITDVPGAE 57

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           AW  GPVF  +Y  F+    +      +          +++  + +E IWN Y S S EQ
Sbjct: 58  AWVHGPVFRDLYTDFR---YNEYTKTKNAQIE----NLDKDTLDFLERIWNVYGSFSGEQ 110

Query: 124 LQEIVQEENKTWRRLYDPNDP--NTNRTITVEEI 155
           L+E+   E   W       D   ++N+ I   +I
Sbjct: 111 LEEMTHNE-APWMNARKDVDKFESSNKLINDRDI 143


>gi|153870579|ref|ZP_01999951.1| phage-associated protein [Beggiatoa sp. PS]
 gi|152072952|gb|EDN70046.1| phage-associated protein [Beggiatoa sp. PS]
          Length = 150

 Score =  109 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 52/125 (41%), Gaps = 10/125 (8%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   VA F + K      P   +K+Q+ +Y +    ++  ++ +  E+  AW  GPV   
Sbjct: 3   TVFDVAAFILTKLG----PTPAMKLQKLVYYSQAWSLVWDEEPLFQEKIYAWINGPVVPE 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y   K         I+       P+  N+   E +E++ + Y    ++ L ++   E K
Sbjct: 59  LYDIHKGQFKVAATEIL-----GNPEALNETQKETVEAVLDYYGDKKSQWLSDLTHLE-K 112

Query: 134 TWRRL 138
            W+  
Sbjct: 113 PWQDA 117


>gi|206972784|ref|ZP_03233706.1| prophage ps3 protein 01, putative [Bacillus cereus AH1134]
 gi|206731668|gb|EDZ48868.1| prophage ps3 protein 01, putative [Bacillus cereus AH1134]
          Length = 334

 Score =  109 bits (273), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 63/142 (44%), Gaps = 14/142 (9%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            VAN+ + K    +  I  L +Q+ +Y       +     + +++ +    GPV+  +++
Sbjct: 169 EVANYLLYK----NDDITPLALQKLLYYAQGFCKVFTGTYLFEDDCEVGSHGPVYRVIFN 224

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
           ++K +    +EV  D + +       Q   EI++ + N    +S + L++++   +  W 
Sbjct: 225 KYKVYQYDNLEVNYDSTNQ-----LTQIEKEILDCVINTLGCYSGKSLEKMI-LFDLPWE 278

Query: 137 RLY---DPNDPNTNRTITVEEI 155
             +   + NDP     +  EEI
Sbjct: 279 VTHLELEDNDPGK-PIMEKEEI 299


>gi|171779724|ref|ZP_02920680.1| hypothetical protein STRINF_01561 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281826|gb|EDT47260.1| hypothetical protein STRINF_01561 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 157

 Score =  109 bits (272), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 45/138 (32%), Gaps = 9/138 (6%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
             V N+   K       +  LK+ + +Y      +    K +  E+  AWK GP    VY
Sbjct: 11  FKVRNYSDMKTNDNVEALTQLKVMKLLYYAQGVSLALYDKLLFPEKILAWKYGPAVQEVY 70

Query: 76  HRFKYFDSHPIEVIMDLSFRIFPK------IANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
             +K   S  I                    ++QE   I+ ++ + Y   S  +L     
Sbjct: 71  DVYK--GSREIVDSTSNGMSDTEIGDYQEVNSDQEAALILNAVVDAYGDMSAIELMNQTH 128

Query: 130 EENKTWRRLYDPNDPNTN 147
            E   W       + + N
Sbjct: 129 GE-APWLETTQSQEIDVN 145


>gi|15838393|ref|NP_299081.1| hypothetical protein XF1793 [Xylella fastidiosa 9a5c]
 gi|9106870|gb|AAF84601.1|AE004001_6 hypothetical protein XF_1793 [Xylella fastidiosa 9a5c]
          Length = 102

 Score =  108 bits (271), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 45/86 (52%)

Query: 12 PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
          PYS   +AN F+ K  +    +  L++ + +YL H   +   ++ ++DE  +AW+ GPV 
Sbjct: 2  PYSPTIIANAFLQKAPQEGRALTPLQVLKLVYLAHGWCLGVHRQPLIDEPVEAWRAGPVI 61

Query: 72 VGVYHRFKYFDSHPIEVIMDLSFRIF 97
            +Y+  K + S  I  ++ + +  +
Sbjct: 62 RSLYNAIKQYGSSGITKLLPVRWFSW 87


>gi|229193806|ref|ZP_04320736.1| Prophage ps3 protein 01 [Bacillus cereus ATCC 10876]
 gi|228589649|gb|EEK47538.1| Prophage ps3 protein 01 [Bacillus cereus ATCC 10876]
          Length = 324

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 63/142 (44%), Gaps = 14/142 (9%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            VAN+ + K    +  I  L +Q+ +Y       +     + +++ +    GPV+  +++
Sbjct: 159 EVANYLLYK----NDDITPLALQKLLYYAQGFCKVFTGTYLFEDDCEVGSHGPVYRVIFN 214

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
           ++K +    +EV  D + +       Q   EI++ + N    +S + L++++   +  W 
Sbjct: 215 KYKVYQYDNLEVNYDSTNQ-----LTQIEKEILDCVINTLGCYSGKSLEKMI-LFDLPWE 268

Query: 137 RLY---DPNDPNTNRTITVEEI 155
             +   + NDP     +  EEI
Sbjct: 269 VTHVELEDNDPGK-PIMEKEEI 289


>gi|229180813|ref|ZP_04308150.1| Prophage ps3 protein 01 [Bacillus cereus 172560W]
 gi|228602650|gb|EEK60134.1| Prophage ps3 protein 01 [Bacillus cereus 172560W]
          Length = 324

 Score =  108 bits (270), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 63/142 (44%), Gaps = 14/142 (9%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            VAN+ + K    +  I  L +Q+ +Y       +     + +++ +    GPV+  +++
Sbjct: 159 EVANYLLYK----NDDITPLALQKLLYYAQGFCKVFTGTYLFEDDCEVGSHGPVYRVIFN 214

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
           ++K +    +EV  D + +       Q   EI++ + N    +S + L++++   +  W 
Sbjct: 215 KYKVYQYDNLEVNYDSTNQ-----LTQIEKEILDCVINTLGCYSGKSLEKMI-LFDLPWE 268

Query: 137 RLY---DPNDPNTNRTITVEEI 155
             +   + NDP     +  EEI
Sbjct: 269 VTHVELEDNDPGK-PIMEKEEI 289


>gi|28211725|ref|NP_782669.1| hypothetical protein CTC02108 [Clostridium tetani E88]
 gi|28204167|gb|AAO36606.1| hypothetical protein CTC_02108 [Clostridium tetani E88]
          Length = 223

 Score =  108 bits (269), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 72/162 (44%), Gaps = 14/162 (8%)

Query: 15  TIAVANFFIDKGVK-YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
            I+VA +FI+   K  +    +LK+ + +Y      ++++ K + +EE  A++ G V   
Sbjct: 4   AISVAGWFINNDFKPTNDKSGNLKLNKLLYFAQMISLIKRNKPLFEEELYAFENGVVVEK 63

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +   +       +++  +     + K  N++  +I+ES    + + S E L E+  +  K
Sbjct: 64  IRKDYCNNYDDFVKLAKE-----YDKNFNEDEIDILESTKELFLNVSPEDLSELTHQH-K 117

Query: 134 TWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKK 175
            W+  Y       N++I   +  K    S   P  V++ + K
Sbjct: 118 CWKHYY-------NKSIEEAKGYKYNKESARMPIGVIKNVYK 152


>gi|288924291|ref|ZP_06418311.1| Uncharacterized phage-associated protein-like protein [Frankia sp.
           EUN1f]
 gi|288344363|gb|EFC78872.1| Uncharacterized phage-associated protein-like protein [Frankia sp.
           EUN1f]
          Length = 201

 Score =  107 bits (268), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/161 (18%), Positives = 60/161 (37%), Gaps = 13/161 (8%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           P +   VA + + +           + Q+ +Y +    +  +   +   E QAW  GPV 
Sbjct: 2   PENVHDVAAYIVARLGAMETY----RFQKLVYYSQAWHLALQGSVLFPNEVQAWVDGPVV 57

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             +Y + +   S       D      P+       + ++ +   Y S S ++L  +   E
Sbjct: 58  RALYEQHRRRTSVSSWPSGD------PRRLQPASKQHVDWVLATYGSFSGDELSRMTHAE 111

Query: 132 NKTWR--RLYDPNDPNTNRTITVEEITKMADGSNISPENVV 170
              WR  R   P+D +++  I  + +        +SP+  V
Sbjct: 112 -APWRLARGGIPDDYSSDAAIDNKMMMDYYSRLRMSPDEAV 151


>gi|255316708|ref|ZP_05358291.1| Uncharacterized phage-associated protein [Clostridium difficile
           QCD-76w55]
          Length = 156

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 57/137 (41%), Gaps = 5/137 (3%)

Query: 1   MKKRTFTQTNPPYSTIAVANFFIDKG-VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLD 59
           M+    T   P Y  + VA + +     K   PI++ K+Q+ +Y      + +  K + D
Sbjct: 1   MEFINLTGFCPNYDAMDVAEYILWYCENKLKNPINNSKLQRILYFIQKKYICKFNKLLFD 60

Query: 60  EEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSH 119
               AW  G VF  VY+ +  +    I  I+      + +I+ ++  + +  +       
Sbjct: 61  NYMVAWSYGIVFPEVYYSYNNYGVEDITGILP---CRYFEISTKDDSKFINEMVASLVYR 117

Query: 120 STEQLQEIVQEENKTWR 136
             E L +   +E++ W+
Sbjct: 118 DVEDLIKET-QEDEVWK 133


>gi|227519580|ref|ZP_03949629.1| prophage protein (ps3) [Enterococcus faecalis TX0104]
 gi|257090820|ref|ZP_05585181.1| predicted protein [Enterococcus faecalis CH188]
 gi|312902452|ref|ZP_07761658.1| conserved hypothetical protein [Enterococcus faecalis TX0635]
 gi|227072967|gb|EEI10930.1| prophage protein (ps3) [Enterococcus faecalis TX0104]
 gi|256999632|gb|EEU86152.1| predicted protein [Enterococcus faecalis CH188]
 gi|310634122|gb|EFQ17405.1| conserved hypothetical protein [Enterococcus faecalis TX0635]
 gi|315576894|gb|EFU89085.1| conserved hypothetical protein [Enterococcus faecalis TX0630]
          Length = 154

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/149 (19%), Positives = 57/149 (38%), Gaps = 17/149 (11%)

Query: 18  VANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR 77
           VA + I    +    +  +K+Q+ +Y      +   +K + +EE QAW  GPV   ++  
Sbjct: 13  VARYII----EQLGGMTTMKLQKLVYYCQAWSLAWDEKPLFEEEFQAWANGPVCYELFSE 68

Query: 78  FK---YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
            +     D + ++   D  F         +  E +  +   Y   S   L E+  +E + 
Sbjct: 69  HRGKFKVDENFLQDYSDYKFE-------PDELETIGIVIEHYAEKSPHYLSELTHKE-RP 120

Query: 135 WRRLY--DPNDPNTNRTITVEEITKMADG 161
           W+      P   ++   I  E + +   G
Sbjct: 121 WKETRGSLPLGESSTEIIPKELMQEYYAG 149


>gi|331271033|ref|YP_004385744.1| hypothetical protein CbC4_4169 [Clostridium botulinum BKT015925]
 gi|329127425|gb|AEB77369.1| conserved hypothetical protein [Clostridium botulinum BKT015925]
          Length = 222

 Score =  107 bits (267), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 53/135 (39%), Gaps = 7/135 (5%)

Query: 15  TIAVANFFIDKGVKYSIPID-HLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
            I VA +FI  G K     + ++K+ + +Y      ++++ K + ++   A+K G V   
Sbjct: 4   AIDVAKWFIKNGYKPCDTRNGNMKLNKLLYFAQLISLVKRDKVLFNDNLSAFKHGVVVEN 63

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           V   +    ++ I+     S          E  E++    N +      +L ++   E+ 
Sbjct: 64  VRQEYHNNYNNFIQTARKSSI-----TLADEEEEVLNITSNIFGQVDARELSQLTH-EHS 117

Query: 134 TWRRLYDPNDPNTNR 148
            W+  Y+ +      
Sbjct: 118 CWKDHYEKSKRGNGN 132


>gi|253682866|ref|ZP_04863657.1| conserved hypothetical protein [Clostridium phage D-1873]
 gi|253560940|gb|EES90398.1| conserved hypothetical protein [Clostridium phage D-1873]
          Length = 225

 Score =  106 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 54/135 (40%), Gaps = 7/135 (5%)

Query: 15  TIAVANFFIDKGVKYSIPID-HLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
            I VA +FI    +     + ++K+ + +Y      ++++ K + ++   A+K G V   
Sbjct: 4   AIDVAKWFIKNNYEPCDTKNGNMKLNKLLYFAQLISLVKRDKVLFNDNLSAFKHGVVVEN 63

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           V   +     + I+     S        ++E  E++    N +   +  +L ++   E+ 
Sbjct: 64  VRKEYYNNYHNFIQTAQKSSI-----TLSEEEEEVLNITINIFGQVNARELSQLTH-EHS 117

Query: 134 TWRRLYDPNDPNTNR 148
            W+  Y+ +      
Sbjct: 118 CWKDHYEKSKRGNGN 132


>gi|194246654|ref|YP_002004293.1| hypothetical protein, phage-associated [Candidatus Phytoplasma
           mali]
 gi|193807011|emb|CAP18447.1| hypothetical protein, phage-associated [Candidatus Phytoplasma
           mali]
          Length = 157

 Score =  106 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/151 (17%), Positives = 58/151 (38%), Gaps = 9/151 (5%)

Query: 7   TQTNPPYSTIAVANFFIDKG-VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAW 65
            +    ++   +  + ++    KY   I   ++Q+ +Y    + ++   + +  EE  AW
Sbjct: 1   MENKNQFNIFDIGKYLLENCRKKYGTGIT--QLQKLLYYAQAEYLVCYNQPLFLEEIHAW 58

Query: 66  KQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPK-IANQEIGEIMESIWNKYQSHSTEQL 124
             GP+   VY  F  +    +    D+      K     ++ +I+  +  K  +  +  L
Sbjct: 59  DFGPIVPSVYFEFIRY----LAESKDIFKYKCSKHPLPSKVIKILNLVLEKNGNKDSRTL 114

Query: 125 QEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
               + E   W+  Y PN   +   I+  +I
Sbjct: 115 TAQTRNE-APWKTTYYPNKKISIAIISTAKI 144


>gi|293597081|ref|ZP_05267091.2| phage protein [Listeria monocytogenes HPB2262]
 gi|293585293|gb|EFF97325.1| phage protein [Listeria monocytogenes HPB2262]
          Length = 176

 Score =  106 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 57/152 (37%), Gaps = 19/152 (12%)

Query: 19  ANFFIDKGVKYSIPI---DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
           A + I     YS  +     +K+Q+ IYL     +    + +   + Q WK GPV   + 
Sbjct: 17  ARYLIHSYESYSRSLFENSEMKLQKLIYLAQRQSIALTGEILFQNDIQGWKHGPVVPELR 76

Query: 76  HRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
           + F      P E           +  ++    I++++ N Y       L+E+   E   W
Sbjct: 77  Y-FLENGYTPYE----------GEPLSETEKYIIDNVVNTYGKFEAWSLREMTHNELS-W 124

Query: 136 RRLY---DPNDPNTNRTITVEEITKMADGSNI 164
           +      +  D      + +E+I K A+   I
Sbjct: 125 KNSRIGLNDEDSGC-EVLKLEDIEKDAEKVRI 155


>gi|168187142|ref|ZP_02621777.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
 gi|169294975|gb|EDS77108.1| conserved hypothetical protein [Clostridium botulinum C str.
           Eklund]
          Length = 222

 Score =  106 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 22/135 (16%), Positives = 53/135 (39%), Gaps = 7/135 (5%)

Query: 15  TIAVANFFIDKGVKYSIPID-HLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
            I VA +FI  G +     + ++K+ + +Y      ++++ + + ++   A+K G V   
Sbjct: 4   AIDVAKWFIKNGYEPCDTRNGNMKLNKLLYFAQLISLVKRDRVLFNDNLSAFKHGVVVEN 63

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           V   +    ++ I+     S          E  E++    N +      +L ++   E+ 
Sbjct: 64  VRQEYHNNYNNFIQTARKSSI-----TLADEEEEVLNITSNIFGQVDARELSQLTH-EHS 117

Query: 134 TWRRLYDPNDPNTNR 148
            W+  Y+ +      
Sbjct: 118 CWKDHYEKSKRGNGN 132


>gi|288802236|ref|ZP_06407676.1| putative prophage ps3 protein 01 [Prevotella melaninogenica D18]
 gi|288335203|gb|EFC73638.1| putative prophage ps3 protein 01 [Prevotella melaninogenica D18]
          Length = 178

 Score =  106 bits (266), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/150 (19%), Positives = 56/150 (37%), Gaps = 16/150 (10%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK--KSMLDEEPQAWKQGPVF 71
               VA +     +   + +  LK+Q+ +Y      ++     K++  + PQAW  GPV+
Sbjct: 3   DIKDVARYIGLSLINKGLSVSPLKLQKILYYVQSWNMVIFGRNKTLFAQAPQAWVNGPVY 62

Query: 72  VGVYHRFKY-------------FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQS 118
             +Y+ +K              F +    +   L         +++  E+++SI+  Y S
Sbjct: 63  PEIYYEYKDKVPNMCDYLDETNFGTDSAHIDKTLQELAEKLSFSKDQIELLDSIFMLYGS 122

Query: 119 HSTEQLQEIVQEENKTWRRLYDPNDPNTNR 148
            S   L  +   E K W       +P    
Sbjct: 123 KSQNDLIFLTHSE-KPWVEARGSLNPFQRS 151


>gi|229821013|ref|YP_002882539.1| hypothetical protein Bcav_2529 [Beutenbergia cavernae DSM 12333]
 gi|229566926|gb|ACQ80777.1| conserved hypothetical protein [Beutenbergia cavernae DSM 12333]
          Length = 150

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 26/149 (17%), Positives = 55/149 (36%), Gaps = 13/149 (8%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   VA   + K       +  +K+Q+ +Y ++   ++ +++ + D   QAW  GPV   
Sbjct: 3   TVHDVAAHILAK----QGGMTAMKLQKLVYYSYAWHLVWEERELFDAPIQAWANGPVIYD 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y   +         + D       +  +    E ++ +   Y   +  +L E+   E  
Sbjct: 59  LYRHHRGQFHVSTWPLGDA------EALDTGERESIDIVLGFYSDKTAHELSELTHSE-A 111

Query: 134 TWRRLY--DPNDPNTNRTITVEEITKMAD 160
            W+      P    ++  IT   I    D
Sbjct: 112 PWQDARGDLPAGSRSSTQITTTSIFDYYD 140


>gi|291560455|emb|CBL39255.1| Uncharacterized phage-associated protein [butyrate-producing
           bacterium SSC/2]
          Length = 338

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/139 (22%), Positives = 63/139 (45%), Gaps = 11/139 (7%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
              +A + ID     +  I +L +Q+ +Y       L  +  ++ +E +AW+ GPVF  +
Sbjct: 167 AEKIALYIID----SNRGITNLFLQKILYYIKAIGKLLVEYPIITDECEAWRFGPVFPNI 222

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y ++K F    I  I+DL       +  +E  ++ + + N +  ++   L+++   E + 
Sbjct: 223 YEKYKNFGKQEI--ILDLPVDYAKNLLTKEEKQVTDFVLNTFGIYNIWFLKDLTHME-EP 279

Query: 135 W---RRLYDPNDPNTNRTI 150
           W   R   D  +  +N  I
Sbjct: 280 WLSARNGID-EEAASNNPI 297


>gi|167768483|ref|ZP_02440536.1| hypothetical protein CLOSS21_03042 [Clostridium sp. SS2/1]
 gi|167710007|gb|EDS20586.1| hypothetical protein CLOSS21_03042 [Clostridium sp. SS2/1]
          Length = 357

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/139 (22%), Positives = 63/139 (45%), Gaps = 11/139 (7%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
              +A + ID     +  I +L +Q+ +Y       L  +  ++ +E +AW+ GPVF  +
Sbjct: 186 AEKIALYIID----SNRGITNLFLQKILYYIKAIGKLLVEYPIITDECEAWRFGPVFPNI 241

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y ++K F    I  I+DL       +  +E  ++ + + N +  ++   L+++   E + 
Sbjct: 242 YEKYKNFGKQEI--ILDLPVDYAKNLLTKEEKQVTDFVLNTFGIYNIWFLKDLTHME-EP 298

Query: 135 W---RRLYDPNDPNTNRTI 150
           W   R   D  +  +N  I
Sbjct: 299 WLSARNGID-EEAASNNPI 316


>gi|157325244|ref|YP_001468666.1| gp27 [Listeria phage B025]
 gi|66733250|gb|AAY53067.1| gp27 [Listeria phage B025]
          Length = 167

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/152 (20%), Positives = 57/152 (37%), Gaps = 19/152 (12%)

Query: 19  ANFFIDKGVKYSIPI---DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
           A + I     YS  +     +K+Q+ IYL     +    + +   + Q WK GPV   + 
Sbjct: 8   ARYLIHSYESYSRSLFENSEMKLQKLIYLAQRQSIALTGEILFQNDIQGWKHGPVVPELR 67

Query: 76  HRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
           + F      P E           +  ++    I++++ N Y       L+E+   E   W
Sbjct: 68  Y-FLENGYTPYE----------GEPLSETEKYIIDNVVNTYGKFEAWSLREMTHNELS-W 115

Query: 136 RRLY---DPNDPNTNRTITVEEITKMADGSNI 164
           +      +  D      + +E+I K A+   I
Sbjct: 116 KNSRIGLNDEDSGC-EVLKLEDIEKDAEKVRI 146


>gi|161506780|ref|YP_001576734.1| Phage associated protein [Lactobacillus helveticus DPC 4571]
 gi|160347769|gb|ABX26443.1| Phage associated protein [Lactobacillus helveticus DPC 4571]
          Length = 244

 Score =  106 bits (265), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 20/135 (14%), Positives = 52/135 (38%), Gaps = 7/135 (5%)

Query: 7   TQTNPPYSTIAVANFFI------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE 60
           +   P +  + +AN+F        +      PI  +++ + +Y  +   +++ KK +   
Sbjct: 110 SSEQPKFKAVQLANWFRVNNYFARQFDYNVDPITQMQVVKLLYFAYGRFLVKSKKRLFSS 169

Query: 61  EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIMESIWNKYQSH 119
                +  PV   V+ +F+       +     +F  +  + ++ EI  +++ I   Y  +
Sbjct: 170 PILHLQYRPVVEEVHQQFRGMVVLDPDKPDKQAFEDYNLVSSDAEINNLLQKIDEDYSDY 229

Query: 120 STEQLQEIVQEENKT 134
           +   L  I+      
Sbjct: 230 TASGLSRIIHRAGSP 244


>gi|153876382|ref|ZP_02003733.1| phage-associated protein [Beggiatoa sp. PS]
 gi|152067153|gb|EDN66266.1| phage-associated protein [Beggiatoa sp. PS]
          Length = 123

 Score =  106 bits (264), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 46/120 (38%), Gaps = 12/120 (10%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIF 97
           +Q+  Y      + +K + + +E+ QAW+ GPV   +Y +++ +    I   +  S    
Sbjct: 1   MQKLCYYAQGYALAEKNQ-LFEEDFQAWQHGPVVYELYDKYRDYQWCQISEDVGES---- 55

Query: 98  PKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPND--PNTNRTITVEEI 155
               +  + E +  +   Y  +    L  +   E   W       D    + + +T E +
Sbjct: 56  ----DPRLLEYITDVVGAYGRYDGAALSTMTHRE-SPWLNARGDLDESQGSTKVMTKESM 110


>gi|228924680|ref|ZP_04087866.1| Prophage ps3 protein 01 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228834979|gb|EEM80432.1| Prophage ps3 protein 01 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 324

 Score =  105 bits (262), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 59/139 (42%), Gaps = 11/139 (7%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            VAN+ + K    +  I  L +Q+ +Y       +     + +++ +    GPV+  +++
Sbjct: 159 EVANYLLYK----NDDITPLALQKLLYYAQGFCKVFTGTYLFEDDCEVGSHGPVYRVIFN 214

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
           ++K +    +EV       +      Q   EI++ + N    +S + L++++   +  W 
Sbjct: 215 KYKVYQYDNLEVS-----YVSTNQLTQIEKEILDCVMNTLGCYSGKSLEKMI-LFDLPWE 268

Query: 137 RLY-DPNDPNTNRTITVEE 154
             + +  D    + I  +E
Sbjct: 269 VAHLELEDNGPGKPIMEKE 287


>gi|85059617|ref|YP_455319.1| hypothetical protein SG1639 [Sodalis glossinidius str. 'morsitans']
 gi|85060326|ref|YP_456028.1| hypothetical protein SG2348 [Sodalis glossinidius str. 'morsitans']
 gi|84780137|dbj|BAE74914.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
 gi|84780846|dbj|BAE75623.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
          Length = 172

 Score =  105 bits (262), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 51/120 (42%), Gaps = 5/120 (4%)

Query: 14  STIAVANFFIDKGVKYS--IPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
               +AN+F+ +         +   K+Q+ +Y      +    K + +E+ +A   GPV 
Sbjct: 17  DCFDLANYFLVRNQNEGCGDVMTSTKLQRLVYYAQVFALSLLGKPLFNEKVEASPDGPVV 76

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             +  R++Y+ + P+ V      +I       +   I++ +   Y  +S  +L E+ + E
Sbjct: 77  HALKLRYRYYKNEPLPV---PPVKIDMSKFTPDEAAILDKVHRIYGQYSGWKLHEMARSE 133


>gi|256841944|ref|ZP_05547449.1| phage-associated protein [Parabacteroides sp. D13]
 gi|256736260|gb|EEU49589.1| phage-associated protein [Parabacteroides sp. D13]
          Length = 155

 Score =  105 bits (262), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 56/147 (38%), Gaps = 13/147 (8%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S   VA + + +  +       +K+ + +Y      ++  +KS+  E  +AW  GPV   
Sbjct: 13  SVYDVATYILKQIKEC----STMKLHKLLYYCQAWSLVWDEKSLFPEPIEAWANGPVVRD 68

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
            ++  K   S    +  D          + +  + ++++   Y     + L ++   E  
Sbjct: 69  FFNFHKGRYS----ISYDNMTIGNENKLSIDQKDTIDNVLKFYGDKPAQWLIDLTHTE-A 123

Query: 134 TW---RRLYDPNDPNTNRTITVEEITK 157
            W   R+ Y   +   N  IT + I +
Sbjct: 124 PWKNARKGYTSMERG-NTIITNDSIAE 149


>gi|319440484|ref|ZP_07989640.1| hypothetical protein CvarD4_01845 [Corynebacterium variabile DSM
           44702]
          Length = 192

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/166 (18%), Positives = 70/166 (42%), Gaps = 18/166 (10%)

Query: 33  IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDL 92
           +D  ++Q+  Y      +    + +++++ QAW  GPV   ++   K+         +  
Sbjct: 18  VDAWRLQKLTYYAQAWTLAWTGRELIEDDFQAWPDGPVSPRLHQASKFDRDGWYSTAIPG 77

Query: 93  SFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR--RLYDPNDPNTNRTI 150
           +    P+    E   +++++ + Y   S +++ E+V  E+  W+  R   P +   +  +
Sbjct: 78  A---HPENLTDEQRTMIDAVLDHYGDLSKDEIVELVHSED-PWKIARGGLPAEAKCHAML 133

Query: 151 TVEEITKMADGSNISPENVVEQIK--------KPVRFDSDSEFATL 188
           + E + +       S  +V  Q +        KPV    D +FAT+
Sbjct: 134 SKEGMKRFYAVQQFSGGDVPAQPRTVQDIARQKPV----DKQFATM 175


>gi|229073386|ref|ZP_04206522.1| Prophage ps3 protein 01 [Bacillus cereus F65185]
 gi|228709693|gb|EEL61731.1| Prophage ps3 protein 01 [Bacillus cereus F65185]
          Length = 321

 Score =  105 bits (261), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 52/119 (43%), Gaps = 10/119 (8%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            VAN+ + K    +  I  L +Q+ +Y       +     + +++ +    GPV+  +++
Sbjct: 159 EVANYLLYK----NDDITPLALQKLLYYAQGFCKVFTGTYLFEDDCEVGSHGPVYRVIFN 214

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
           ++K +    +EV       +      Q   EI++ + N    +S + L++++   +  W
Sbjct: 215 KYKVYQYDNLEVN-----YVSTNQLTQIEKEILDCVINTLGCYSGKSLEKMI-LFDLPW 267


>gi|237739590|ref|ZP_04570071.1| gp27 [Fusobacterium sp. 2_1_31]
 gi|229423198|gb|EEO38245.1| gp27 [Fusobacterium sp. 2_1_31]
          Length = 176

 Score =  104 bits (260), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/158 (20%), Positives = 66/158 (41%), Gaps = 16/158 (10%)

Query: 16  IAVANFFIDKGVK-YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
           + VA +   +  +     ID +K+Q+ +Y +  + +    K M  E+ + WK GPV   V
Sbjct: 19  LNVAEYIFKEYQRVTGEYIDEMKLQKLLYFSQRESLAILNKPMFSEKFEGWKYGPVSREV 78

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
              F            +   + + +    E   I+ ++  +Y S ++ +L E+  +E   
Sbjct: 79  RTYF----------TQEDGIQTYTEDIKSENKYIVNNVILEYGSLASWKLSEMTHKEIS- 127

Query: 135 WRRLYD--PNDPNTNRTITVEEITKMADGSNISPENVV 170
           W         + N N+ I +E+I +  D   + P + +
Sbjct: 128 WLNSRKGLSENENGNKKIELEDIRE--DAKKVRPYDYI 163


>gi|148284307|ref|YP_001248397.1| hypothetical protein OTBS_0523 [Orientia tsutsugamushi str.
           Boryong]
 gi|146739746|emb|CAM79589.1| hypothetical protein OTBS_0523 [Orientia tsutsugamushi str.
           Boryong]
          Length = 90

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 19/95 (20%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 42  IYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA 101
           +Y +    +    K +  E+ +AW+ GPV   +   F  F+++ I    ++ F I+    
Sbjct: 1   MYFSQGVHLALFDKPLFKEDIEAWQNGPVVRHLRSIFGSFEANAIPGPGEIDFSIY---- 56

Query: 102 NQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
             +  E++  I++ Y  H+   L+++       W+
Sbjct: 57  TNQQKELIYKIYSSYGEHTASYLRDLTHLH-SIWQ 90


>gi|319942310|ref|ZP_08016625.1| hypothetical protein HMPREF9464_01844 [Sutterella wadsworthensis
           3_1_45B]
 gi|319942641|ref|ZP_08016949.1| hypothetical protein HMPREF9464_02168 [Sutterella wadsworthensis
           3_1_45B]
 gi|319803820|gb|EFW00752.1| hypothetical protein HMPREF9464_02168 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804183|gb|EFW01083.1| hypothetical protein HMPREF9464_01844 [Sutterella wadsworthensis
           3_1_45B]
          Length = 157

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 54/128 (42%), Gaps = 5/128 (3%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
            P  ++ V  + +D   K  I ++  K+Q+ +Y  +   + Q    +  E PQAW+ GPV
Sbjct: 9   RPLDSLQVMAYIVDMCRKQHIEVNVTKLQKLLYCCYGVALAQLGIRLTKESPQAWQYGPV 68

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
           F      F+    HPIE + D S       A+ E+ +++      +   S  QL     +
Sbjct: 69  FPKTLEYFRK---HPIESLTDSSV--LESTASDELKKLLIGTLTYFGQFSASQLSTWSHQ 123

Query: 131 ENKTWRRL 138
               W R 
Sbjct: 124 IGSPWYRS 131


>gi|255316707|ref|ZP_05358290.1| phage-associated protein [Clostridium difficile QCD-76w55]
          Length = 169

 Score =  104 bits (259), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 55/120 (45%), Gaps = 8/120 (6%)

Query: 11  PPYSTIAVANFFIDKG-VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQ---AWK 66
             Y  + +AN+ +     K   P  +L++Q+ +YL     +   K+S+ +++ +   AW 
Sbjct: 7   NDYDAVDIANYILWYCENKLKNPSTNLRLQKLLYLIQERYLYLYKESIFNDKFEWFEAWD 66

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQE 126
            GP    ++  F  FDS+PI  I+  +      +   +  + +E +    +  STE + E
Sbjct: 67  YGPTMPEIWFTFYEFDSNPITGIIPKN----NDLVKDKEKDTIEEVIELTKDISTEDIIE 122


>gi|298252748|ref|ZP_06976542.1| uncharacterized phage-associated protein [Gardnerella vaginalis
           5-1]
 gi|297533112|gb|EFH71996.1| uncharacterized phage-associated protein [Gardnerella vaginalis
           5-1]
          Length = 149

 Score =  103 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 62/143 (43%), Gaps = 10/143 (6%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
           I VA   +    +   P+  +K+Q+ +Y +    +     S+  E+ +AW  GPV + ++
Sbjct: 4   INVAAKIL----EIMGPMTTMKLQKLVYYSQAHSLATTGLSLFPEDFEAWTNGPVSLELF 59

Query: 76  HRFKY-FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           +R +  F     E+++ L  R        E  +I+E +  K  + +  QL E   +E+  
Sbjct: 60  NRHRGRFTIRKEELLISLPERCA--TLEYEQVKIIEEVCAKLGNLTGNQLSERTHKED-P 116

Query: 135 WRRLY--DPNDPNTNRTITVEEI 155
           W R       +  +   I+ + +
Sbjct: 117 WIRARIGISANQGSEEIISKKSM 139


>gi|283783313|ref|YP_003374067.1| toxin-antitoxin system, antitoxin component, Xre domain protein
           [Gardnerella vaginalis 409-05]
 gi|283442082|gb|ADB14548.1| toxin-antitoxin system, antitoxin component, Xre domain protein
           [Gardnerella vaginalis 409-05]
          Length = 149

 Score =  103 bits (258), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/143 (20%), Positives = 62/143 (43%), Gaps = 10/143 (6%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
           I VA   +    +   P+  +K+Q+ +Y +    +     S+  E+ +AW  GPV + ++
Sbjct: 4   INVAAKIL----EIMGPMTTMKLQKLVYYSQAHSLATTGLSLFPEDFEAWTNGPVSLELF 59

Query: 76  HRFKY-FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           +R +  F     E+++ L  R        E  +I+E +  K  + +  QL E   +E+  
Sbjct: 60  NRHRGRFTIRKEELLISLPERCA--TLEYEQVKIIEEVCAKLGNLTGNQLSERTHKED-P 116

Query: 135 WRRLY--DPNDPNTNRTITVEEI 155
           W R       +  +   I+ + +
Sbjct: 117 WIRARIGISANQGSEEIISKKSM 139


>gi|282851961|ref|ZP_06261321.1| conserved hypothetical protein [Lactobacillus gasseri 224-1]
 gi|282556970|gb|EFB62572.1| conserved hypothetical protein [Lactobacillus gasseri 224-1]
          Length = 103

 Score =  103 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/102 (22%), Positives = 49/102 (48%), Gaps = 11/102 (10%)

Query: 57  MLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKY 116
           M D+  +AW  GPV + +Y  +  +    I+   D+       +  +++  ++E +W+ Y
Sbjct: 1   MFDDHFEAWVHGPVILRLYAEYADYGFGSIDEKPDVP------VFTEDVENVLEQVWDIY 54

Query: 117 QSHSTEQLQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
             +S  +L+ +  +E+  W   R+   P     N TI+ ++I
Sbjct: 55  GKYSANELESMTHQED-PWINARKGLSPLQKGKN-TISDKDI 94


>gi|116514086|ref|YP_812992.1| phage-associated protein [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|116514101|ref|YP_813007.1| phage-associated protein [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|116093401|gb|ABJ58554.1| Uncharacterized phage-associated protein [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|116093416|gb|ABJ58569.1| Uncharacterized phage-associated protein [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
          Length = 137

 Score =  103 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 14/111 (12%), Positives = 41/111 (36%), Gaps = 1/111 (0%)

Query: 27  VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPI 86
            +   P+  +K+ + +Y  +   +++    +        +  PV   V+ +FK       
Sbjct: 4   DENVEPLTQMKLIKLLYFAYGRYLVKTHNKLFTSSIVHSQYDPVITEVHSKFKGLTVLDT 63

Query: 87  EVIMDLSFRIFPKIA-NQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
                 +F  +  ++ + +I  ++  +   Y ++S   L +   +    W 
Sbjct: 64  GKPSKEAFDDYNLVSKDGDISHLLRLVNEAYINYSASGLSQKTHQPGSPWS 114


>gi|194246803|ref|YP_002004442.1| Uncharacterized phage-associated protein [Candidatus Phytoplasma
           mali]
 gi|193807160|emb|CAP18598.1| Uncharacterized phage-associated protein [Candidatus Phytoplasma
           mali]
          Length = 166

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/151 (23%), Positives = 62/151 (41%), Gaps = 8/151 (5%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK--KSMLDEEPQA 64
            + +   +   VAN+ I    K    + +LKIQ+ I+  +   +++      M     +A
Sbjct: 1   MEKSNEINIFDVANYII--ANKKIPDLTNLKIQKLIFYIYVVYLVKTNPKTKMFHSNIEA 58

Query: 65  WKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQL 124
           W  GPVF  +Y     F +  I+  +      FPK+ N      +E I  KY +    +L
Sbjct: 59  WPYGPVFPELYFALSKFHNVIIDKPL---VVDFPKVINHLPKSCIEYILQKYGNLKAYEL 115

Query: 125 QEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
              + +E + W  +Y  N       IT + I
Sbjct: 116 TRQIHDE-ELWNDVYVDNISFEENKITDKVI 145


>gi|194246651|ref|YP_002004290.1| phage-associated protein [Candidatus Phytoplasma mali]
 gi|193807008|emb|CAP18444.1| phage-associated protein [Candidatus Phytoplasma mali]
          Length = 217

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 72/158 (45%), Gaps = 12/158 (7%)

Query: 2   KKRTFTQTN--PPYSTIAVANFFIDKGVKY-SIPIDHLKIQQFIYLTHCDVVLQKK---- 54
           KK+     N     +   VAN+ I K  K  +  + H+K+ + IY ++   ++Q +    
Sbjct: 29  KKKELIMENKDNQINVFDVANYIITKSKKLPNNNLTHMKLHKIIYYSYISYLIQNQTSKT 88

Query: 55  KSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWN 114
           K ++ E+P+AWK GPVF  ++H  + +    I   ++          ++E  E++ +I  
Sbjct: 89  KRLIFEKPKAWKYGPVFGQLFHILRNYYEKIITKPLEGG---NMSKIDKERAEVINNILE 145

Query: 115 KYQSHSTEQLQEIVQEENKTWRRL-YDPNDPNTNRTIT 151
           K ++ +  QL EI   +   W    Y       N TI+
Sbjct: 146 KTKNMNAVQLSEISHNQ-PPWDYTFYYYWPKTKNNTIS 182


>gi|218507675|ref|ZP_03505553.1| hypothetical protein RetlB5_08707 [Rhizobium etli Brasil 5]
          Length = 113

 Score =  103 bits (257), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/109 (21%), Positives = 46/109 (42%), Gaps = 6/109 (5%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
           +  Y   AVAN  +D+  +  I + H+ +Q+ +Y  H   +++ K  ++    +AW+ GP
Sbjct: 2   SRGYDPRAVANLMLDEADRLDIGVSHIVLQKLLYFAHGIYLMRTKAPLVSGYFEAWQYGP 61

Query: 70  VFVGVYHRFKYFDSHPI------EVIMDLSFRIFPKIANQEIGEIMESI 112
           V    Y  FK      I      +  +    R      +  I +++  +
Sbjct: 62  VHPAAYKSFKQAGKDAIAFRASGQDPLSGEPRQIQTPNDPHIVDLLRQV 110


>gi|308185287|ref|YP_003929420.1| phage-associated protein [Helicobacter pylori SJM180]
 gi|308061207|gb|ADO03103.1| phage-associated protein [Helicobacter pylori SJM180]
          Length = 145

 Score =  103 bits (257), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 66/150 (44%), Gaps = 9/150 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +T+ +A +      K    + +L++Q+ +Y T  D + +  K ++ ++ +AWK G V   
Sbjct: 3   NTLELAQYIFKHSNKE---LSNLELQKTLYFTELDYIKKFDKHLVSDDFEAWKYGLVARE 59

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY+ ++ + ++ I+   +       +   ++  E +     K    S   L +   +EN 
Sbjct: 60  VYYEYRNYGANSIDKPKE---ETLSQNLRKDELETINHSIEKCNEKSYWDLVKESYKENG 116

Query: 134 TWRRLYDPNDPNTNRTITVEEITKMADGSN 163
            W + +     +    I+ + I + A  +N
Sbjct: 117 AWHKSF---KEDRKEIISKDLIKQEAKQTN 143


>gi|255324897|ref|ZP_05366006.1| conserved hypothetical protein [Corynebacterium tuberculostearicum
           SK141]
 gi|255298074|gb|EET77382.1| conserved hypothetical protein [Corynebacterium tuberculostearicum
           SK141]
          Length = 189

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 59/146 (40%), Gaps = 10/146 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           + + VA             +D  K+++  Y      +    + ++  E QAWK GPV   
Sbjct: 3   TAVDVAQVI----YNKLGWVDAWKLEKLTYYCQAWSLGWYGRPLVSNEFQAWKDGPVEPD 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y   KY  S     ++  +     +    E  +I++++   Y   ++ +L E+   E +
Sbjct: 59  LYRENKYQRSEKSSTVLPGAD---VEAIGDEAEKIIDAVIAFYGDKTSNELIELTHSE-R 114

Query: 134 TW--RRLYDPNDPNTNRTITVEEITK 157
            W   R     + NTN  I+  E+ K
Sbjct: 115 PWIVARGQMGPEANTNEPISQLEMKK 140


>gi|197294474|ref|YP_001799015.1| phage-associated protein [Candidatus Phytoplasma australiense]
 gi|171853801|emb|CAM11737.1| Uncharacterized phage-associated protein [Candidatus Phytoplasma
           australiense]
          Length = 159

 Score =  103 bits (256), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/149 (22%), Positives = 57/149 (38%), Gaps = 6/149 (4%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
                  +   VA + +            +K+ + IY  H   ++Q KK +L E+ Q W 
Sbjct: 1   MNQTKQINVFDVALYIV---KNNPSSTTKMKLNKMIYYAHTKHLVQTKKPLLKEQIQTWI 57

Query: 67  QGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQE 126
            GPVF  +  + K F   PI    ++         N+   +I++ I   Y   S   L  
Sbjct: 58  YGPVFPELCKQLKEFTYQPI--NPEVLSMGDVTKINETQKQIIDFIILLYGDKSPTFLTS 115

Query: 127 IVQEENKTWRRLYDPNDPNTNRTITVEEI 155
               E+  W+  Y  +D  T   I  ++I
Sbjct: 116 QTHTED-VWKNNYYKHDVQTKNNIKNKDI 143


>gi|297243457|ref|ZP_06927389.1| hypothetical protein GVAMD_0365 [Gardnerella vaginalis AMD]
 gi|296888502|gb|EFH27242.1| hypothetical protein GVAMD_0365 [Gardnerella vaginalis AMD]
          Length = 149

 Score =  102 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/143 (20%), Positives = 62/143 (43%), Gaps = 10/143 (6%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
           I VA   +    +   P+  +K+Q+ +Y +    +     S+  E+ +AW  GPV + ++
Sbjct: 4   INVAAKIL----EIMGPMTTMKLQKLVYYSQAHSLATTGLSLFPEDFEAWTNGPVSLELF 59

Query: 76  HRFKY-FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           +R +  F     E+++ L  R        E  +I++ +  K  + +  QL E   +E+  
Sbjct: 60  NRHRGRFTIRKEELLISLPERCA--TLEYEQVKIIKEVCAKLGNLTGNQLSERTHKED-P 116

Query: 135 WRRLY--DPNDPNTNRTITVEEI 155
           W R       +  +   I+ + +
Sbjct: 117 WIRARIGISANQGSEEIISKKSM 139


>gi|242309858|ref|ZP_04809013.1| predicted protein [Helicobacter pullorum MIT 98-5489]
 gi|239523859|gb|EEQ63725.1| predicted protein [Helicobacter pullorum MIT 98-5489]
          Length = 134

 Score =  102 bits (255), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 27/148 (18%), Positives = 65/148 (43%), Gaps = 17/148 (11%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           + + ++++ +   VK    + +L++Q+ +Y T    + +  K ++ ++ +AW+ GP+   
Sbjct: 3   NALELSSYILKNSVKG---LSNLELQKILYFTELAYIKKFNKHLIIDDFEAWQYGPIIRS 59

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           VY+ ++ + ++ I+   D       +   +E  E+++S   +  S S  +L E       
Sbjct: 60  VYYEYRNYGANSIDKPED---ESLSRQLTKEELEVIDSTIIECNSKSYWELVEKS----- 111

Query: 134 TWRRLYDPNDPNTNRTITVEEITKMADG 161
                 +         I  + I K A G
Sbjct: 112 ------NSFKGGKKEVINKDLIRKEAKG 133


>gi|325686115|gb|EGD28166.1| phage-associated protein [Lactobacillus delbrueckii subsp. lactis
           DSM 20072]
          Length = 137

 Score =  102 bits (254), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 14/111 (12%), Positives = 41/111 (36%), Gaps = 1/111 (0%)

Query: 27  VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPI 86
            +   P+  +K+ + +Y  +   +++    +        +  PV   V+ +FK       
Sbjct: 4   DENVEPLTQIKLIKLLYFAYGRYLVKTHNKLFTSSIVHSQYDPVITEVHSKFKGLTVLDT 63

Query: 87  EVIMDLSFRIFPKIA-NQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
                 +F  +  ++ + +I  ++  +   Y ++S   L +   +    W 
Sbjct: 64  GKPSKEAFDDYNLVSKDSDISHLLRLVNEAYINYSASGLSQKTHQPGSPWS 114


>gi|311741431|ref|ZP_07715255.1| XRE family transcriptional regulator [Corynebacterium
           pseudogenitalium ATCC 33035]
 gi|311303601|gb|EFQ79680.1| XRE family transcriptional regulator [Corynebacterium
           pseudogenitalium ATCC 33035]
          Length = 189

 Score =  102 bits (254), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/146 (21%), Positives = 59/146 (40%), Gaps = 10/146 (6%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           + + VA             +D  K+++  Y      +    + ++  E QAWK GPV   
Sbjct: 3   TAVDVAQVI----YNKLGWVDAWKLEKLAYYCQAWSLGWYGRPLVSNEFQAWKDGPVEPD 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +Y   KY  S     ++  +     +    E  +I++++   Y   ++ +L E+   E +
Sbjct: 59  LYRENKYQRSEKTSTVLPGAD---VEAIGDEAEKIIDAVIAFYGDKTSNELIELTHSE-R 114

Query: 134 TW--RRLYDPNDPNTNRTITVEEITK 157
            W   R     + NTN  I+  E+ K
Sbjct: 115 PWIVARGQMGPEANTNEPISQLEMKK 140


>gi|297588135|ref|ZP_06946779.1| conserved hypothetical protein [Finegoldia magna ATCC 53516]
 gi|297574824|gb|EFH93544.1| conserved hypothetical protein [Finegoldia magna ATCC 53516]
          Length = 164

 Score =  101 bits (253), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/159 (16%), Positives = 59/159 (37%), Gaps = 16/159 (10%)

Query: 16  IAVANFFI-DKGVKYSIPI-DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
             V  + I     +    I   LK+Q+ +Y +  + +      + DEE + W  GPV   
Sbjct: 5   FEVTKYLIYSYERQTGNRIQSELKLQKLMYFSQRESLCLTGHQLFDEEFEGWIHGPVLPS 64

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           + +              ++          +E   ++++   +Y  +    L+++  EE  
Sbjct: 65  LRYCL---------ENSEVFDIEGGFSLTEEEKYVIDNTIAQYAKYDAWYLRDLSHEEY- 114

Query: 134 TWRRLYDPNDPNTN--RTITVEEITKMADGSNISPENVV 170
            W++  +           I +++I    D +N+ P + V
Sbjct: 115 CWQKSREGLTDRQQGFNKIKLDDIR--VDANNLRPYDSV 151


>gi|308234821|ref|ZP_07665558.1| Putative phage-associated protein [Gardnerella vaginalis ATCC
           14018]
 gi|311114496|ref|YP_003985717.1| phage-associated protein family protein [Gardnerella vaginalis ATCC
           14019]
 gi|310945990|gb|ADP38694.1| phage-associated protein family protein [Gardnerella vaginalis ATCC
           14019]
          Length = 369

 Score =  101 bits (252), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/185 (18%), Positives = 70/185 (37%), Gaps = 31/185 (16%)

Query: 20  NFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFK 79
           N  I   +     I  L +Q+ +Y          K  +  ++ QAW  GPV+  VY R+K
Sbjct: 180 NNVIQYLLIKCEDITTLALQKSLYYIQGFYFAFYKSFIFTDDCQAWIHGPVYKDVYLRYK 239

Query: 80  YFDSHPIEVI-----------------------MDLSFRIFPKIANQEIGEIMESIWNKY 116
            +   PI+                         + L         +     + +S+ +  
Sbjct: 240 DYTFTPIDSPTTEISGIKSSEKLADYKHVQKSDVTLFTSELTTTLSATEKAVCDSVIDNL 299

Query: 117 QSHSTEQLQEIVQEENKTW--RRLYDPNDPNTNRTITVEEI----TKMADGSN-ISPENV 169
             +S ++L+     E + W   R     + ++N+ I+ + I    TK+ +  N I+P+++
Sbjct: 300 CCYSGKELERFTHHE-EPWILTRGNLKTNDSSNKIISKKIIGEYFTKIKEKYNMINPDDI 358

Query: 170 VEQIK 174
            +  K
Sbjct: 359 RQYAK 363


>gi|322383488|ref|ZP_08057264.1| hypothetical protein PL1_3350 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321152227|gb|EFX45057.1| hypothetical protein PL1_3350 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 109

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/107 (22%), Positives = 46/107 (42%), Gaps = 5/107 (4%)

Query: 57  MLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKY 116
           M D+E +AW  GPV   +Y  +K F   PI+   +        I +     +++ +W +Y
Sbjct: 1   MFDDEFEAWVHGPVNYKLYLDYKKFGWSPIKENTEGFQE--DSIFDDNQLHVLDQVWERY 58

Query: 117 QSHSTEQLQEIVQEENKTWRRLY--DPNDPNTNRTITVEEITKMADG 161
                + L+ +   E+  W++      NDP +   I  +++     G
Sbjct: 59  GRLDVKVLEALTHGED-PWKKARMLLENDPYSPAIIVKDDMMSFYRG 104


>gi|313885524|ref|ZP_07819274.1| conserved hypothetical protein [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312619254|gb|EFR30693.1| conserved hypothetical protein [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 171

 Score =  101 bits (251), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/154 (18%), Positives = 61/154 (39%), Gaps = 22/154 (14%)

Query: 15  TIAVANFFI------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQG 68
              +A + I       K    +  I    +Q+ +Y      +    + ++DEE + WK G
Sbjct: 5   VQNIAKYLIYSYEQITKSSFNNDEIT---LQKLMYFAQKTSLAFLGEPIIDEEFEGWKHG 61

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV   +   F+Y++                +  ++    ++++    Y  ++   L+ + 
Sbjct: 62  PVLPSLRFFFEYYN----------PNEQIDEQLSESEKYVIDNTIYLYGKYAPWTLRNMS 111

Query: 129 QEENKTWR--RLYDPNDPNTNRTITVEEITKMAD 160
            EEN  W+  R+      + +  I +E+I K A+
Sbjct: 112 HEEN-AWKISRVGLAEGESGSCKINIEDIKKDAE 144


>gi|331002405|ref|ZP_08325923.1| hypothetical protein HMPREF0491_00785 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330410221|gb|EGG89655.1| hypothetical protein HMPREF0491_00785 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 164

 Score =  100 bits (249), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/155 (19%), Positives = 63/155 (40%), Gaps = 16/155 (10%)

Query: 15  TIAVANFFIDKGVK-YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
            I VA +  D+  K     ID +K+ + +Y +  +      + +  +E + W+ GPV V 
Sbjct: 4   AINVARYICDEYRKMSGEAIDEMKLHKLLYFSQRESFAITGEPLFIDEFEGWRYGPVCVA 63

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           V   F  FD   I            +  + +   I+ ++  +Y   ++ +L ++  +E  
Sbjct: 64  VRKSF--FDGEIISKE--------TENISDKYIYIVSNVIAQYGELASWKLSKLSHDETS 113

Query: 134 TWRRLYDPNDPNTN--RTITVEEITKMADGSNISP 166
            W+        + N    +++E+I    D   + P
Sbjct: 114 -WKNARKGLSTSENGYNKLSLEDIEN--DAKKVRP 145


>gi|325270745|ref|ZP_08137336.1| putative phage-associated protein [Prevotella multiformis DSM
           16608]
 gi|324986861|gb|EGC18853.1| putative phage-associated protein [Prevotella multiformis DSM
           16608]
          Length = 153

 Score = 99.3 bits (246), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/143 (19%), Positives = 57/143 (39%), Gaps = 5/143 (3%)

Query: 12  PYSTIAVANFFIDKGVKY-SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
           P S++  AN   +   K  SI ++  ++ + +++ +   +    + +  E P+AW  GPV
Sbjct: 2   PLSSVDFANQLRNMAYKRHSINLNKTQVNKLLFMCYGFYLAFYNQRLFHEPPKAWPYGPV 61

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
           F  VY ++  F+  PI +  + +        ++    I+  + +KY   S   L      
Sbjct: 62  FPNVYKQYSLFEV-PIYIPEEKNKEFEN---DERAKGILTQVVDKYSHISAYDLSLWSHL 117

Query: 131 ENKTWRRLYDPNDPNTNRTITVE 153
               W +       + N     E
Sbjct: 118 PGGPWSQTVYGIKGDKNSGWNKE 140


>gi|332707571|ref|ZP_08427606.1| hypothetical protein LYNGBM3L_49210 [Lyngbya majuscula 3L]
 gi|332353655|gb|EGJ33160.1| hypothetical protein LYNGBM3L_49210 [Lyngbya majuscula 3L]
          Length = 78

 Score = 99.3 bits (246), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 14 STIAVANFFIDKGVKYSIP--IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
            +  A +FI K     +   + ++K+Q+ +Y      +    + + DEE QAW+ GPV 
Sbjct: 3  DCLNAARYFIVKAYDDGMEAEMTNMKLQKLLYYAQSLHLALYDQPLFDEEIQAWRYGPVC 62

Query: 72 VGVYHRFKYFDSHPIE 87
             Y  +  F++  + 
Sbjct: 63 PSAYRFYSEFEAKQLP 78


>gi|228983062|ref|ZP_04143321.1| hypothetical protein bthur0002_61960 [Bacillus thuringiensis Bt407]
 gi|228777245|gb|EEM25553.1| hypothetical protein bthur0002_61960 [Bacillus thuringiensis Bt407]
          Length = 154

 Score = 99.3 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 1/87 (1%)

Query: 16  IAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
           + +A   I+K     +  I HLK+Q+ +Y      +    + M  ++  AW  GPV   +
Sbjct: 1   MHIAQELINKSKPNTNESITHLKLQKLLYYAQGWNLGIHGEPMFTDDIHAWVNGPVVPTI 60

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIA 101
           Y+RFK ++   I  I         K  
Sbjct: 61  YNRFKRYEYFEIGKINCFWDEKTNKPF 87


>gi|260664304|ref|ZP_05865157.1| conserved hypothetical protein [Lactobacillus jensenii SJ-7A-US]
 gi|260562190|gb|EEX28159.1| conserved hypothetical protein [Lactobacillus jensenii SJ-7A-US]
          Length = 158

 Score = 99.3 bits (246), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 31/157 (19%), Positives = 71/157 (45%), Gaps = 22/157 (14%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKK-------SML-DEE 61
              Y++  VAN+F+         I   K+Q  +Y ++   +    +        +  D++
Sbjct: 4   KKKYTSNEVANYFLAI---DKGNISVKKLQILVYYSYAWTLTLLNESSDNLINKLFEDDK 60

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHST 121
             A   GP  + +Y ++K +    I+   +          +Q++ +I++ +W +Y +++ 
Sbjct: 61  FIAGVHGPKIMKIYKKYKSYGFSAIQDKPERPI------FSQKVEDILDQVWKEYGNYTG 114

Query: 122 EQLQEIVQEENKTW---RRLYDPNDPNTNRTITVEEI 155
            QL+ I+Q+E + W   R  + P D    + I+ ++I
Sbjct: 115 VQLESIIQQE-QPWINARVGFSPIDK-CTKVISDKDI 149


>gi|306836835|ref|ZP_07469793.1| hypothetical protein HMPREF0277_2050 [Corynebacterium accolens ATCC
           49726]
 gi|304567296|gb|EFM42903.1| hypothetical protein HMPREF0277_2050 [Corynebacterium accolens ATCC
           49726]
          Length = 201

 Score = 98.9 bits (245), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 24/159 (15%), Positives = 54/159 (33%), Gaps = 12/159 (7%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
               V  +  ++       +D LK+ +  Y +    +    + +   E QAW+ GPV   
Sbjct: 3   DIFDVGQYITERIPN----VDKLKLNKLCYFSQGWHLAWTGRPLFQAEFQAWRHGPVSSE 58

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +  +            +           +    E+++SI   Y    + +L ++      
Sbjct: 59  LRAQTWQVAGTKEPWPVPYVPGGQSDNLSTYEREVVDSIIAFYGGVKSTKLSDLSH--GL 116

Query: 134 TWRRLYD--PNDPNTNRTIT----VEEITKMADGSNISP 166
            W       P D  +N  +     ++E ++  +  N +P
Sbjct: 117 AWNEARRGIPKDQKSNEKLRTTTILQEFSQAINSHNPTP 155


>gi|257467044|ref|ZP_05631355.1| putative prophage protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|315918181|ref|ZP_07914421.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
 gi|313692056|gb|EFS28891.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
          Length = 145

 Score = 98.9 bits (245), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 48/128 (37%), Gaps = 11/128 (8%)

Query: 28  KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIE 87
           K +  I +L +Q+ +Y     +++       +E+ +AW  GPV   VY  FK        
Sbjct: 14  KTNPNISNLVLQKLLYFIQASLLVTTGNPAFEEDIEAWMYGPVVPEVYDNFKK------- 66

Query: 88  VIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTN 147
              D   +      +  I EI+ +I       +   L       +  W+  +D      N
Sbjct: 67  -DKDYYNQFETNQLDSNIQEIVVNITKNLGKINPYSLVNATHGYDT-WKEAWD--RGGWN 122

Query: 148 RTITVEEI 155
             I+ ++I
Sbjct: 123 TIISQDKI 130


>gi|110005056|emb|CAK99387.1| putative conserved prophage protein [Spiroplasma citri]
          Length = 164

 Score = 98.5 bits (244), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/159 (19%), Positives = 63/159 (39%), Gaps = 10/159 (6%)

Query: 3   KRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEP 62
           K+   + N      +++ + ++K           K+Q+ +Y  + D + Q  K + ++E 
Sbjct: 2   KKINKKINNEI-IFSISKYLVEKHDIKQST----KLQKILYFLYLDYLKQYGKKLFEDEF 56

Query: 63  QAWKQGPVFVGVYHRFKYFD--SHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
           +AW  GPV   +++  K        IE           ++ ++ I   ++    KY S S
Sbjct: 57  EAWVYGPVVRKIFNHMKDNGCIFSLIEDYKTYELTEIKELDDEGIKNFIDEDIKKYLSLS 116

Query: 121 TEQLQEIVQEENKTWRRLYDPN--DPNTNRTITVEEITK 157
             +L E   +    W+        D  ++  I+ E I K
Sbjct: 117 PIELVEKSHD-TLPWKETRGELEYDEPSDEVISFELIKK 154


>gi|197294372|ref|YP_001798913.1| phage-associated protein [Candidatus Phytoplasma australiense]
 gi|171853699|emb|CAM11587.1| Uncharacterized phage-associated protein [Candidatus Phytoplasma
           australiense]
          Length = 162

 Score = 98.1 bits (243), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/159 (18%), Positives = 58/159 (36%), Gaps = 18/159 (11%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK----------KS 56
            + N   +   V ++ +    + +I   +L + + +Y ++   ++             + 
Sbjct: 1   MKNNNQINVFDVVHYMV---FEKNIKASNLTLNKLVYYSYAKYLIDNNTLADIQNNNYQK 57

Query: 57  MLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKY 116
           ++    QAW  GPVF  +Y   K +    I  I  ++         ++    +E   NKY
Sbjct: 58  LIPNYCQAWVYGPVFYELYRGIKQYLKRQIVNIPKITGF----PLTEKQKSAIEYATNKY 113

Query: 117 QSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
            +     L      E+  W++  D       R IT E I
Sbjct: 114 GNWHPWDLVAKTHMED-PWKKNIDLTMAYPKRIITDESI 151


>gi|293400463|ref|ZP_06644608.1| conserved hypothetical protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291305489|gb|EFE46733.1| conserved hypothetical protein [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 247

 Score = 97.0 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/154 (22%), Positives = 62/154 (40%), Gaps = 16/154 (10%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
            S   +A+F +       +P   LK+Q+ +YL + D +++    + +E+  A+K GP   
Sbjct: 94  ISANDLASFILSI-----VPCSKLKLQKLVYLCYADFLVKYDMKLFEEKIYAFKYGPFIK 148

Query: 73  GVYHRFKYFDSHPI-EVIMDLSFRIFP-----KIANQEIGEIMES---IWNKYQSHSTEQ 123
            +  ++K      I + + + +    P      + ++   EI+ S      KY   S   
Sbjct: 149 EIDGKYKTRGKERIKDELYEFTNSEIPPLLARMVFSKNGKEIVNSCLLTIGKYADKSPAN 208

Query: 124 LQEIVQEENKTWRRLYDPNDPNTNRTITVEEITK 157
           L  I   +   W R Y  N       IT E I K
Sbjct: 209 LINITHTKGGPWDRTYVVNKRYL--EITDECIKK 240


>gi|150016592|ref|YP_001308846.1| prophage ps3 protein 01, [Clostridium beijerinckii NCIMB 8052]
 gi|149903057|gb|ABR33890.1| prophage ps3 protein 01, putative [Clostridium beijerinckii NCIMB
           8052]
          Length = 336

 Score = 97.0 bits (240), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 8/119 (6%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
           AV  + + +          L IQ+ +Y       +     M +E+ +AWK GP +  +Y 
Sbjct: 167 AVIKYLLIRC----EDFTALSIQKLLYYVQAFHYVFTGNFMFEEDCEAWKDGPFYPSLYE 222

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
           R++ F    I   +  + ++  +        I+ESI   Y  +S + L+E+ + E   W
Sbjct: 223 RYEQFGYEKINKDIMANDKLRLENF---ERNIVESIIKFYGCYSGKILKEMTKSE-APW 277


>gi|153869441|ref|ZP_01999037.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152074071|gb|EDN70969.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 184

 Score = 96.6 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 32/179 (17%), Positives = 69/179 (38%), Gaps = 24/179 (13%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
              +A + + K       + ++K+ + +YL     V +  + M  +   +   GPV    
Sbjct: 7   VTQMAAYLLKK---RGNRMAYIKLIKLLYLAERKAVAKWGEPMSGDHFVSMPHGPVLSQT 63

Query: 75  YHRFKYF--------------DSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
           Y   K                D    EV +      F +++  E+  I++ ++ +Y + +
Sbjct: 64  YELIKSQPSPNEVSPWHDLIKDEENYEVSLSKDIEDFDELSQAEMR-ILDEVYAEYGTMN 122

Query: 121 TEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRF 179
             Q+++   +  + W   YD   P     IT+E I + A G +      + Q+ +  R+
Sbjct: 123 RFQIRDFTHDYCQEWEDPYDSAFP-----ITLESILR-AMGRDEEQVKALSQLNQEQRY 175


>gi|228918418|ref|ZP_04081866.1| Prophage ps3 protein 01 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
 gi|228949957|ref|ZP_04112149.1| Prophage ps3 protein 01 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228809701|gb|EEM56130.1| Prophage ps3 protein 01 [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228841223|gb|EEM86417.1| Prophage ps3 protein 01 [Bacillus thuringiensis serovar pulsiensis
           BGSC 4CC1]
          Length = 321

 Score = 96.6 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 25/143 (17%), Positives = 60/143 (41%), Gaps = 16/143 (11%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            VAN+ + K    +  +  L +Q+ +Y       +     + +++ +   QGPV+  ++ 
Sbjct: 159 EVANYLLYK----NDDVTPLALQRLLYYAQGFCKVFTGTYLFEDDCEVGSQGPVYRVIFD 214

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
           ++K +    +EV  D + +       Q   ++++ + N    +S + L++++   +  W 
Sbjct: 215 KYKGYQYDNLEVNHDSTNQ-----LTQIEKQLLDCVVNTLGCYSGKTLKKMI-LFDLPW- 267

Query: 137 RLYDPNDPNTNR----TITVEEI 155
                 +   N      I  EEI
Sbjct: 268 -AVTDLELEDNNFGKPIIEKEEI 289


>gi|256846086|ref|ZP_05551544.1| gp27 [Fusobacterium sp. 3_1_36A2]
 gi|256719645|gb|EEU33200.1| gp27 [Fusobacterium sp. 3_1_36A2]
          Length = 161

 Score = 96.6 bits (239), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 62/154 (40%), Gaps = 17/154 (11%)

Query: 16  IAVANF-FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
           + VA + F +        ID +K+Q+ +Y +  + +    K + +EE + WK GP+  GV
Sbjct: 5   LNVAEYIFKEYYRVTGELIDEMKLQKLLYFSQRETLAILNKPLFNEEFEGWKYGPISRGV 64

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
              F     +     +             E   I+ +I  +Y S ++ +L +I  +E   
Sbjct: 65  RTVFTKDGINTDTEDIK-----------SESKYIINNIILEYGSLASWKLSKISHKEVS- 112

Query: 135 WRRLYDPNDPNT--NRTITVEEITKMADGSNISP 166
           W             NR I +E+I +  D   + P
Sbjct: 113 WLNSRKDLKDGENGNRKIKLEDIKE--DAKKVKP 144


>gi|254780025|ref|YP_003058132.1| hypothetical protein HELPY_1490 [Helicobacter pylori B38]
 gi|254001938|emb|CAX30193.1| Conserved hypothetical protein [Helicobacter pylori B38]
          Length = 118

 Score = 95.8 bits (237), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 55/122 (45%), Gaps = 6/122 (4%)

Query: 42  IYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA 101
           +Y T  D + +  K ++ ++ +AWK GPV   VY++++ + ++PI+   +       +  
Sbjct: 1   MYFTELDYIKKFDKHLVSDDFEAWKYGPVAREVYYKYRNYGANPIDKPKE---ETLSQNL 57

Query: 102 NQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADG 161
            ++  E +     K    S   L +   +EN  W + +     +    I+ + I + A  
Sbjct: 58  RKDELETINRSIEKCSKKSYWDLVKESHKENGAWHKSF---KEDRKEIISKDLIRQEAKQ 114

Query: 162 SN 163
           +N
Sbjct: 115 TN 116


>gi|219882668|ref|YP_002477832.1| Uncharacterized phage-associated protein [Arthrobacter
           chlorophenolicus A6]
 gi|219861674|gb|ACL42015.1| Uncharacterized phage-associated protein [Arthrobacter
           chlorophenolicus A6]
          Length = 164

 Score = 95.4 bits (236), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 55/147 (37%), Gaps = 15/147 (10%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
           PP +   +A   + +  +       + + +  Y      ++ + + + D +  AW  GPV
Sbjct: 8   PPATIFDLAAAILARTGET----TTVALHRLAYYCQAWHLVWEDRLLADADFYAWGTGPV 63

Query: 71  FVGVYHRFKY-FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
              ++      F    +           P +  ++  E ++S+   Y S    +L  IV+
Sbjct: 64  NPDLHSSHAGTFTISEVP--------GNPGVFTEDENESIDSVVKAYGSLQPFELSSIVK 115

Query: 130 EENKTWRRLYDPNDPNTN-RTITVEEI 155
            E+  WR  +    P    R I V+ +
Sbjct: 116 NED-PWRSAWSGTQPGKRGRLIQVDRM 141


>gi|153932085|ref|YP_001385252.1| hypothetical protein CLB_2956 [Clostridium botulinum A str. ATCC
           19397]
 gi|152928129|gb|ABS33629.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           19397]
          Length = 223

 Score = 95.4 bits (236), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 26/147 (17%), Positives = 63/147 (42%), Gaps = 12/147 (8%)

Query: 15  TIAVANFFIDKGVKYSIPI-DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
            I +A +FI+    +S     ++K+ + +Y +    +++  K + +++  A+K G V   
Sbjct: 4   AIEIAKWFINNNDGFSNSFEGNMKLNKLLYFSQLISLVKNDKPLFNDDLYAFKNGVVIES 63

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           V   +    S      +    ++F +   +E  EI++     + +   ++L ++   E+ 
Sbjct: 64  VRKEYYCNYSQ-----LKKDAKLFKESFTEEEKEILKIGSEIFGNVDADELSQLTH-EHA 117

Query: 134 TWRRLYDPNDPN-----TNRTITVEEI 155
            W   Y+ +  +         I VE+I
Sbjct: 118 CWNDYYNKSKNDNWYMKEESKIPVEDI 144


>gi|225386399|ref|ZP_03756163.1| hypothetical protein CLOSTASPAR_00144 [Clostridium asparagiforme
           DSM 15981]
 gi|225047480|gb|EEG57726.1| hypothetical protein CLOSTASPAR_00144 [Clostridium asparagiforme
           DSM 15981]
          Length = 81

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 33/85 (38%), Gaps = 6/85 (7%)

Query: 38  IQQFIYLTHCDVVLQK-KKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRI 96
           +Q+  Y              +  +E QAW  GPV   +Y  +  +    I    D     
Sbjct: 1   MQKLCYYAQAWYCALYDGSPLFSDEIQAWVHGPVIPSIYPVYAGYKWSTIP-KADFDAS- 58

Query: 97  FPKIANQEIGEIMESIWNKYQSHST 121
                ++++ +++++++N Y   S 
Sbjct: 59  ---ALDEKLTDVLDAVYNTYGELSG 80


>gi|83592965|ref|YP_426717.1| hypothetical protein Rru_A1630 [Rhodospirillum rubrum ATCC 11170]
 gi|83575879|gb|ABC22430.1| hypothetical protein Rru_A1630 [Rhodospirillum rubrum ATCC 11170]
          Length = 202

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/150 (18%), Positives = 62/150 (41%), Gaps = 18/150 (12%)

Query: 9   TNPPY--STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDV-VLQKKKSMLDEEPQAW 65
           T PP   +T  VAN+FID+ +  +  +   K+ + ++L      V    + ++     A 
Sbjct: 4   TRPPLVETTFDVANWFIDRALNDNEYLQPQKLHRLMFLAQAYFAVANNGQRLMPAIFIAD 63

Query: 66  KQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
             GP+   +Y  F+   +            I  +   ++    +++IW ++  HS E L 
Sbjct: 64  AVGPLEPNIYRAFETQKA-----------WITQEKMPEKATLFLDNIWRRFGGHSAEHLS 112

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
           +++++    +   +     +    IT E +
Sbjct: 113 KVIRKH-PPYAEAFA---EHPRSVITEEAM 138


>gi|296386742|ref|ZP_06876241.1| hypothetical protein PaerPAb_01360 [Pseudomonas aeruginosa PAb1]
          Length = 175

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 52/145 (35%), Gaps = 22/145 (15%)

Query: 19  ANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF 78
           A FF+        P+ HL + + +YL   + + +    M D+   +   GPV        
Sbjct: 2   AAFFLASA---EGPLPHLTLIKLLYLADRESMARFDVPMSDDRAVSMPHGPVLSSTLDLI 58

Query: 79  KYFDSHP-----IEVIMDLSFRIFPKIANQEIGE--------IMESIWNKYQSHSTEQLQ 125
           K           I  ++D   R+   + N +  +        I+ES+W ++   +  QL+
Sbjct: 59  KGRLRSEVWSAWISPLVDHEVRLVHDVENWDDLDELSRSDRSILESVWQEFGHMTKYQLR 118

Query: 126 EIVQEENKTWRRLY------DPNDP 144
           +        W   +      DP D 
Sbjct: 119 DYTHHHIGEWHDPHGSSRDIDPKDT 143


>gi|116054432|ref|YP_788408.1| hypothetical protein PA14_03163 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115589653|gb|ABJ15668.1| hypothetical protein PA14_03163 [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 207

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 28/145 (19%), Positives = 52/145 (35%), Gaps = 22/145 (15%)

Query: 19  ANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF 78
           A FF+        P+ HL + + +YL   + + +    M D+   +   GPV        
Sbjct: 34  AAFFLASA---EGPLPHLTLIKLLYLADRESMARFDVPMSDDRAVSMPHGPVLSSTLDLI 90

Query: 79  KYFDSHP-----IEVIMDLSFRIFPKIANQEIGE--------IMESIWNKYQSHSTEQLQ 125
           K           I  ++D   R+   + N +  +        I+ES+W ++   +  QL+
Sbjct: 91  KGRLRSEVWSAWISPLVDHEVRLVHDVENWDDLDELSRSDRSILESVWQEFGHMTKYQLR 150

Query: 126 EIVQEENKTWRRLY------DPNDP 144
           +        W   +      DP D 
Sbjct: 151 DYTHHHIGEWHDPHGSSRDIDPKDT 175


>gi|227502127|ref|ZP_03932176.1| conserved hypothetical protein [Corynebacterium accolens ATCC
           49725]
 gi|227077111|gb|EEI15074.1| conserved hypothetical protein [Corynebacterium accolens ATCC
           49725]
          Length = 201

 Score = 94.3 bits (233), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 31/161 (19%), Positives = 61/161 (37%), Gaps = 11/161 (6%)

Query: 33  IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDL 92
           +D LK+ +  Y +         + M  EE QAW+ GPV   ++ R            +  
Sbjct: 18  VDKLKLYKLCYFSQGWHFAWTGRPMFCEEFQAWRHGPVSRELHARTWQVAGSHRPWPIPC 77

Query: 93  SFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD--PNDPNTNRTI 150
                 +  +    E+++SI   Y      +L ++       W +       D  +N  +
Sbjct: 78  VPGGLTENLSAYEREVVDSIIAFYGGVDFTKLSDLSH--GLAWNKARRGIAKDQKSNEVL 135

Query: 151 T----VEEITKMADGSNISPENVVE--QIKKP-VRFDSDSE 184
                ++E ++  D    +P++ ++  +I  P V  D D E
Sbjct: 136 QATAILQEFSQALDSRKPTPQSPLQSPEILLPNVELDGDVE 176


>gi|83311982|ref|YP_422246.1| phage-associated protein [Magnetospirillum magneticum AMB-1]
 gi|82946823|dbj|BAE51687.1| Uncharacterized phage-associated protein [Magnetospirillum
           magneticum AMB-1]
          Length = 189

 Score = 93.5 bits (231), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 31/177 (17%), Positives = 64/177 (36%), Gaps = 21/177 (11%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDV-VLQKKKSMLDEEPQAWKQGPVFV 72
           S + V  +  D+ +     I   K+ + +YL      V    + ++         GPV  
Sbjct: 7   SCLDVVFWISDQALNDREYIQPQKLHRLLYLAQAYFAVAYHGRKLMPATFVTDAFGPVEP 66

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            V+H F  +              I   + ++++   ++ IW +Y  ++ +QL + +  E+
Sbjct: 67  TVFHAF-AYGR---------PTMIEGNMLSEQVSHFLDGIWRRYGPYTADQLTKKI-AEH 115

Query: 133 KTWRRLYDPNDPNTNRTITVEEITK------MADGSNISPENVVEQIKKPVRFDSDS 183
                +        N  I   ++ K       A     S  + ++Q+ KP    S S
Sbjct: 116 AP---VALAMAKGQNEEIPFADMVKYYSEEAAARNRPASAVDSIDQVMKPRMMRSQS 169


>gi|209543109|ref|YP_002275338.1| hypothetical protein Gdia_0939 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209530786|gb|ACI50723.1| conserved hypothetical protein, putative phage associated protein
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 184

 Score = 93.1 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 60/148 (40%), Gaps = 17/148 (11%)

Query: 13  YSTIAVANFFIDKGVKYS-IPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           Y++   A       +K     I+ LK  + +Y++  + + +    MLDE   +   GPV 
Sbjct: 2   YNSAKAAQIIAYLALKTDARAINMLKAIKLVYISDREALKRFAVPMLDEPRASLPHGPVN 61

Query: 72  VGVYHRFK-------------YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQS 118
              Y   K                +H I V  D+      ++++ E+ E+++S+W ++  
Sbjct: 62  SWTYDNAKGEVEDANWSTILDDRANHMIGVKADIGVDDLDELSDAEV-EVLDSVWEEFGG 120

Query: 119 HSTEQLQEIVQEEN--KTWRRLYDPNDP 144
            +  QL++   + +    W      ++P
Sbjct: 121 MTQWQLRDWTHKSDNIPEWEDPNGSSNP 148


>gi|148380020|ref|YP_001254561.1| hypothetical protein CBO2063 [Clostridium botulinum A str. ATCC
           3502]
 gi|148289504|emb|CAL83602.1| conserved hypothetical protein [Clostridium botulinum A str. ATCC
           3502]
          Length = 89

 Score = 93.1 bits (230), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 41/91 (45%), Gaps = 4/91 (4%)

Query: 41  FIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI 100
            +Y       +   + + + + +AW  GPV+  +YH ++ +  +PIE  ++ +       
Sbjct: 1   MLYNCQGFYKVFDGEYLFNNDCEAWAHGPVYKKIYHEYRNYGYNPIEENIEYN----HIE 56

Query: 101 ANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             +   EI+++I      +S + L ++   E
Sbjct: 57  LTEIEREIIDNIIINLGCYSGKILGKMTHSE 87


>gi|153931194|ref|YP_001384318.1| hypothetical protein CLB_2002 [Clostridium botulinum A str. ATCC
           19397]
 gi|153936660|ref|YP_001387855.1| hypothetical protein CLC_2007 [Clostridium botulinum A str. Hall]
 gi|152927238|gb|ABS32738.1| hypothetical protein CLB_2002 [Clostridium botulinum A str. ATCC
           19397]
 gi|152932574|gb|ABS38073.1| hypothetical protein CLC_2007 [Clostridium botulinum A str. Hall]
          Length = 88

 Score = 92.4 bits (228), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 41/90 (45%), Gaps = 4/90 (4%)

Query: 42  IYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA 101
           +Y       +   + + + + +AW  GPV+  +YH ++ +  +PIE  ++ +        
Sbjct: 1   MYNCQGFYKVFDGEYLFNNDCEAWAHGPVYKKIYHEYRNYGYNPIEENIEYN----HIEL 56

Query: 102 NQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
            +   EI+++I      +S + L ++   E
Sbjct: 57  TEIEREIIDNIIINLGCYSGKILGKMTHSE 86


>gi|227511950|ref|ZP_03941999.1| possible phage-associated protein [Lactobacillus buchneri ATCC
           11577]
 gi|227524933|ref|ZP_03954982.1| possible phage-associated protein [Lactobacillus hilgardii ATCC
           8290]
 gi|227084853|gb|EEI20165.1| possible phage-associated protein [Lactobacillus buchneri ATCC
           11577]
 gi|227087906|gb|EEI23218.1| possible phage-associated protein [Lactobacillus hilgardii ATCC
           8290]
          Length = 156

 Score = 92.0 bits (227), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 41/124 (33%), Gaps = 6/124 (4%)

Query: 18  VANFFIDKGVKYS-----IPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           ++ F I    K         +  +K+   +Y      +    +     +  AWK GP   
Sbjct: 8   ISWFIIVNTDKQRQHPGTEKLTQMKLMFLLYYVQGTFLALYGQKAFSNDVVAWKYGPAVA 67

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            V+ RF+        V  +          +  + +I+  +   + + +  +L      E 
Sbjct: 68  VVHQRFRGKRFVTGTVTNEDDVNYRDVNQDDRLLKIVFEVQETFGNKTAAELSRQTMRE- 126

Query: 133 KTWR 136
           + W+
Sbjct: 127 RPWK 130


>gi|227509039|ref|ZP_03939088.1| possible phage-associated protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227191516|gb|EEI71583.1| possible phage-associated protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 156

 Score = 91.6 bits (226), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 42/124 (33%), Gaps = 6/124 (4%)

Query: 18  VANFFI-----DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           ++ F I      +    +  +  +K+   +Y      +    +     +  AWK GP   
Sbjct: 8   ISWFIIVNMDKQRQYPGTEKLTQMKLMFLLYYVQGTFLALYGQKAFSNDVVAWKYGPAIA 67

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN 132
            V+ RF+        V  +          +  + +I+  +   + + +  +L      E 
Sbjct: 68  VVHQRFRGKRFVTGTVTNEDDVNYRDVNQDDRLLKIVFEVQETFGNKTAAELSRQTMRE- 126

Query: 133 KTWR 136
           + W+
Sbjct: 127 RPWK 130


>gi|182418783|ref|ZP_02950051.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237668818|ref|ZP_04528802.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
 gi|182377382|gb|EDT74941.1| conserved hypothetical protein [Clostridium butyricum 5521]
 gi|237657166|gb|EEP54722.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT
           E BL5262]
          Length = 337

 Score = 91.6 bits (226), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 29/148 (19%), Positives = 59/148 (39%), Gaps = 9/148 (6%)

Query: 18  VANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR 77
           V  + + +       +  L IQ+ IY       +  +  + +E+ +A  +GP+   VY R
Sbjct: 168 VIKYILTR----GDDVTLLMIQKLIYYVQAFYYVFTEHFLFEEDFKAGYRGPLLESVYER 223

Query: 78  FKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
           +K +    I   +  +  +  +        I+E +   Y  +S + L+++V+ E   W  
Sbjct: 224 YKVYGFEDINNEILNNEEVNLEDI---EKNIVEGVLKFYGCYSGKILEKMVENE-APWIL 279

Query: 138 LYDPNDPNTNRTITVEEITKMADGSNIS 165
                  N    I +EE T +     +S
Sbjct: 280 ARKKM-LNCKSEIHLEEQTDIISKDALS 306


>gi|15837139|ref|NP_297827.1| hypothetical protein XF0537 [Xylella fastidiosa 9a5c]
 gi|9105394|gb|AAF83347.1|AE003901_10 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 135

 Score = 91.2 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 42/92 (45%), Gaps = 2/92 (2%)

Query: 50  VLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA--NQEIGE 107
           +   ++ ++DE  +AW+ GPV   +Y+  K + S  I   + + +  + +    +     
Sbjct: 1   MAVHRQPLIDEPVEAWRAGPVIRSLYNAIKQYGSSAITERLPVRWFSWGRALKIDATAAA 60

Query: 108 IMESIWNKYQSHSTEQLQEIVQEENKTWRRLY 139
           I+ S+W  Y+ +   +L  I + E   W   +
Sbjct: 61  ILASVWATYRRYGGVELAAITRAEGSPWWTTW 92


>gi|297571057|ref|YP_003696831.1| phage-associated protein [Arcanobacterium haemolyticum DSM 20595]
 gi|296931404|gb|ADH92212.1| Uncharacterized phage-associated protein [Arcanobacterium
          haemolyticum DSM 20595]
          Length = 140

 Score = 91.2 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 33/74 (44%), Gaps = 1/74 (1%)

Query: 14 STIAVANFFIDK-GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
             +VAN+ +     +    +  +K+ + +YL     +      ++D + +A++ GPV  
Sbjct: 12 DPASVANYILHLDTQREDSDVTQMKLHKLLYLAQAHYLAVTGYRLMDSDVEAFEHGPVIK 71

Query: 73 GVYHRFKYFDSHPI 86
           V+  F+ +    I
Sbjct: 72 AVFPMFREYGREVI 85


>gi|197294208|ref|YP_001798749.1| phage-associated protein [Candidatus Phytoplasma australiense]
 gi|171853535|emb|CAM11393.1| Uncharacterized phage-associated protein [Candidatus Phytoplasma
           australiense]
          Length = 163

 Score = 91.2 bits (225), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 64/137 (46%), Gaps = 7/137 (5%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
            A+AN+ I      ++ ++H K+Q+ +Y  H   ++  K+S+   + +AW++GP+F  ++
Sbjct: 14  FALANYLIQ-----NMEVNHWKLQKLLYYAHAKHLVDFKESLAAAQVEAWEKGPIFRTLF 68

Query: 76  HRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
            + K  DS  I +   +   +  +  N    +++  +  KY    +++L      +    
Sbjct: 69  DKLKDHDSKEI-ITNPIPCSMRGQQLNASRLQVLNFVMEKYGWVDSKELMRQAINK-LPC 126

Query: 136 RRLYDPNDPNTNRTITV 152
           ++ Y+   P     + V
Sbjct: 127 QQYYESPLPGYFPKVCV 143


>gi|38233395|ref|NP_939162.1| hypothetical protein DIP0796 [Corynebacterium diphtheriae NCTC
           13129]
 gi|38199655|emb|CAE49314.1| Putative phage protein [Corynebacterium diphtheriae]
          Length = 188

 Score = 90.0 bits (222), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 17/117 (14%), Positives = 41/117 (35%), Gaps = 6/117 (5%)

Query: 36  LKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFR 95
           +K+ +  Y +    +    + + +EE QAWK G V   +            + ++   + 
Sbjct: 21  MKLYKLCYFSQGWHLAWTGRPLFNEELQAWKYGAVSPTLRQASGLRADD--DRLVTQIWS 78

Query: 96  IFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR--RLYDPNDPNTNRTI 150
                       +++++ + Y    +  L ++       W   R   P D + +  I
Sbjct: 79  GDSSQLIDYERSVVDTVVSFYGDLESFHLSDLSH--GFAWSTVRGNLPPDASCSDVI 133


>gi|188518457|ref|ZP_03003944.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11
          str. ATCC 33695]
 gi|188998211|gb|EDU67308.1| conserved hypothetical protein [Ureaplasma urealyticum serovar 11
          str. ATCC 33695]
          Length = 84

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 20/88 (22%), Positives = 38/88 (43%), Gaps = 12/88 (13%)

Query: 11 PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKS-------MLDEEPQ 63
             + + VAN+F+ K       +   K+Q+ +Y  +   +    +        + DE+ +
Sbjct: 2  KEITPLIVANWFLTK-----ESMTLKKVQKLVYYAYSWYLTLMNEKVDDLKNKLFDEKIK 56

Query: 64 AWKQGPVFVGVYHRFKYFDSHPIEVIMD 91
          AW  GP    +Y+ FK +  + I  I D
Sbjct: 57 AWVHGPAIPMLYNEFKEYKYNSIPKIND 84


>gi|227487578|ref|ZP_03917894.1| possible prophage protein [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227092396|gb|EEI27708.1| possible prophage protein [Corynebacterium glucuronolyticum ATCC
           51867]
          Length = 196

 Score = 88.5 bits (218), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 42/118 (35%), Gaps = 11/118 (9%)

Query: 18  VANFF---IDKGVKYSIP--IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           VA+F    + +      P  I +LK Q+  YL       +   ++ D   QAW  GPV  
Sbjct: 6   VADFIEWAVRRERDEGRPPSISNLKAQELAYLAESLYGYRSGDNLADTSFQAWNHGPVLP 65

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
            +Y   K     P+    +            ++  I E +W+ +   +   L+     
Sbjct: 66  SLYSALKGNGKEPLSPHTE------RLTIGPDLETIYEIVWDDFGDMTASNLRNFTHR 117


>gi|282917362|ref|ZP_06325117.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
 gi|282318989|gb|EFB49344.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           D139]
          Length = 169

 Score = 88.1 bits (217), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 39/168 (23%), Positives = 56/168 (33%), Gaps = 24/168 (14%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK------------- 54
                Y T  V N  I    +    I  L++Q+ +Y                        
Sbjct: 1   MAEQKYLTT-VEN-IIGLMKEEIKNISPLRLQKTLYFLFAYYGASYGQLSKSKEYEVTKS 58

Query: 55  ------KSMLDEEPQAWKQGPVFVGVYHRFK-YFDSHPIEVIMDLSFRIFPKIANQEIGE 107
                 + + D + +AW+ GPV   VY   K  F  + IE  M  +F I  K   QEI E
Sbjct: 59  ESLNLPEYLFDAQFEAWQYGPVIRDVYKNNKYSFGYNDIEFSMS-NFEIEDKTMQQEITE 117

Query: 108 IMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
            +  I       S   L E    E++ W+      +   N  I  E I
Sbjct: 118 YLREIIKSTLKISDFGLVERSH-EDEEWKNKITQQEIMNNDLIIKEYI 164


>gi|242371749|ref|ZP_04817323.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W1]
 gi|242350535|gb|EES42136.1| conserved hypothetical protein [Staphylococcus epidermidis
           M23864:W1]
          Length = 174

 Score = 87.3 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 38/170 (22%), Positives = 56/170 (32%), Gaps = 24/170 (14%)

Query: 6   FTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK----------- 54
           F      Y T  V N  I    +    I  L++Q+ +Y                      
Sbjct: 4   FIMAEQKYLTT-VEN-IIGLMKEEIKNISPLRLQKTLYFLFAYYGASYGQLSKSKEYEVT 61

Query: 55  --------KSMLDEEPQAWKQGPVFVGVYHRFK-YFDSHPIEVIMDLSFRIFPKIANQEI 105
                   + + D + +AW+ GPV   VY   K     + I+  M  +F I  K   QEI
Sbjct: 62  KSESLNLPEYLFDAQFEAWQYGPVIRDVYKNNKYSLGYNDIDFSMS-NFEIEDKTMQQEI 120

Query: 106 GEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
            E +  I       S   L E    E++ W+      +   N  I  E I
Sbjct: 121 TEYLREIIKSTLKISDFGLVERSH-EDEEWKNKITQQEIMNNDLIIKEYI 169


>gi|227489142|ref|ZP_03919458.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51867]
 gi|227540705|ref|ZP_03970754.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227090886|gb|EEI26198.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51867]
 gi|227183517|gb|EEI64489.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 190

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 34/154 (22%), Positives = 55/154 (35%), Gaps = 24/154 (15%)

Query: 33  IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDL 92
           +D +K+ +  Y      +    + +  E+ QAW  GPV V + +      + PI     +
Sbjct: 18  VDKMKLYKLCYFAQGWNLAWTGRRLFPEDFQAWTYGPVPVELRNC-----TDPIANGNTI 72

Query: 93  SF--RIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLY--DPNDPNTN- 147
            F  R             +ESI + Y    + QL          WR      PN+  ++ 
Sbjct: 73  PFVPRGDSSELTVAEKRTIESIVDFYGKSRSFQLSFESH--GLAWREARGGLPNESRSSD 130

Query: 148 ----RTITVEEI--------TKMADGSNISPENV 169
                TI  E I          +A   N+ PE+V
Sbjct: 131 VLHTATIRREFIEYLRSSEENPVAPRENLFPEHV 164


>gi|269124040|ref|YP_003306617.1| Putative phage-associated protein [Streptobacillus moniliformis DSM
           12112]
 gi|268315366|gb|ACZ01740.1| Putative phage-associated protein [Streptobacillus moniliformis DSM
           12112]
          Length = 169

 Score = 86.6 bits (213), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 13/122 (10%)

Query: 16  IAVANFFIDKGVK-YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
           I VA F + +  + YS  ID +K+Q+ IY T  + +L     +  E+ +AW+ GPV + V
Sbjct: 10  IEVARFIVKRYKEMYSENIDEIKLQKLIYFTQKESILYTGNLLFIEKMKAWRLGPVSIKV 69

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
            + ++    +      + + + F K        I+ ++  KY  +S+ +L  +  +E + 
Sbjct: 70  RNGYRNRSVN----KQNYNLKTFNKY-------IINNVIIKYGLYSSSKLINLTHKE-RA 117

Query: 135 WR 136
           W+
Sbjct: 118 WK 119


>gi|160947087|ref|ZP_02094254.1| hypothetical protein PEPMIC_01018 [Parvimonas micra ATCC 33270]
 gi|158446221|gb|EDP23216.1| hypothetical protein PEPMIC_01018 [Parvimonas micra ATCC 33270]
          Length = 153

 Score = 86.6 bits (213), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 53/126 (42%), Gaps = 13/126 (10%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK--KSMLDEEPQAWKQGPVF 71
           + +  A   I         I +L++Q+ +Y +   V   KK  +++ DE  + W+ GPV 
Sbjct: 15  NMMNFAEHIIAVANNNDKFITNLQLQKVMYFSMKTVNADKKFLQNLYDEPFKVWRYGPVV 74

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             VY ++K F S PI    ++       I N EI + ++         +   L     +E
Sbjct: 75  KSVYDKYKIFVSSPIIAQAEIVEDYN--IFNDEILKFLDE--------NPFDLVNRSHKE 124

Query: 132 NKTWRR 137
            K W+ 
Sbjct: 125 KK-WKD 129


>gi|296876013|ref|ZP_06900071.1| hypothetical protein HMPREF0833_0629 [Streptococcus parasanguinis
           ATCC 15912]
 gi|296433004|gb|EFH18793.1| hypothetical protein HMPREF0833_0629 [Streptococcus parasanguinis
           ATCC 15912]
          Length = 139

 Score = 86.6 bits (213), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 41/120 (34%), Gaps = 16/120 (13%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDV----VLQKKK--SMLDEEPQAWKQGPV 70
            +AN  I         I +L++Q+ +Y    D     ++   +   + DE    W  GPV
Sbjct: 5   KLANHIIAVAQDNKTSISNLQLQKIMYFAMKDAKEKQLMSMDELSELYDEPFLVWAYGPV 64

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
               Y RFK F S PI                 +  + +     +Y S +   L     +
Sbjct: 65  VKSQYDRFKRFGSSPI----------IGLFQASDDLKKINGTIKEYLSETVSSLVRKSHQ 114


>gi|260904045|ref|ZP_05912367.1| putative prophage protein [Brevibacterium linens BL2]
          Length = 257

 Score = 86.2 bits (212), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 43/128 (33%), Gaps = 16/128 (12%)

Query: 32  PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMD 91
            +   K  + +Y T    +    +    +   AW+ GP     Y  F           + 
Sbjct: 96  EVSVTKAMKLVYYTQAWSLAWTGQDAFSDPVVAWQYGPTTELAYKNF--------TATVP 147

Query: 92  LSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPN--TNRT 149
            S  I     + E+  ++++I   Y   +  QL +    E   W++ ++         R 
Sbjct: 148 RSDGI-----SAELKSVVDAIVGYYNQFTATQLVDRTHSE-SPWKKTFNSLSGGHEAGRA 201

Query: 150 ITVEEITK 157
           I   ++ K
Sbjct: 202 IAPTDMKK 209


>gi|328464139|gb|EGF35610.1| Phage associated protein [Lactobacillus helveticus MTCC 5463]
          Length = 219

 Score = 85.8 bits (211), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 7   TQTNPPYSTIAVANFFI------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE 60
           +   P +  + +AN+F        +      PI  +++ + +Y  +   +++ KK +   
Sbjct: 110 SSEQPKFKAVQLANWFRVNNYFARQFDYNVDPITQMQVVKLLYFAYGRFLVKSKKRLFSS 169

Query: 61  EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIM 109
                + GPV   V+ +F+       +     +F  +  + ++ EI +++
Sbjct: 170 PILHLQYGPVVEEVHQQFRGMVVPDPDKPDKQAFEDYNLVSSDAEINDLL 219


>gi|46201439|ref|ZP_00055053.2| COG3600: Uncharacterized phage-associated protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 179

 Score = 85.8 bits (211), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 34/193 (17%), Positives = 69/193 (35%), Gaps = 25/193 (12%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDV-VLQKKKSMLDEEPQAWKQGPVFVGVYHRFK 79
           +  D+ +     I   K+ + +YL+     V    + ++         GPV   V+H F 
Sbjct: 4   WISDQALNDREYIQPQKLHRLLYLSQAYFAVAYHGRKLMPATFVTDAFGPVEPTVFHAF- 62

Query: 80  YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLY 139
            +              I   + ++++   ++ IW +Y  ++ +QL + + E       + 
Sbjct: 63  AYGR---------PTMIEGNMLSEQVSHFLDGIWRRYGPYTADQLTKKIIEHA----PVA 109

Query: 140 DPNDPNTNRTITVEEITK----MADGSNISPENV--VEQIKKPVRFDSDSEFATLESQLV 193
                  N  I   ++ K     A   N    NV  ++ + KP    S     T +   V
Sbjct: 110 LAMAKGQNEEIPFADMVKYYSEAAAARNNPASNVDSIDTVMKPRMMRSQ----TGKPVTV 165

Query: 194 KGFKSMPPQLTKE 206
             +K  P  + K+
Sbjct: 166 AAWKPKPASVKKD 178


>gi|70726748|ref|YP_253662.1| hypothetical protein SH1747 [Staphylococcus haemolyticus JCSC1435]
 gi|68447472|dbj|BAE05056.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 177

 Score = 85.4 bits (210), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 31/148 (20%), Positives = 59/148 (39%), Gaps = 18/148 (12%)

Query: 18  VANFFIDKGVK-YSIPI--DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
           +A   I K  +     I  D +K+Q+ +Y      +     +++DEE + W  GPV   +
Sbjct: 13  IAQNLISKYQEITGNSIVGDEMKVQKLMYYIQKTSIALTGDTIIDEEFEGWVHGPVLPSL 72

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
              F  +    I     +         +     I+E+   +Y  ++T  L+E    E   
Sbjct: 73  RGLF-DYFVEDITSKNKI---------DDTEEFIIENAIYQYGKYATWALREKSHNEIS- 121

Query: 135 W---RRLYDPNDPNTNRTITVEEITKMA 159
           W   R+    N+   N  +++E+I + A
Sbjct: 122 WINSRKGLSSNERGHN-KLSIEDIKEDA 148


>gi|59801954|ref|YP_208666.1| putative phage associated protein [Neisseria gonorrhoeae FA 1090]
 gi|240017306|ref|ZP_04723846.1| putative phage associated protein [Neisseria gonorrhoeae FA6140]
 gi|240128886|ref|ZP_04741547.1| putative phage associated protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291043460|ref|ZP_06569176.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|293398762|ref|ZP_06642931.1| phage associated protein [Neisseria gonorrhoeae F62]
 gi|59718849|gb|AAW90254.1| hypothetical protein, putative phage associated protein [Neisseria
           gonorrhoeae FA 1090]
 gi|291011923|gb|EFE03912.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2]
 gi|291610819|gb|EFF39925.1| phage associated protein [Neisseria gonorrhoeae F62]
          Length = 215

 Score = 85.4 bits (210), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 25/170 (14%), Positives = 57/170 (33%), Gaps = 30/170 (17%)

Query: 2   KKRTFTQTNPPYS--------TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQK 53
           +K    ++  P++            A F + K       ++ LK+ + +YL   +  L+ 
Sbjct: 14  RKPHIIKSMKPHNDTIFQEPKAAQAAAFLLYKANGR---LEVLKLMKLMYLAERESFLRF 70

Query: 54  KKSMLDEEPQAWKQGPV--------------FVGVYHRFKYFDSHPIEVIMDLSFRIFP- 98
            + +  +   +   GPV                  +  +     + +  + D S    P 
Sbjct: 71  GEGLTGDALVSMPHGPVLSMTLDFINGGHESVPNGWATWVSDRENRMLALRDPSMIRTPG 130

Query: 99  ---KIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT-WRRLYDPNDP 144
                 ++   E++ES+W  Y  +S   L+ +        W   +  + P
Sbjct: 131 QDLSALSEADLEVLESVWENYGHYSAWDLRNMTHNGLCPEWEDPHGSSRP 180


>gi|298695147|gb|ADI98369.1| hypothetical protein SAOV_1906 [Staphylococcus aureus subsp. aureus
           ED133]
          Length = 175

 Score = 84.6 bits (208), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/156 (21%), Positives = 61/156 (39%), Gaps = 18/156 (11%)

Query: 11  PPYSTIAVANFFIDKGVK-YSIPI--DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
            P +T  +A   I K  +     I  D +K+ + +Y      +     +++DE+ + W  
Sbjct: 4   QPNNTYVIAQNLITKYQEITGNSIVGDEMKVHKLMYYIQKTSIALTGNAIIDEQFEGWVH 63

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           GPV   +   F YF                    N     I+E+   +Y  ++T  L+E 
Sbjct: 64  GPVLPSLRGLFDYFVEDNTSRNK----------VNDTEEFIIENAIYQYGKYATWALREK 113

Query: 128 VQEENKTW---RRLYDPNDPNTNRTITVEEITKMAD 160
             EE   W   R+    N+      +T+E+I + A+
Sbjct: 114 SHEEIS-WLNSRKGLSANERGYRN-LTIEDIKEDAN 147


>gi|240014861|ref|ZP_04721774.1| putative phage associated protein [Neisseria gonorrhoeae DGI18]
 gi|240081052|ref|ZP_04725595.1| putative phage associated protein [Neisseria gonorrhoeae FA19]
 gi|240113262|ref|ZP_04727752.1| putative phage associated protein [Neisseria gonorrhoeae MS11]
 gi|240115327|ref|ZP_04729389.1| putative phage associated protein [Neisseria gonorrhoeae PID18]
 gi|240118671|ref|ZP_04732733.1| putative phage associated protein [Neisseria gonorrhoeae PID1]
 gi|240121950|ref|ZP_04734912.1| putative phage associated protein [Neisseria gonorrhoeae PID24-1]
 gi|240124215|ref|ZP_04737171.1| putative phage associated protein [Neisseria gonorrhoeae PID332]
 gi|260440168|ref|ZP_05793984.1| putative phage associated protein [Neisseria gonorrhoeae DGI2]
 gi|268597164|ref|ZP_06131331.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268599342|ref|ZP_06133509.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268601012|ref|ZP_06135179.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268604383|ref|ZP_06138550.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268682841|ref|ZP_06149703.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268687267|ref|ZP_06154129.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
 gi|268550952|gb|EEZ45971.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19]
 gi|268583473|gb|EEZ48149.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11]
 gi|268585143|gb|EEZ49819.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18]
 gi|268588514|gb|EEZ53190.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1]
 gi|268623125|gb|EEZ55525.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332]
 gi|268627551|gb|EEZ59951.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035]
          Length = 194

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/163 (17%), Positives = 56/163 (34%), Gaps = 23/163 (14%)

Query: 1   MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE 60
           MK    T    P +  A A F + K       ++ LK+ + +YL   +  L+  + +  +
Sbjct: 1   MKPHNDTIFQEPKAAQA-AAFLLYKANGR---LEVLKLMKLMYLAERESFLRFGEGLTGD 56

Query: 61  EPQAWKQGPV--------------FVGVYHRFKYFDSHPIEVIMDLSFRIFP----KIAN 102
              +   GPV                  +  +     + +  + D S    P       +
Sbjct: 57  ALVSMPHGPVLSMTLDFINGGHESVPNGWATWVSDRENRMLALRDPSMIRTPGQDLSALS 116

Query: 103 QEIGEIMESIWNKYQSHSTEQLQEIVQEENKT-WRRLYDPNDP 144
           +   E++ES+W  Y  +S   L+ +        W   +  + P
Sbjct: 117 EADLEVLESVWENYGHYSAWDLRNMTHNGLCPEWEDPHGSSRP 159


>gi|197294760|ref|YP_001799301.1| Putative phage associated protein [Candidatus Phytoplasma
          australiense]
 gi|171854087|emb|CAM12064.1| Putative phage associated protein [Candidatus Phytoplasma
          australiense]
          Length = 68

 Score = 83.9 bits (206), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 30/71 (42%), Gaps = 4/71 (5%)

Query: 7  TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKK-SMLDEEPQAW 65
           + N   +   VAN+ I+          H+K+ + IY  +   +++        +  +AW
Sbjct: 1  MKNNNQINVFDVANYIIE---NNPHKTTHMKLHKMIYYAYAKYLMKHNSLPNFKDSFRAW 57

Query: 66 KQGPVFVGVYH 76
            GPV   +Y+
Sbjct: 58 IYGPVLPELYN 68


>gi|283469625|emb|CAQ48836.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 175

 Score = 83.1 bits (204), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 60/156 (38%), Gaps = 18/156 (11%)

Query: 11  PPYSTIAVANFFIDKGVK-YSIPI--DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
            P +T  +A   I K  +     I  D +K+ + +Y      +     +++DE+ + W  
Sbjct: 4   QPNNTYVIAQNLITKYQEITGNSIVGDEMKVHKLMYYIQKTSIALTGNAIIDEQFEGWVH 63

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           GPV   +   F YF                    N     I+E+   +Y  ++T  L+E 
Sbjct: 64  GPVLPSLRGLFDYFVEDNTSRNK----------VNDTEEFIIENAIYQYGKYATWALREK 113

Query: 128 VQEENKTW---RRLYDPNDPNTNRTITVEEITKMAD 160
             EE   W   R+    N+      + +E+I + A+
Sbjct: 114 SHEEIS-WLNSRKGLSANERGYRN-LAIEDIKEDAN 147


>gi|15923906|ref|NP_371440.1| hypothetical protein SAV0916 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|156979242|ref|YP_001441501.1| hypothetical protein SAHV_0911 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|255005706|ref|ZP_05144307.2| hypothetical protein SauraM_04535 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|14246685|dbj|BAB57078.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu50]
 gi|156721377|dbj|BAF77794.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
          Length = 210

 Score = 82.7 bits (203), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 50/128 (39%), Gaps = 11/128 (8%)

Query: 12  PYSTIAVANFFIDKG--VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
            Y+   +A +F++       +    +L + + IY           K ++DE P  +  GP
Sbjct: 2   TYNINTIAKWFVENNITSSENSYDGNLTLNKLIYFADAMNYAINNKKLVDEIPVGFANGP 61

Query: 70  VFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
           V+  VY   +Y     I               ++E  +++  +   + S++++ L E+  
Sbjct: 62  VYQSVYVDHRYRTLESI--------NSDDAEISEETLKLLRIVKFAFGSYTSQYLSELTH 113

Query: 130 EENKTWRR 137
            E   W+ 
Sbjct: 114 -EQTPWKN 120


>gi|283470703|emb|CAQ49914.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus
           ST398]
          Length = 148

 Score = 82.3 bits (202), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 33/156 (21%), Positives = 57/156 (36%), Gaps = 20/156 (12%)

Query: 11  PPYSTIAVANFFIDKGVK-YSIPI--DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
            P +T  +A   I K  +     I  D +K+ + +Y      +     +++DE+ + W  
Sbjct: 4   QPNNTYVIAQNLITKYQEITGNSIVGDEMKVHKLMYYIQKTSIALTGNAIIDEQFEGWVH 63

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           GPV   +   F YF                    N     I+E+   +Y  ++T  L+E 
Sbjct: 64  GPVLPSLRGLFDYFVEDNTSRNK----------VNDTEEFIIENAIYQYGKYATWALREK 113

Query: 128 VQEENKTW---RRLYDPNDPNTNR---TITVEEITK 157
             EE   W   R+    N+         I+ +  TK
Sbjct: 114 SHEEIS-WLNSRKGLSANERGYRNLQLRISKKMQTK 148


>gi|260102197|ref|ZP_05752434.1| xre family toxin-antitoxin system [Lactobacillus helveticus DSM
           20075]
 gi|260083994|gb|EEW68114.1| xre family toxin-antitoxin system [Lactobacillus helveticus DSM
           20075]
          Length = 219

 Score = 82.3 bits (202), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 46/110 (41%), Gaps = 7/110 (6%)

Query: 7   TQTNPPYSTIAVANFFI------DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE 60
           +   P +  + +AN+F        +      PI  +++ + +Y  +   +++ KK +   
Sbjct: 110 SSEQPKFKAVQLANWFRVNNYFARQFDYNVDPIMQMQVVKLLYFAYGRFLVKSKKRLFSS 169

Query: 61  EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI-ANQEIGEIM 109
                + GPV   V+ +F+       +     +F  +  + ++ EI +++
Sbjct: 170 PILHLQYGPVVEEVHQQFRGMVVPDPDKPDKQAFEDYNLVSSDAEINDLL 219


>gi|42561013|ref|NP_975464.1| hypothetical protein MSC_0478 [Mycoplasma mycoides subsp.
          mycoides SC str. PG1]
 gi|42492510|emb|CAE77106.1| Conserved hypothetical protein [Mycoplasma mycoides subsp.
          mycoides SC str. PG1]
          Length = 73

 Score = 82.3 bits (202), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 31/73 (42%), Gaps = 6/73 (8%)

Query: 11 PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE-PQAWKQGP 69
          P YS   ++++F+ K       +   K+Q+  Y           + +L +   QAW  GP
Sbjct: 6  PKYSYKDISDWFLSK-----ESMTPKKLQKLTYYAEAWAYALFDEGILSDTSFQAWIHGP 60

Query: 70 VFVGVYHRFKYFD 82
          V   ++  +K + 
Sbjct: 61 VSPELWRDYKDYG 73


>gi|227508502|ref|ZP_03938551.1| conserved hypothetical protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
 gi|227192152|gb|EEI72219.1| conserved hypothetical protein [Lactobacillus brevis subsp.
           gravesensis ATCC 27305]
          Length = 117

 Score = 82.0 bits (201), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 18/101 (17%), Positives = 47/101 (46%), Gaps = 8/101 (7%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKK------SMLDEEPQAWKQGPV 70
            +A+  I    + ++PI +L++Q+ ++ +  D ++  +        + D+    W+ GPV
Sbjct: 5   DLAHHIIGIAQEKNLPITNLQLQKVMFFSLKDAIVNHRFSESALMRIYDKPFLVWRYGPV 64

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMES 111
              +Y  ++ + + PI      +     +  N++I  ++E 
Sbjct: 65  EKDIYDEYRIYGADPIIEPNKSNSDF--ESLNEKIISLLEE 103


>gi|319941572|ref|ZP_08015898.1| hypothetical protein HMPREF9464_01117 [Sutterella wadsworthensis
           3_1_45B]
 gi|319804942|gb|EFW01784.1| hypothetical protein HMPREF9464_01117 [Sutterella wadsworthensis
           3_1_45B]
          Length = 189

 Score = 80.4 bits (197), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/142 (13%), Positives = 51/142 (35%), Gaps = 21/142 (14%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
              VA + + K       +  LK+ + +Y+     +LQ  + +  ++  +   GPV    
Sbjct: 7   ATHVAAYLLWK---RGRRMSSLKLMKMMYIAEKQFLLQYGERLTGDKMVSMPYGPVLSAT 63

Query: 75  YHRF---KYFDSHPIEVIMDLSFRIFPKI-------------ANQEIGEIMESIWNKYQS 118
           Y  F   + +    I    +    +   I              +     +++S+++K+ +
Sbjct: 64  YDCFMGDREYWDSWIINPGNYDLALNSSIKVDPADPLDTFDELSVAEKTVLDSVYSKFGA 123

Query: 119 HSTEQLQEIVQEENKT--WRRL 138
            +   L +++ + +    W   
Sbjct: 124 SNRWDLVKLLHDPDYCPEWENP 145


>gi|224543170|ref|ZP_03683709.1| hypothetical protein CATMIT_02370 [Catenibacterium mitsuokai DSM
           15897]
 gi|224523957|gb|EEF93062.1| hypothetical protein CATMIT_02370 [Catenibacterium mitsuokai DSM
           15897]
          Length = 240

 Score = 80.0 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/133 (15%), Positives = 47/133 (35%), Gaps = 8/133 (6%)

Query: 23  IDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFD 82
           I         +  ++++ ++Y           + +  E  +AWKQG ++  VYH F  F 
Sbjct: 109 ISYLFYKLEELTPMQLESYLYFIQAYS---YPEPLFHEHCEAWKQGVIYPDVYHLFSTFP 165

Query: 83  SHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPN 142
               + +            +    + ++ I N +  +  + L  +   +   W+  Y  +
Sbjct: 166 FKVQDDVRYKIIEDAYHHLDDSKKQFIDDILNTFSRYPLKTLVTL--AKTGPWKNNYQED 223

Query: 143 DPNTNRTITVEEI 155
                  I  ++I
Sbjct: 224 KV---TVIPQQDI 233


>gi|261207991|ref|ZP_05922670.1| predicted protein [Enterococcus faecium TC 6]
 gi|289567528|ref|ZP_06447873.1| predicted protein [Enterococcus faecium D344SRF]
 gi|260077790|gb|EEW65502.1| predicted protein [Enterococcus faecium TC 6]
 gi|289160676|gb|EFD08631.1| predicted protein [Enterococcus faecium D344SRF]
          Length = 221

 Score = 80.0 bits (196), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 45/114 (39%), Gaps = 7/114 (6%)

Query: 19  ANFFIDKGVKYSIPI--DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
           A FF+ K +  +      ++K+Q+ ++  +     +    + +E   A++ G V   V  
Sbjct: 8   AKFFLKKNLDSNPNTFDGNMKLQKLLFFANLINFSKHNSLLFEESMLAFENGTVIEEVRK 67

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
           R+K               + F     QE   ++    + + + S ++L E+  +
Sbjct: 68  RYKNDYHS-----YKQDAKNFNPDFTQEEYNVLNDTISIFGNLSAKELSELNHQ 116


>gi|183602546|ref|ZP_02963911.1| hypothetical protein BIFLAC_04406 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219683591|ref|YP_002469974.1| hypothetical protein BLA_1110 [Bifidobacterium animalis subsp.
           lactis AD011]
 gi|241190620|ref|YP_002968014.1| putative prophage protein [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|241196026|ref|YP_002969581.1| putative prophage protein [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|183218187|gb|EDT88833.1| hypothetical protein BIFLAC_04406 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219621241|gb|ACL29398.1| conserved hypothetical protein [Bifidobacterium animalis subsp.
           lactis AD011]
 gi|240249012|gb|ACS45952.1| putative prophage protein [Bifidobacterium animalis subsp. lactis
           Bl-04]
 gi|240250580|gb|ACS47519.1| putative prophage protein [Bifidobacterium animalis subsp. lactis
           DSM 10140]
 gi|289178359|gb|ADC85605.1| hypothetical protein BIF_01886 [Bifidobacterium animalis subsp.
           lactis BB-12]
 gi|295793609|gb|ADG33144.1| putative prophage protein [Bifidobacterium animalis subsp. lactis
           V9]
          Length = 170

 Score = 80.0 bits (196), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 21/146 (14%), Positives = 48/146 (32%), Gaps = 9/146 (6%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
              VA   +      +  + +LK+   +Y      +      +  +E    + GPV   +
Sbjct: 3   ASDVARHIVAH-YGDAWFLTNLKLNLLVYWCQVGALRDAGAPLFADEIAVGECGPVIPAI 61

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           +  ++ F S  I +  +       K   +    ++ S+  +    +   L  +    +  
Sbjct: 62  WAEYEAFGSRMIRLRDEWQV----KALGENTESLVASVMRELGWLTAADLLNLSNHPDGA 117

Query: 135 WRRLYDPNDPNTNRTITVEEITKMAD 160
           W    +        +I+V  I   AD
Sbjct: 118 W----NAAREQGYESISVSHIAGSAD 139


>gi|71275398|ref|ZP_00651684.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71898570|ref|ZP_00680741.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|170730373|ref|YP_001775806.1| hypothetical protein Xfasm12_1233 [Xylella fastidiosa M12]
 gi|71163698|gb|EAO13414.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71731694|gb|EAO33754.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|167965166|gb|ACA12176.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 127

 Score = 79.6 bits (195), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 40/90 (44%), Gaps = 2/90 (2%)

Query: 58  LDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI--ANQEIGEIMESIWNK 115
           +DE  +AW+ GPV   +Y+  K + S  I   + + +  + +    +     I+ S+W  
Sbjct: 1   MDEPVEAWRAGPVIHSLYNAIKQYGSSGITERLPVRWFSWGRASKLDVTAAAILASVWAT 60

Query: 116 YQSHSTEQLQEIVQEENKTWRRLYDPNDPN 145
           Y+ +   +L  I + E   W   +   + N
Sbjct: 61  YRRYGGVELAAITRAEGSPWWTTWKGLNEN 90


>gi|315652286|ref|ZP_07905278.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
 gi|315485409|gb|EFU75799.1| conserved hypothetical protein [Eubacterium saburreum DSM 3986]
          Length = 203

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 56/142 (39%), Gaps = 16/142 (11%)

Query: 17  AVANFFIDKG--VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            +A +F+ K   ++     ++ K+ + +Y +H        +++ +   + W  GPV   +
Sbjct: 5   DLAKWFLIKNPVLRDGYIDENTKLNKLLYFSHLMYYAITNQNLTNCVFEKWDNGPVSREI 64

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
           Y  ++Y         +   +     I NQ I +I++ +   Y + +  +L E        
Sbjct: 65  YIAYRY-------EELGCHYDDAADIINQHILKILQIVNFVYANKTARELSEETHTH-SI 116

Query: 135 WRRLYDPNDPNTNRTITVEEIT 156
           W+ +        N  I  E I+
Sbjct: 117 WQEV------GRNEKIIFENIS 132


>gi|254453001|ref|ZP_05066438.1| hypothetical protein OA238_3618 [Octadecabacter antarcticus 238]
 gi|198267407|gb|EDY91677.1| hypothetical protein OA238_3618 [Octadecabacter antarcticus 238]
          Length = 86

 Score = 79.3 bits (194), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 3/77 (3%)

Query: 60  EEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQE---IGEIMESIWNKY 116
           E P+ WK GPVF  +YH FK F   PI      +    P+  +Q+      ++  IW +Y
Sbjct: 4   EGPEIWKHGPVFDSLYHAFKVFGRKPITAPQSSNPFAAPENVDQDDENTRNLVTWIWGRY 63

Query: 117 QSHSTEQLQEIVQEENK 133
              S   L ++  ++  
Sbjct: 64  GHLSGFALSDLTHKDGT 80


>gi|306830690|ref|ZP_07463855.1| phage protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|304427198|gb|EFM30305.1| phage protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 142

 Score = 78.9 bits (193), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 47/127 (37%), Gaps = 19/127 (14%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK----KSMLDEEPQAWKQGPVFV 72
            +AN  I       +PI +L++Q+ +Y T  +          K   +E    W+ GPV  
Sbjct: 5   ELANHIIAVAHDNELPITNLQLQKILYFTLRNSRRYLDEDTLKETYNEPFLVWRYGPVVE 64

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ--- 129
             Y+RF  + S PI      SF   PK  N      +  +   +      ++ +      
Sbjct: 65  SQYNRFYSYGSSPIID----SFNQIPKYEN------LNQMILHFLKIDVFRMVDASHTHK 114

Query: 130 --EENKT 134
             +EN  
Sbjct: 115 FWKENSP 121


>gi|312199397|ref|YP_004019458.1| hypothetical protein FraEuI1c_5603 [Frankia sp. EuI1c]
 gi|311230733|gb|ADP83588.1| hypothetical protein FraEuI1c_5603 [Frankia sp. EuI1c]
          Length = 197

 Score = 78.5 bits (192), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 46/123 (37%), Gaps = 11/123 (8%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S   VA + +++       +   ++Q+ +Y T    +      + ++  +A   GPV + 
Sbjct: 4   SVDDVAAYLLERLGA----LTVARLQRLVYYTQAWHLADHHVHLFEDPIEARADGPVVLR 59

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           ++ +        +           P+       +++E +   Y S    +L  IV+ E  
Sbjct: 60  LHDQAG--GRDEVHEWPAGD----PRRLGARARDVIEWVLGAYGSFPDAELARIVRAE-A 112

Query: 134 TWR 136
            WR
Sbjct: 113 PWR 115


>gi|222086937|ref|YP_002545471.1| hypothetical protein Arad_3637 [Agrobacterium radiobacter K84]
 gi|221724385|gb|ACM27541.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 190

 Score = 78.1 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 24/152 (15%), Positives = 50/152 (32%), Gaps = 20/152 (13%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
           +P  +   +A  FI K       I+ LK  + +YL   + + +    +LDE   +   GP
Sbjct: 4   DPKKAAQLIAR-FIQKS--GGNSINVLKAVKLVYLADRESIGRYGFPILDETRVSMPHGP 60

Query: 70  VFVGVYHRFKYFDS-------HPIEVIMDLSFRIFPKIANQEIGEIM--------ESIWN 114
           V    Y                 +E        +       +  E +        +++W 
Sbjct: 61  VNSTTYSHINGEYDLGACGWADYLEDKEHHQIALANTALTVDDLEELSDADLECVDAVWE 120

Query: 115 KYQSHSTEQLQEIVQEE-NKT-WRRLYDPNDP 144
           ++   +  +L++      N   W      ++P
Sbjct: 121 RFGVMNQWELRDWTHNPKNIPEWEDPNGASNP 152


>gi|296328507|ref|ZP_06871026.1| gp27 family protein [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
 gi|296154316|gb|EFG95115.1| gp27 family protein [Fusobacterium nucleatum subsp. nucleatum ATCC
           23726]
          Length = 113

 Score = 78.1 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 22/105 (20%), Positives = 38/105 (36%), Gaps = 11/105 (10%)

Query: 16  IAVANFFIDKGVK-YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
           + VA +   +  +     ID +K+Q+ +Y +  + +    K M  E  + WK GPV   V
Sbjct: 17  LNVAEYIFKEYYRISGEYIDEMKLQKLLYFSQRESLAILNKPMFSENFEGWKYGPVSREV 76

Query: 75  YHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSH 119
              F                    +    E   I+ +I  +Y S 
Sbjct: 77  RTYF----------TPKDGITTNTEDIKSENKYIINNIILEYGSL 111


>gi|265763443|ref|ZP_06092011.1| predicted protein [Bacteroides sp. 2_1_16]
 gi|263256051|gb|EEZ27397.1| predicted protein [Bacteroides sp. 2_1_16]
          Length = 182

 Score = 78.1 bits (191), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 28/142 (19%), Positives = 57/142 (40%), Gaps = 17/142 (11%)

Query: 22  FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYF 81
            +         I+  K+ + ++L   + V  +  S+      AW++GPV   +Y   K  
Sbjct: 9   LLAYISSKIEDINLRKLIKLVFLIDEESVRSRGISVTWLTYYAWEKGPVAPCIY-EIKDR 67

Query: 82  D---SHPIEVIMDLSFRIF----------PKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
               S  I V  +   ++               +++   +++SI +KY   S + L EI 
Sbjct: 68  GGIFSKYISVHRNREEKVIITPFVDKNESSIQFSKKELRLIDSIIDKYGQLSADDLSEIT 127

Query: 129 QEENKTW---RRLYDPNDPNTN 147
            +    W   ++ Y+PN  ++N
Sbjct: 128 HKPGGLWDIAKKKYNPNFKSSN 149


>gi|256847921|ref|ZP_05553366.1| GepA protein [Lactobacillus coleohominis 101-4-CHN]
 gi|256715610|gb|EEU30586.1| GepA protein [Lactobacillus coleohominis 101-4-CHN]
          Length = 235

 Score = 76.9 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/159 (14%), Positives = 55/159 (34%), Gaps = 18/159 (11%)

Query: 5   TFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQA 64
           +  ++    +   +A++      +    +D   +Q+ +Y  +   + +  +   +    A
Sbjct: 81  SDMKSKSELNDEDIASYL-----QTKYHLDAFSLQKVLYYGYAGFLTEFHQRPFNAHFIA 135

Query: 65  WKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTE-- 122
           +  GPV   ++   K     P  +     F +    A  +I + ++ +  KY  +  +  
Sbjct: 136 FSHGPVDYDIWKWIK---YSPETMNYQFDF-LQKIAAKPKIKQYLDGVVKKYGQYFQKTN 191

Query: 123 ----QLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITK 157
                 +         W R Y       N  IT ++I K
Sbjct: 192 SFKNDDENPTHNLGTPWSRAYA---KGQNTPITDDDILK 227


>gi|148548607|ref|YP_001268709.1| hypothetical protein Pput_3399 [Pseudomonas putida F1]
 gi|148512665|gb|ABQ79525.1| hypothetical protein Pput_3399 [Pseudomonas putida F1]
          Length = 191

 Score = 76.9 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/186 (15%), Positives = 62/186 (33%), Gaps = 28/186 (15%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            +A FF+ +       +  LK+ + +YL     +   ++ +  +   +   GPV    Y 
Sbjct: 10  QMAAFFLQR---NGGSLSILKLMKLLYLADRKALDVYEEPISGDRMVSMPHGPVLSRTYE 66

Query: 77  RFKYFDSHPIE----------------VIMDLSFRIFPK-IANQEIGEIMESIWNKYQSH 119
                     +                    +S         ++   E++     +Y   
Sbjct: 67  LMNGAGCSVDKGWDSWVADRADRMLSLKECHISSNDLDLPALSESDLEVLSETQAEYGDK 126

Query: 120 STEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRF 179
               L+    ++   W    DPN   ++R I+ E + + A G +  PE+     ++   F
Sbjct: 127 EAWVLRNYTHDKCAEWE---DPN--GSSRPISYESVFR-ALGRD--PESAKSAQQRIESF 178

Query: 180 DSDSEF 185
           +S  E 
Sbjct: 179 NSTDEL 184


>gi|225021857|ref|ZP_03711049.1| hypothetical protein CORMATOL_01889 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224945405|gb|EEG26614.1| hypothetical protein CORMATOL_01889 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 179

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/144 (13%), Positives = 45/144 (31%), Gaps = 22/144 (15%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           +   V  +      +    +D +K+ +  Y +    +      +  E  QAW  GP+   
Sbjct: 3   NVYDVGQYI----TELVPTVDTMKLYKLCYFSQGWKLAWTGCLLFQEPLQAWANGPI--- 55

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
                      PI +                    +ES+ + Y    + +L  +     K
Sbjct: 56  -----------PIALRDRSKPGGDATNLTDTELHTVESVVDFYGDKDSIELSRLS--RGK 102

Query: 134 TWRRL--YDPNDPNTNRTITVEEI 155
            W+      P++  +   ++V  +
Sbjct: 103 AWKEARRNLPDNVRSQEILSVTTM 126


>gi|71276650|ref|ZP_00652922.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71900060|ref|ZP_00682204.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|170730096|ref|YP_001775529.1| hypothetical protein Xfasm12_0920 [Xylella fastidiosa M12]
 gi|71162577|gb|EAO12307.1| phage-related protein [Xylella fastidiosa Dixon]
 gi|71730203|gb|EAO32290.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|167964889|gb|ACA11899.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 83

 Score = 75.8 bits (185), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 15/76 (19%), Positives = 36/76 (47%)

Query: 33  IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDL 92
           +  L++ + +YL H   +    + ++DE  +AW+ GPV   +Y+  K   S  I   + +
Sbjct: 2   LTPLQVLKLVYLAHGWCLGVHTQPLIDESVEAWRAGPVIRPLYNVIKQDGSSGITERLPV 61

Query: 93  SFRIFPKIANQEIGEI 108
            +    + +  ++  +
Sbjct: 62  RWFSCGRASKIDVTTV 77


>gi|85717694|ref|ZP_01048630.1| hypothetical protein NB311A_08764 [Nitrobacter sp. Nb-311A]
 gi|85695491|gb|EAQ33413.1| hypothetical protein NB311A_08764 [Nitrobacter sp. Nb-311A]
          Length = 190

 Score = 75.8 bits (185), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 27/163 (16%), Positives = 59/163 (36%), Gaps = 25/163 (15%)

Query: 10  NPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
            P  +   +A + I K  +  + I  LK  + +YL   + + +    +LDE+  +   GP
Sbjct: 4   EPKRAAQLIA-YLILKSGRGKLNI--LKAIKLVYLIDRESIKRFGFPVLDEKRCSMPHGP 60

Query: 70  VFVGVYHRFKYF------DSHPI-EVIMDLSFRIFPKIANQEIGEIM--------ESIWN 114
           V    Y                I     + +  +  +    +  + +        +++W 
Sbjct: 61  VNSMTYDHINGVYDDDESGWSAILTDRENHNIALANREIRPDELDELSEADIECADAVWG 120

Query: 115 KYQSHSTEQLQEIVQEE-NKT-WRRLYDPNDPNTNRTITVEEI 155
           ++   +  QL++   +  N   W    DPN    +  I ++ I
Sbjct: 121 QFGHMTKWQLRDWTHDPRNVPEWE---DPN--GGSTEIPLQRI 158


>gi|76787839|ref|YP_330667.1| hypothetical protein SAK_2077 [Streptococcus agalactiae A909]
 gi|76562896|gb|ABA45480.1| conserved hypothetical protein [Streptococcus agalactiae A909]
          Length = 168

 Score = 75.8 bits (185), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 28/156 (17%), Positives = 53/156 (33%), Gaps = 20/156 (12%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK----------------KSMLDEEPQA 64
           F ++   K       +K+Q+ +YL                          K +     +A
Sbjct: 11  FLVNFLYKLLDNPTQIKVQKTLYLLFAFYGATYGNLDKDEDNEFSDQNYPKQLFKAIFEA 70

Query: 65  WKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQL 124
           W+ GPV   VY + K      I +  +   + F     + + + +E+I  +        L
Sbjct: 71  WRYGPVETDVYAKEKSGSYSDIAINEENINKFFNTPELKNVRDFIENIVEQTNQIDDFSL 130

Query: 125 QEIVQEENKTWRRLYDPND---PNTNRTITVEEITK 157
            +   ++N  W  +Y   +   P  N  I  E I +
Sbjct: 131 VDRTHQDN-VWLDVYKEGESHIPMENEKIIQEYIDR 165


>gi|71898043|ref|ZP_00680248.1| phage-related protein [Xylella fastidiosa Ann-1]
 gi|71732287|gb|EAO34342.1| phage-related protein [Xylella fastidiosa Ann-1]
          Length = 83

 Score = 75.4 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 28/56 (50%)

Query: 33 IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEV 88
          +  L++ + +YL H   +    + ++DE  +AW+ GP+   +Y+  K   S  I  
Sbjct: 2  LTPLQVLKLVYLAHGWCLGVHTQPLIDEPVEAWRAGPLIRSLYNVIKQDGSSGITE 57


>gi|319779083|ref|YP_004129996.1| putative phage associated protein [Taylorella equigenitalis MCE9]
 gi|317109107|gb|ADU91853.1| putative phage associated protein [Taylorella equigenitalis MCE9]
          Length = 162

 Score = 74.6 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 59/151 (39%), Gaps = 24/151 (15%)

Query: 40  QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR---FKYFDSHP----IEVIMD- 91
           + +YL   + +L+   S+ ++   +   GPV          F+ +DS+     I    + 
Sbjct: 2   KLLYLAERESLLRYGTSITNDAFVSMPHGPVLSMTLDCINGFRTYDSNCWNTWIADREEN 61

Query: 92  ---------LSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT-WRRLYDP 141
                    +      +  ++   E ++S+W +Y  +S  +L++I        W      
Sbjct: 62  HLVLAAPGMIRSTDDLRELSESDVEALDSVWKEYGYYSATKLRDITHSSFCPEWEDP--- 118

Query: 142 NDPNTNRTITVEEITKMADGSNISPENVVEQ 172
                ++ I+++++   + G N S  N + Q
Sbjct: 119 --KGYSKPISMKKLL-TSIGYNDSQANSIIQ 146


>gi|38233401|ref|NP_939168.1| hypothetical protein DIP0802 [Corynebacterium diphtheriae NCTC
           13129]
 gi|38199661|emb|CAE49320.1| Putative phage protein [Corynebacterium diphtheriae]
          Length = 165

 Score = 73.5 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 21/127 (16%), Positives = 43/127 (33%), Gaps = 14/127 (11%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF- 71
           YS+  VAN  +      +  +D  K+ + +Y      +    +     + QAW  GPV  
Sbjct: 14  YSSTDVANLILK--TTGTALMDKKKLHKLLYYMQGWTLAALGRPAFANDLQAWVDGPVSV 71

Query: 72  ---VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
                 ++   +        + +          ++++  +M  I   Y    T+ L +  
Sbjct: 72  GMRRDTHYATCF-------EVANRPLSNPLAPQDRDLLALMYLIAPFYAQQQTQALVDST 124

Query: 129 QEENKTW 135
             E   W
Sbjct: 125 HAE-APW 130


>gi|153869471|ref|ZP_01999063.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152074039|gb|EDN70940.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 187

 Score = 73.5 bits (179), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 30/172 (17%), Positives = 61/172 (35%), Gaps = 24/172 (13%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            +A +F     K    I HL + + +Y+   + +     S+ D+   +   GPV      
Sbjct: 14  QLAAYF---TDKNGGEIYHLTLMKLLYIADRNALATLGYSISDDNYVSMDYGPVLSKTSS 70

Query: 77  RFKYFDSHP-------IEVIMDL------SFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
                +          I    D          +   + +Q   EI +S++ +Y +     
Sbjct: 71  LINGSERAENSLWIKLISPSKDYKVSLLNPKNVPTDLLSQAELEIADSVFAQYGNWDRFD 130

Query: 124 LQEIVQEENKTWRRLYDPNDPNTNRT-ITVEEITKMADGSNISPENVVEQIK 174
           L +    E   W+      DPN +   I+ E+I      S     N++++++
Sbjct: 131 LADKTH-EFSEWK------DPNGSAIPISYEDILMALGFSKEDVNNILQELE 175


>gi|251773332|gb|EES53881.1| conserved hypothetical protein [Leptospirillum ferrodiazotrophum]
          Length = 165

 Score = 72.3 bits (176), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 19/134 (14%), Positives = 52/134 (38%), Gaps = 17/134 (12%)

Query: 33  IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFK-YFDSH------- 84
           + HLK+ + +YL+  + + +    +  + P +   GPV     +     + S        
Sbjct: 1   MPHLKLMKLLYLSDRESIQETGLPISWDLPVSMPHGPVLSLTLNLMNGDWGSDTTDGWAS 60

Query: 85  --------PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
                    + ++  +S +   K+++ +  +++ES+W ++       L++   +    W+
Sbjct: 61  WISGKENYEVGLVRPVSRKALDKLSDFD-LDVLESVWARFGEMDQWSLRDWTHDHCAEWQ 119

Query: 137 RLYDPNDPNTNRTI 150
                + P     I
Sbjct: 120 DPDGSSRPIAPGEI 133


>gi|78067174|ref|YP_369943.1| hypothetical protein Bcep18194_A5705 [Burkholderia sp. 383]
 gi|77967919|gb|ABB09299.1| hypothetical protein Bcep18194_A5705 [Burkholderia sp. 383]
          Length = 225

 Score = 71.9 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/141 (10%), Positives = 48/141 (34%), Gaps = 20/141 (14%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
               A + + +      P++  K+ + +YL   +   +  + +  ++   +++ PV  G 
Sbjct: 45  AADAAMYLLVRARA---PVNGAKLNRLLYLAERESFARYGEPLTGDQLLVFEKSPVLYGT 101

Query: 75  YHRFKY-----------------FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQ 117
           Y R                        PI      ++       +     +++++W+++ 
Sbjct: 102 YQRLAGDVPGWEDRIENLANHELRVRVPIFAEEPEAYFDHSTQLSDADIAVLDAVWDEFG 161

Query: 118 SHSTEQLQEIVQEENKTWRRL 138
             +   L + +  + + W   
Sbjct: 162 GMTHWALADYIHSKCREWTDG 182


>gi|254884185|ref|ZP_05256895.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|254836978|gb|EET17287.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
          Length = 196

 Score = 71.9 bits (175), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 69/184 (37%), Gaps = 32/184 (17%)

Query: 14  STIAVAN------FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
           + I +A       + +    +    I   K+ + +Y    D +++  K ++++  +A K 
Sbjct: 14  TAIQIAKIRAVVLYIMQSFTQGVDYI---KLFKILYFAQQDHLVKYGKVIVEDSFRALKH 70

Query: 68  GPVFVGVYHRF-----KYFDSHPIEVIMDLSFRIFPKIANQEIGEI----------MESI 112
           GPV    Y        K  D +  E + D+  R   K+    + ++          +++ 
Sbjct: 71  GPVPAYTYKALQIAEGKPLDGNFDEFLSDIEVRD-KKVYTSAVPDMDYISGANKRCLDAA 129

Query: 113 WNKYQSHSTEQLQEIVQEENKTWRRLYDP-NDPNTNRTITVEEITKMADGSNISPENVVE 171
             KY+      L ++    +  W        D      IT+ +I +    +    E++V+
Sbjct: 130 IAKYKDTDPYDLSDLSH--DSAWEEAMTRIQDDPQKNFITIIDIARAGKAT----EDMVD 183

Query: 172 QIKK 175
            I++
Sbjct: 184 YIRE 187


>gi|255013704|ref|ZP_05285830.1| hypothetical protein B2_07347 [Bacteroides sp. 2_1_7]
 gi|265763564|ref|ZP_06092132.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|313146832|ref|ZP_07809025.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|263256172|gb|EEZ27518.1| conserved hypothetical protein [Bacteroides sp. 2_1_16]
 gi|313135599|gb|EFR52959.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 185

 Score = 71.5 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/184 (16%), Positives = 69/184 (37%), Gaps = 32/184 (17%)

Query: 14  STIAVAN------FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
           + I +A       + +    +    I   K+ + +Y    D +++  K ++++  +A K 
Sbjct: 3   TAIQIAKIRAVVLYIMQSFTQGVDYI---KLFKILYFAQQDHLVKYGKVIVEDSFRALKH 59

Query: 68  GPVFVGVYHRF-----KYFDSHPIEVIMDLSFRIFPKIANQEIGEI----------MESI 112
           GPV    Y        K  D +  E + D+  R   K+    + ++          +++ 
Sbjct: 60  GPVPAYTYKALQIAEGKPLDGNFDEFLSDIEVRD-KKVYTSAVPDMDYISGANKRCLDAA 118

Query: 113 WNKYQSHSTEQLQEIVQEENKTWRRLYDP-NDPNTNRTITVEEITKMADGSNISPENVVE 171
             KY+      L ++    +  W        D      IT+ +I +    +    E++V+
Sbjct: 119 IAKYKDTDPYDLSDLSH--DSAWEEAMTRIQDDPQKNFITIIDIARAGKAT----EDMVD 172

Query: 172 QIKK 175
            I++
Sbjct: 173 YIRE 176


>gi|167856603|ref|ZP_02479304.1| hypothetical protein HPS_05935 [Haemophilus parasuis 29755]
 gi|167852269|gb|EDS23582.1| hypothetical protein HPS_05935 [Haemophilus parasuis 29755]
          Length = 191

 Score = 71.5 bits (174), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 35/195 (17%), Positives = 70/195 (35%), Gaps = 38/195 (19%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY 80
           + + K       + H+K+ + +YL+     L++  S+  +E  +   GPV     +  + 
Sbjct: 13  YLLHKA---GGTMHHIKLMKLLYLSDRLSWLERDHSITGDEYYSLPYGPVLSKTLNLIRG 69

Query: 81  FDSH------------------PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTE 122
              +                   I  I+D     F    +    +I++S++ KY      
Sbjct: 70  ETLNHTKTAWEEWISDKENHQVSIAKIVDEKDEYFWGELSLSDTDILDSVFEKYGHFDRF 129

Query: 123 QLQEIVQEEN--KTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFD 180
            L E+    +    W            + IT+E++ +    S        EQIK    F+
Sbjct: 130 ALVELTHNPDIVPEWEDP-----KGGAKKITLEKLLQHLGKSK-------EQIK--AIFE 175

Query: 181 SDSEFATLESQLVKG 195
             +E   + ++L KG
Sbjct: 176 EQAEMQQI-NRLFKG 189


>gi|42527501|ref|NP_972599.1| hypothetical protein TDE1996 [Treponema denticola ATCC 35405]
 gi|41818086|gb|AAS12510.1| hypothetical protein TDE_1996 [Treponema denticola ATCC 35405]
          Length = 186

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 59/157 (37%), Gaps = 20/157 (12%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +  I V N+ + K   Y   +++ K+ + +YL            +  +   A K GP+  
Sbjct: 4   HKLIEVVNYMLKK---YEYRLNYTKLLKMLYLADRQSYDDTGSPITGDTYTALKAGPILS 60

Query: 73  GVYHRFKYFDSHPIEVIMD------------LSFRIFPKIANQEIGEIMESIWNKYQSHS 120
             Y+  +   +   + + +            L+ +I     +    E+++ I +K+ +++
Sbjct: 61  NTYNLIRNKGNQNDQNLWNSRFLKDAYDLVALTDKIPCNTLSDYEKEVLDGIDSKFHNYT 120

Query: 121 TEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITK 157
              L E        W+   D   P     I++E I +
Sbjct: 121 FTDLIEYTHANCPEWKAPKDSALP-----ISIESILQ 152


>gi|325473753|gb|EGC76942.1| hypothetical protein HMPREF9353_02044 [Treponema denticola F0402]
          Length = 186

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 59/157 (37%), Gaps = 20/157 (12%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +  I V N+ + K   Y   +++ K+ + +YL            +  +   A K GP+  
Sbjct: 4   HKLIEVVNYMLKK---YEYRLNYTKLLKMLYLADRQSYDDTGSPITGDTYTALKAGPILS 60

Query: 73  GVYHRFKYFDSHPIEVIMD------------LSFRIFPKIANQEIGEIMESIWNKYQSHS 120
             Y+  +   +   + + +            L+ +I     +    E+++ I +K+ +++
Sbjct: 61  NTYNLIRNKGNQNDQNLWNSRFLKDVYDLVALTDKIPCNTLSDYEKEVLDGIDSKFHNYT 120

Query: 121 TEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITK 157
              L E        W+   D   P     I++E I +
Sbjct: 121 FTDLIEYTHANCPEWKAPKDSALP-----ISIESILQ 152


>gi|239617653|ref|YP_002940975.1| transcriptional regulator, XRE family [Kosmotoga olearia TBF
           19.5.1]
 gi|239506484|gb|ACR79971.1| transcriptional regulator, XRE family [Kosmotoga olearia TBF
           19.5.1]
          Length = 331

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/115 (18%), Positives = 46/115 (40%), Gaps = 10/115 (8%)

Query: 32  PIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYF--------DS 83
            +D +K+ + ++    +  ++  KS+     +A   GP     Y     +        D+
Sbjct: 197 SLDMMKLLKLMFYVDAESFVKTGKSIFGLRYKANIYGPT-PYNYDIILGYLKKKGVISDN 255

Query: 84  HPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
              E  +D       K+ ++    I++S+   Y   S+ +L E+  +E K W+  
Sbjct: 256 QDKEHFLDYREYKPAKVISKGESLIIDSVLKTYGKLSSRKLSELTHDE-KCWKET 309


>gi|28198677|ref|NP_778991.1| hypothetical protein PD0772 [Xylella fastidiosa Temecula1]
 gi|28056768|gb|AAO28640.1| phage-related protein [Xylella fastidiosa Temecula1]
 gi|307579815|gb|ADN63784.1| hypothetical protein XFLM_09485 [Xylella fastidiosa subsp.
          fastidiosa GB514]
          Length = 83

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 29/56 (51%)

Query: 33 IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEV 88
          +  L++ + +YL H   +    + ++DE  +AW+ GP+   +Y+  K+  S  I  
Sbjct: 2  LTPLQVLKLVYLAHGWCLGVHTQPLIDELVEAWRAGPLIRSLYNVIKHDRSSGITE 57


>gi|197294472|ref|YP_001799013.1| phage-associated protein [Candidatus Phytoplasma australiense]
 gi|171853799|emb|CAM11735.1| Uncharacterized phage-associated protein [Candidatus Phytoplasma
           australiense]
          Length = 116

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 23/116 (19%), Positives = 41/116 (35%), Gaps = 3/116 (2%)

Query: 8   QTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
                   + VA + I    +        KIQ   +  +   ++     M + + Q+W  
Sbjct: 4   MQPNKIDILDVATYLIQHQNRNDYA--PFKIQNLAFWVYSKYLIDFNYPMFNNDFQSWPY 61

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
           G V + +Y+     +  P+     +       I  Q+  EIM+ I  KY S    Q
Sbjct: 62  GAVSLKLYNTL-SREKTPLNPHHKIKKNYDENIFTQQEKEIMDYIIKKYGSKHAMQ 116


>gi|255009083|ref|ZP_05281209.1| hypothetical protein Bfra3_08076 [Bacteroides fragilis 3_1_12]
          Length = 168

 Score = 70.8 bits (172), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 28/159 (17%), Positives = 65/159 (40%), Gaps = 23/159 (14%)

Query: 33  IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF-----KYFDSHPIE 87
           +D++K+ + +Y    D +++  K ++++  +A K GPV    Y        K  D +  E
Sbjct: 8   VDYIKLFKILYFAQQDHLVKYGKVIVEDSFRALKHGPVPAYTYKALQIAEGKPLDGNFDE 67

Query: 88  VIMDLSFRIFPKIANQEIGEI----------MESIWNKYQSHSTEQLQEIVQEENKTWRR 137
            + D+  R   K+    + ++          +++   KY+      L ++    +  W  
Sbjct: 68  FLSDIEVRD-KKVYTSAVPDMDYISGANKRCLDAAIAKYKDTDPYDLSDLSH--DSAWEE 124

Query: 138 LYDP-NDPNTNRTITVEEITKMADGSNISPENVVEQIKK 175
                 D      IT+ +I +    +    E++V+ I++
Sbjct: 125 AMTRIQDDPQKNFITIIDIARAGKAT----EDMVDYIRE 159


>gi|225155296|ref|ZP_03723789.1| hypothetical protein ObacDRAFT_8899 [Opitutaceae bacterium TAV2]
 gi|224803903|gb|EEG22133.1| hypothetical protein ObacDRAFT_8899 [Opitutaceae bacterium TAV2]
          Length = 200

 Score = 70.0 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/145 (15%), Positives = 48/145 (33%), Gaps = 18/145 (12%)

Query: 20  NFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF- 78
           NFF     +    I+ LK  + ++L     + +  + +  +E  A   GPV  G      
Sbjct: 15  NFF---ARQSGGEINKLKALKLVFLADRYHLRRYGRPITGDEYLAMPYGPVASGAKDLAE 71

Query: 79  ---------KYFDSHPIEVIMDLSFRIFPKI----ANQEIGEIMESIWNKYQSHSTEQLQ 125
                    + + +  +  +   S+R   K+     ++     +   W  +      +L 
Sbjct: 72  MDSMMSDAERSYGAQYLAPVDRYSYRSIAKVEARTLSESDRLTLTWAWENFGKLKEFELA 131

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTI 150
           E      + W+R  +P        I
Sbjct: 132 EYTHRYPE-WKRHEEPLKSGRETRI 155


>gi|53714150|ref|YP_100142.1| hypothetical protein BF2859 [Bacteroides fragilis YCH46]
 gi|224026702|ref|ZP_03645068.1| hypothetical protein BACCOPRO_03459 [Bacteroides coprophilus DSM
           18228]
 gi|237719895|ref|ZP_04550376.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|253567326|ref|ZP_04844775.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|256840307|ref|ZP_05545815.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|293369551|ref|ZP_06616129.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
 gi|294644266|ref|ZP_06722034.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294806708|ref|ZP_06765538.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
 gi|298483929|ref|ZP_07002100.1| conserved hypothetical protein [Bacteroides sp. D22]
 gi|52217015|dbj|BAD49608.1| conserved hypothetical protein related to phage [Bacteroides
           fragilis YCH46]
 gi|224019938|gb|EEF77936.1| hypothetical protein BACCOPRO_03459 [Bacteroides coprophilus DSM
           18228]
 gi|229450447|gb|EEO56238.1| conserved hypothetical protein [Bacteroides sp. 2_2_4]
 gi|251943895|gb|EES84423.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|256737579|gb|EEU50905.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|292635255|gb|EFF53769.1| conserved hypothetical protein [Bacteroides ovatus SD CMC 3f]
 gi|292640337|gb|EFF58587.1| conserved hypothetical protein [Bacteroides ovatus SD CC 2a]
 gi|294446085|gb|EFG14722.1| conserved hypothetical protein [Bacteroides xylanisolvens SD CC 1b]
 gi|298269989|gb|EFI11579.1| conserved hypothetical protein [Bacteroides sp. D22]
          Length = 185

 Score = 70.0 bits (170), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 27/171 (15%), Positives = 61/171 (35%), Gaps = 28/171 (16%)

Query: 14  STIAVAN------FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQ 67
           + I +A       + +    +    I   K+ + +Y    D +++  K ++++  +A K 
Sbjct: 3   TAIQIAKIRAVVLYIMQSFTQGVDYI---KLFKILYFAQQDHLVKYGKVIVEDSFRALKH 59

Query: 68  GPVFVGVYHRF-----KYFDSHPIEVIMDLSFRIFPKIANQEIGEI----------MESI 112
           GPV    Y        K  D +  E + D+  R   K+    + ++          +++ 
Sbjct: 60  GPVPAYTYKALQIAEGKPLDGNFDEFLSDIEVRD-KKVYTSAVPDMDYISGANKRCLDAA 118

Query: 113 WNKYQSHSTEQLQEIVQEENKTWRRLYDP-NDPNTNRTITVEEITKMADGS 162
             KY+      L ++    +  W        D      IT+ +I +    +
Sbjct: 119 IAKYKDTDPYDLSDLSH--DSAWEEAMTRIQDDPQKNFITIIDIARAGKAT 167


>gi|153806929|ref|ZP_01959597.1| hypothetical protein BACCAC_01205 [Bacteroides caccae ATCC 43185]
 gi|149131606|gb|EDM22812.1| hypothetical protein BACCAC_01205 [Bacteroides caccae ATCC 43185]
          Length = 175

 Score = 68.9 bits (167), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 66/174 (37%), Gaps = 22/174 (12%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
           I +  + ++K            + + +Y  +   ++   + M+ ++  A   GPV   +Y
Sbjct: 10  IEIVLYILNKTGGMDYY----HLFKILYFANQRSLVDWGQLMIADKFCALPHGPVPTILY 65

Query: 76  HRFKYFDSHPIEVIMDLSFRIFPKIANQE---------IGEIMESIWNKYQSHSTEQLQE 126
              +   S   ++  D+    +  ++ +E           + ++   +KY   S ++L+ 
Sbjct: 66  STIQGQKSVLSKMKDDVYVVDYYLLSKREPDMDYLSQYDKDTLDLCISKYGKMSFKELER 125

Query: 127 IVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFD 180
                   W++     D   N  I   +I  +  G+N   + +V+ I   + FD
Sbjct: 126 TSH--TTCWQKA---RDKKGNHVIDPGDIA-LDGGAN---DELVKYINDSIAFD 170


>gi|13095915|ref|NP_076824.1| Orf24 [Lactococcus phage bIL312]
 gi|15672508|ref|NP_266682.1| hypothetical protein L114740 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|12723410|gb|AAK04624.1|AE006287_3 unknown protein [Lactococcus lactis subsp. lactis Il1403]
 gi|12831126|gb|AAK08477.1|AF323673_24 Orf24 [Lactococcus phage bIL312]
          Length = 162

 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 47/139 (33%), Gaps = 25/139 (17%)

Query: 32  PIDHLKIQQFIYLTHCDVVLQKK---------------KSMLDEEPQAWKQGPVFVGVYH 76
            +  LK+Q+ +Y          +               K +   + +AW  GPV   VY 
Sbjct: 23  ELSPLKLQKSLYFLFAFYAGNYQISEEQGVAESDYDYPKYLFKADFEAWTYGPVIRHVYD 82

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
           + K  +    E   + +        N EI + ++ +     + S   L +   + +K W+
Sbjct: 83  KNKKDEYMAKEFNFEGN-------ENSEISKFIDDVSEMIMAKSDFALVDRSHD-DKAWK 134

Query: 137 RLYD--PNDPNTNRTITVE 153
                  + P +   I  E
Sbjct: 135 DAIAIGNSSPMSEEVIANE 153


>gi|219870976|ref|YP_002475351.1| putative phage associated protein [Haemophilus parasuis SH0165]
 gi|219691180|gb|ACL32403.1| putative phage associated protein [Haemophilus parasuis SH0165]
          Length = 170

 Score = 68.5 bits (166), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 34/181 (18%), Positives = 66/181 (36%), Gaps = 35/181 (19%)

Query: 35  HLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSH---------- 84
           H+K+ + +YL+     L++  S+  +E  +   GPV     +  +    +          
Sbjct: 3   HIKLMKLLYLSDRLSWLERDHSITGDEYYSLPYGPVLSKTLNLIRGETLNHTKTAWEEWI 62

Query: 85  --------PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEEN--KT 134
                    I  I+D     F    +    +I++S++ KY       L E+    +    
Sbjct: 63  SDKENHQVSIAKIVDEKDEYFWGELSLSDTDILDSVFEKYGHFDRFALVELTHNPDIVPE 122

Query: 135 WRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVK 194
           W            + IT+E++ +    S        EQIK    F+  +E   + ++L K
Sbjct: 123 WEDP-----KGGAKKITLEKLLQHLGKSK-------EQIK--AIFEEQAEMQQI-NRLFK 167

Query: 195 G 195
           G
Sbjct: 168 G 168


>gi|282891217|ref|ZP_06299720.1| hypothetical protein pah_c048o048 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498910|gb|EFB41226.1| hypothetical protein pah_c048o048 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 154

 Score = 68.1 bits (165), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 25/138 (18%), Positives = 59/138 (42%), Gaps = 11/138 (7%)

Query: 1   MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE 60
           MKKR  +Q   P S + +A + +      + PI   K+   +Y      ++ +     +E
Sbjct: 1   MKKRRQSQ---PVSALDIAAYILAN-HTRNTPIAAWKMHILVYYCQVYQLISEGIPFFNE 56

Query: 61  EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
           +  A ++G +     H       +  ++ +  S +      + +  +I+  +  KY + +
Sbjct: 57  KIMATQKGIMI----HELCALHYN--QLYIGDSSKGNLNHLSLKQIDIIGEVMKKYGNKT 110

Query: 121 TEQLQEIVQEENKTWRRL 138
            E+L +++Q E   W++ 
Sbjct: 111 LEELGQLIQLE-APWKKA 127


>gi|288927052|ref|ZP_06420944.1| conserved hypothetical protein [Prevotella buccae D17]
 gi|288336190|gb|EFC74579.1| conserved hypothetical protein [Prevotella buccae D17]
          Length = 187

 Score = 68.1 bits (165), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/178 (14%), Positives = 66/178 (37%), Gaps = 27/178 (15%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV---------- 70
           + ++K     I      + + IY  +   + +    M+ ++ +A++ GPV          
Sbjct: 17  YILNKTQGTDIY----HVLKIIYFANQKHLAKWGTPMIRDDFRAYEYGPVSDQLYKAMHD 72

Query: 71  -------FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
                     ++ +  Y+        +  S +   K  ++   E+++    +    +  Q
Sbjct: 73  NHKYGDELPELFKQTAYYAGDDARSNILPSRKPDMKYLSKAAIEVLDQSIAENAGLTFPQ 132

Query: 124 LQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDS 181
           L E     +  W+  ++    N +  ++   I K A     + E ++E IK+ +  D+
Sbjct: 133 LLEKSH--DSAWQEAWERKAKNGDDLMSPTSIAKAAG----AKEAMLEYIKEQMEIDA 184


>gi|327409416|ref|YP_004301558.1| gp24 [Brochothrix phage BL3]
 gi|296245492|gb|ADH03105.1| gp24 [Brochothrix phage BL3]
          Length = 157

 Score = 67.7 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 43/131 (32%), Gaps = 21/131 (16%)

Query: 22  FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK-------------KSMLDEEPQAWKQG 68
            ++        + ++++Q+ +YL                       K + +   +AW+ G
Sbjct: 11  LVNHVHSRIENMTNIRLQKTMYLLFAFYGATFGSMEKDKELDEFYPKYLFEPSFEAWRYG 70

Query: 69  PVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           PV   +Y  FK                I        + + ++ +  +  + +   L +  
Sbjct: 71  PVDNEIYRDFKSEVFSIAPFEPKTKEEI-------NVLKFLDDLIVQTNAINDFGLVDRT 123

Query: 129 QEENKTWRRLY 139
            +++  WR  Y
Sbjct: 124 HQDD-AWRERY 133


>gi|52839993|gb|AAU87900.1| unknown [Helicobacter pylori]
          Length = 59

 Score = 67.7 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 23 IDKGVKYSIPIDHLKIQQFIYL--THCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY 80
          I+  +    PI +LK+Q+ +YL     +        ++ E+ QAW  GPV   VY  F  
Sbjct: 1  INLSLDNQKPIINLKLQKMLYLYIAQAEG----DSKLIKEDFQAWDYGPVIPDVYRNFCI 56

Query: 81 FDS 83
            S
Sbjct: 57 NGS 59


>gi|148284157|ref|YP_001248247.1| hypothetical protein OTBS_0289 [Orientia tsutsugamushi str.
          Boryong]
 gi|146739596|emb|CAM79355.1| hypothetical protein OTBS_0289 [Orientia tsutsugamushi str.
          Boryong]
          Length = 79

 Score = 67.7 bits (164), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 11/50 (22%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 14 STIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEP 62
          S   VA++F+     +    I  LK+Q+ +Y      +    K +  E+ 
Sbjct: 11 SCFDVASYFLVLVDREAGDVITQLKLQRLVYFIQGVHLALFDKPLFKEDI 60


>gi|319938025|ref|ZP_08012425.1| hypothetical protein HMPREF9488_03261 [Coprobacillus sp. 29_1]
 gi|319806931|gb|EFW03570.1| hypothetical protein HMPREF9488_03261 [Coprobacillus sp. 29_1]
          Length = 186

 Score = 67.3 bits (163), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 32/86 (37%), Gaps = 3/86 (3%)

Query: 8  QTNPPYSTIAVANFFIDKGVKYSIP--IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAW 65
               Y+ + +A + +D   K  +   +  LK+ + +Y+     +    + +  +E +  
Sbjct: 1  MKEAKYTALELAYYMVDYTHKKQLECYLSPLKMSKLLYVAQGLSLAIYHQPLFKDEIKKC 60

Query: 66 KQGPVFVGVYHRF-KYFDSHPIEVIM 90
          K G     V   F K +  + I    
Sbjct: 61 KYGVRIEEVDKAFLKSYGGNTIPSTY 86


>gi|169633419|ref|YP_001707155.1| hypothetical protein ABSDF1778 [Acinetobacter baumannii SDF]
 gi|169152211|emb|CAP01115.1| conserved hypothetical protein [Acinetobacter baumannii]
          Length = 185

 Score = 67.3 bits (163), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 47/125 (37%), Gaps = 16/125 (12%)

Query: 36  LKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR-------------FKY-- 80
           +K+ + +Y    +      +S+   +  AW+ GPV V +Y               FK   
Sbjct: 27  IKLFKLLYFLDFEHYKLTGRSVTGMDYFAWQMGPVPVELYDEISSPQPDMAEILSFKEIP 86

Query: 81  -FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLY 139
            +  +   + ++      P    +   +IM  + + Y+    + + E    EN  W ++Y
Sbjct: 87  VYQGNSTMLKVETKKEFDPSYFTKRELKIMHWLADSYKKELADDMIEATHLENLPWHQIY 146

Query: 140 DPNDP 144
           +  + 
Sbjct: 147 NVENK 151


>gi|284005926|ref|YP_003391744.1| hypothetical protein Slin_7002 [Spirosoma linguale DSM 74]
 gi|283821110|gb|ADB42945.1| hypothetical protein Slin_7002 [Spirosoma linguale DSM 74]
          Length = 188

 Score = 67.3 bits (163), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 14/141 (9%), Positives = 47/141 (33%), Gaps = 10/141 (7%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV----------FVGVYHRFKYFDSHPI 86
           K+ + +Y+   + + Q    +         +GPV               +R+   D    
Sbjct: 29  KLLKLVYIIEEEYIKQAGVPLTPLSFTHLPKGPVSTFINNQINKNREPLNRYVRIDKVND 88

Query: 87  EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNT 146
           +  +           ++   +++  +  ++  ++ + L +    E   W+++ D      
Sbjct: 89  QCWIRPIVDFSDDEFSEFDLQVINEVLERFGRYNADALIDYTHREGSIWKQMQDEFGGPP 148

Query: 147 NRTITVEEITKMADGSNISPE 167
                   + ++ D  ++ P+
Sbjct: 149 PAKQNTLNLFRLLDSEDVDPD 169


>gi|167580346|ref|ZP_02373220.1| hypothetical protein BthaT_19487 [Burkholderia thailandensis TXDOH]
          Length = 191

 Score = 65.8 bits (159), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 23/163 (14%), Positives = 58/163 (35%), Gaps = 21/163 (12%)

Query: 15  TIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            +  A + + +      P++ +K+ + +YL   +   Q  + +  ++ Q ++  PV    
Sbjct: 11  AVDAAMYLLVRARA---PMNVVKLNRLLYLAERESFAQHAEPLTGDQLQVFETSPVLFAT 67

Query: 75  YHRFK----------YFDSH-------PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQ 117
           Y R             + ++       PI       +       +     I++SIW K+ 
Sbjct: 68  YQRLAGDVAGWEDRISYLANHEVEVRRPIMSETPEEYFDHSTRLSSADISILDSIWEKFG 127

Query: 118 SHSTEQLQEIVQEENKTW-RRLYDPNDPNTNRTITVEEITKMA 159
             +   L + +      W  +  +P + +  R +   + +  A
Sbjct: 128 ERNHYALTDYLHMSCHEWTDKQGNPTEVSHKRLLRELKYSDSA 170


>gi|189485019|ref|YP_001955960.1| hypothetical protein TGRD_016 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|170286978|dbj|BAG13499.1| conserved hypothetical protein [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 185

 Score = 65.8 bits (159), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 34/182 (18%), Positives = 72/182 (39%), Gaps = 23/182 (12%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
           I + N+ + K   Y   +++ K+ + +Y+   + + +   ++ ++   A KQG V  G+Y
Sbjct: 7   IQIVNYVLQK---YDFSLNYTKLLKLLYIADRECLDRWNFTISEDNYAAMKQGMVLSGLY 63

Query: 76  HRFKYFDSHPIEVIMDLSFRIFP-------------KIANQEIGEIMESIWNKYQSHSTE 122
              +       +V  D  F                    ++   E+++ +  KY   S +
Sbjct: 64  DFIRGNADKLSQVKWDSYFYRDNYDLRSRHRENCSYDELSEAEKEMLDEVDKKYHFKSWD 123

Query: 123 QLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSN------ISPENVVEQIKKP 176
            L   V  +   W+ + +    N++  I  E+I  + D         IS EN  E+ K  
Sbjct: 124 YLVNEVVHKFPEWKEV-EAEIGNSSLKIEKEKILSVLDRDEREIKEIISSENAYEKCKND 182

Query: 177 VR 178
           ++
Sbjct: 183 LK 184


>gi|189184312|ref|YP_001938097.1| hypothetical protein OTT_1405 [Orientia tsutsugamushi str. Ikeda]
 gi|189181083|dbj|BAG40863.1| hypothetical protein OTT_1405 [Orientia tsutsugamushi str. Ikeda]
          Length = 74

 Score = 65.8 bits (159), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 11/50 (22%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 14 STIAVANFFIDKGV-KYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEP 62
          S   VA++F+     +    I  LK+Q+ +Y      +    K +  E+ 
Sbjct: 11 SRFDVASYFLVLVNREAGDVITQLKLQRLVYFIQGVHLALFDKPLFKEDI 60


>gi|262273699|ref|ZP_06051512.1| hypothetical protein VHA_000674 [Grimontia hollisae CIP 101886]
 gi|262222114|gb|EEY73426.1| hypothetical protein VHA_000674 [Grimontia hollisae CIP 101886]
          Length = 97

 Score = 65.4 bits (158), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
           +YHR+K + +  I++  ++S          E  EI+   +  +      QL+E+  +E  
Sbjct: 1   MYHRYKKYINGNIDLNKEISACDD---LTTEEKEIVAGAYKNFGKFDGWQLRELTHKEGS 57

Query: 134 TWRRLY 139
            W +++
Sbjct: 58  PWHKIW 63


>gi|308235803|ref|ZP_07666540.1| toxin-antitoxin system, antitoxin component, Xre domain protein
           [Gardnerella vaginalis ATCC 14018]
 gi|311114464|ref|YP_003985685.1| hypothetical protein HMPREF0421_20580 [Gardnerella vaginalis ATCC
           14019]
 gi|310945958|gb|ADP38662.1| hypothetical protein HMPREF0421_20580 [Gardnerella vaginalis ATCC
           14019]
          Length = 248

 Score = 65.0 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 36/214 (16%), Positives = 71/214 (33%), Gaps = 15/214 (7%)

Query: 18  VANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR 77
           VA   + +  K +I     ++Q   Y      +      +     QAW+ GPV + ++  
Sbjct: 7   VAYAILKRYGKMNIN----RLQLLSYYCQAYNLASTNSPLFYNNFQAWRNGPVCLDLFKM 62

Query: 78  FKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
            +  D       + L                + ++ +     S E+L+   + E   W  
Sbjct: 63  HRINDVFIECKDIVLGPYELKNHLTYSNLLTIYNVCDALIDFSIEELENRARSE-MPWID 121

Query: 138 LYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFK 197
                 PN    +   EI+K           V+    +  R     EF   + +L K  +
Sbjct: 122 ARRGILPNKANEV---EISKKIIHDYYVKHPVINTNSRTTR---SKEFRKDDEELQKDIQ 175

Query: 198 SMPPQLTKEFQEAQVQIKKDSAIARSIQESNIMR 231
            +  +  ++F     Q  +D  + R  +   I+R
Sbjct: 176 DIISEQIEKFN----QYNQDEKVRRIRRAEKILR 205


>gi|153873025|ref|ZP_02001747.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152070509|gb|EDN68253.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 170

 Score = 65.0 bits (157), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 51/157 (32%), Gaps = 22/157 (14%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
            ++ +      +        P  H +I + +Y    + +    + +  +   A K GPV 
Sbjct: 6   TFNAVKSVEAILYIAQHVKQPTFH-RISKIMYFADKEHLETYGRFVCGDHYVAMKHGPVP 64

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPK-------------IANQEIGEIMESIWNKYQS 118
              Y   K    +      D    +  +               ++   E +++  +KY  
Sbjct: 65  SCTYDILKAVRGNSFFESPDKKAFVVVEQFLVKPLRATCVDYFSESDLECLDNAISKYGD 124

Query: 119 HSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEI 155
            S  +L E+  +E   W+        + N  I +E I
Sbjct: 125 LSFNELTELSHDE--AWQTA------DENDYIDIEHI 153


>gi|332882521|ref|ZP_08450139.1| conserved domain protein [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332679581|gb|EGJ52560.1| conserved domain protein [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 188

 Score = 64.6 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/148 (16%), Positives = 52/148 (35%), Gaps = 15/148 (10%)

Query: 1   MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHL---KIQQFIYLTHCDVVLQKKKSM 57
           MK  T+TQ    Y+   + N   +  +  S  I +L   K  + +Y+     + Q     
Sbjct: 1   MKNNTYTQ----YNEAQL-NKIGNTAIYLSERIPNLSKTKFLKLLYILDELSIKQSGIPF 55

Query: 58  LDEEPQAWKQGPVFVGVY-------HRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIME 110
           L+ + + WK GPV   ++            F     +  +           +    E+++
Sbjct: 56  LNLDYKVWKFGPVAEPIFIDLSSEMSLLAPFIKSNQKGHLSAKKAFKDDEFSDNDIELLD 115

Query: 111 SIWNKYQSHSTEQLQEIVQEENKTWRRL 138
            +   + + + ++L      E   W + 
Sbjct: 116 EVIKSFGNKTAKELVAYTHNEESLWNKT 143


>gi|254472489|ref|ZP_05085889.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211958772|gb|EEA93972.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 108

 Score = 64.6 bits (156), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 42/98 (42%), Gaps = 8/98 (8%)

Query: 80  YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLY 139
            F     E++  ++ +I     +    EI++ +W KY++++ +QL ++  + N  W   Y
Sbjct: 5   GFKGPNSEIVDPITGQIITSKISGNEEEILDHVWKKYRNYTPQQLSDLTHQANSPW--AY 62

Query: 140 DPNDPNTNRTITVEEITK------MADGSNISPENVVE 171
              +   N  I  E   +      +A  SN   E  ++
Sbjct: 63  AYFEKGRNAEIDTERTRQYYIKLALAGRSNAEQEQALQ 100


>gi|332665668|ref|YP_004448456.1| hypothetical protein Halhy_3731 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332334482|gb|AEE51583.1| hypothetical protein Halhy_3731 [Haliscomenobacter hydrossis DSM
           1100]
          Length = 190

 Score = 64.2 bits (155), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/179 (14%), Positives = 58/179 (32%), Gaps = 19/179 (10%)

Query: 22  FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY- 80
            +    K     D  KI + +Y      +      +  +   A   GPV    Y   K  
Sbjct: 16  ILFVLNKLGGESDLHKIFKILYFADQKHLATYGFPITGDYYIAMPHGPVPSKSYDVLKAI 75

Query: 81  FDSHPIEVIMDLSF--------------RIFPKIANQEIGEIMESIWNKYQSHSTEQLQE 126
                     + S                   ++A  ++  ++E+I    +  + +QL +
Sbjct: 76  RGDSFWTASKEYSDLFEVEDHIVIAKQMPDMDELAESDVECLLEAIAEN-KDLTFQQLVD 134

Query: 127 IVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEF 185
              +    W +  + +  N +  + VE+I K  + +      ++  I+  +     +EF
Sbjct: 135 KSHK--SAWEKARN-DASNFDNEMKVEDIAKEVNVNEEMLNYIMLNIENQILLKEHAEF 190


>gi|261496397|ref|ZP_05992789.1| hypothetical protein COI_2127 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261307944|gb|EEY09255.1| hypothetical protein COI_2127 [Mannheimia haemolytica serotype A2
           str. OVINE]
          Length = 195

 Score = 63.8 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 63/174 (36%), Gaps = 30/174 (17%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV-------- 72
           + + K       ++H+K+ + +YL       +   S+ ++E  +   GPV          
Sbjct: 13  YLLHKA---GGTMEHIKVMKLLYLADRLSWQRYGYSISNDEYYSLPYGPVLSNTLNLMRG 69

Query: 73  ---GVYHRFKYFD-------SHPIEVIMDLSFRI--FPKIANQEIGEIMESIWNKYQSHS 120
               +Y +   +         H I +   ++     F    ++   EI+E ++  + ++ 
Sbjct: 70  EEASLYQKTSIWGEWIADKEDHKISLKKSVNTEDEYFFDCLSESDTEILEEVFATFGNYK 129

Query: 121 TEQLQEIVQEEN--KTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQ 172
              L E          W      + P +  T+    +TK+    +   E+++EQ
Sbjct: 130 PFALVEYTHNPKYIPEWEDPQGRSKPISLNTL----LTKLGKTPS-EIESILEQ 178


>gi|296393155|ref|YP_003658039.1| hypothetical protein Srot_0728 [Segniliparus rotundus DSM 44985]
 gi|296180302|gb|ADG97208.1| conserved hypothetical protein [Segniliparus rotundus DSM 44985]
          Length = 59

 Score = 63.8 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 3/53 (5%)

Query: 14 STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
          S + VA   ID+       ++  K+   +Y      ++     +  E+ QAW 
Sbjct: 3  SAVDVAQHIIDR---LGGEVEPEKLHCLLYYCQAWHLVAHGTPLFPEQMQAWP 52


>gi|261493154|ref|ZP_05989688.1| hypothetical protein COK_1566 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261311185|gb|EEY12354.1| hypothetical protein COK_1566 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 195

 Score = 63.8 bits (154), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 64/174 (36%), Gaps = 30/174 (17%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV-------- 72
           + + K       ++H+K+ + +YL       +   S+ ++E  +   GPV          
Sbjct: 13  YLLHKA---GGTMEHIKVMKLLYLADRLSWQRYGYSISNDEYYSLPYGPVLSNTLNLMRG 69

Query: 73  ---GVYHRFKYFD-------SHPIEVIMDLSFRI--FPKIANQEIGEIMESIWNKYQSHS 120
               +Y +   +         H I +   ++     F    ++   EI+E ++  + ++ 
Sbjct: 70  EEASLYQKTSIWGEWIADKEDHKISLKKSVNTEDEYFFDCLSESDTEILEEVFATFGNYK 129

Query: 121 TEQLQEIVQ--EENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQ 172
              L E     +    W      + P +  T+    +TK+    +   E+++EQ
Sbjct: 130 PFALVEYTHIPKYIPEWEDPQGRSKPISLNTL----LTKLGKTPS-EIESILEQ 178


>gi|254363026|ref|ZP_04979087.1| hypothetical protein MHA_2612 [Mannheimia haemolytica PHL213]
 gi|153094688|gb|EDN75483.1| hypothetical protein MHA_2612 [Mannheimia haemolytica PHL213]
          Length = 195

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/174 (15%), Positives = 63/174 (36%), Gaps = 30/174 (17%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV-------- 72
           + + K       ++H+K+ + +YL       +   S+ ++E  +   GPV          
Sbjct: 13  YLLHKA---GGTMEHIKVMKLLYLADRLSWQRYGYSISNDEYYSLPYGPVLSNTLNLMRG 69

Query: 73  ---GVYHRFKYFD-------SHPIEVIMDLSFRI--FPKIANQEIGEIMESIWNKYQSHS 120
               +Y +   +         H I +   ++     F    ++   EI+E ++  + ++ 
Sbjct: 70  EEASLYQKTSIWGEWIADKEDHKISLKKSVNTEDEYFFDCLSESDTEILEEVFATFGNYK 129

Query: 121 TEQLQEIVQEEN--KTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQ 172
              L E          W      + P +  T+    +TK+    +   E+++EQ
Sbjct: 130 PFALVEYTHNPKYIPEWEDPQGRSKPISLSTL----LTKLGKTPS-EIESILEQ 178


>gi|90426161|ref|YP_534531.1| hypothetical protein RPC_4690 [Rhodopseudomonas palustris BisB18]
 gi|90108175|gb|ABD90212.1| hypothetical protein RPC_4690 [Rhodopseudomonas palustris BisB18]
          Length = 183

 Score = 63.5 bits (153), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/144 (14%), Positives = 47/144 (32%), Gaps = 18/144 (12%)

Query: 20  NFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFK 79
           N+F     K       +K+ + +Y    +   Q  +++      AW  GPV V +++   
Sbjct: 15  NYFARNTKKLGK----VKLFKLLYFLDFEHFKQTGRNVTGLTYFAWPMGPVPVSLHNEIV 70

Query: 80  YFDSHPIEVIM--------------DLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
                  E +               +       +   +    I+E +  +Y+    + + 
Sbjct: 71  QPKDDMTEALELGKRDISDGWMLVVNPKIPFSDRHFTKREIAILEHLAAEYRDADADSMI 130

Query: 126 EIVQEENKTWRRLYDPNDPNTNRT 149
           E    EN  W ++Y+ +       
Sbjct: 131 EATHLENLPWDQIYNKDGKKQQEI 154


>gi|182681368|ref|YP_001829528.1| hypothetical protein XfasM23_0815 [Xylella fastidiosa M23]
 gi|182631478|gb|ACB92254.1| hypothetical protein XfasM23_0815 [Xylella fastidiosa M23]
          Length = 77

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/49 (26%), Positives = 25/49 (51%)

Query: 40 QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEV 88
          + +YL H   +    + ++DE  +AW+ GP+   +Y+  K+  S  I  
Sbjct: 3  KLVYLAHGWCLGVHTQPLIDELVEAWRAGPLIRSLYNVIKHDRSSGITE 51


>gi|39938576|ref|NP_950342.1| uncharacterized phage-associated protein [Onion yellows
          phytoplasma OY-M]
 gi|39721685|dbj|BAD04175.1| uncharacterized phage-associated protein [Onion yellows
          phytoplasma OY-M]
          Length = 66

 Score = 63.1 bits (152), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 5/58 (8%)

Query: 17 AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV 74
            AN+ I K     I ++H+K+Q+ +Y ++   + + K+S+     +AW++GPVF  +
Sbjct: 14 DYANYIIKK-----IDVNHMKLQKLLYYSYAAYLFKYKESLSVNLVEAWQKGPVFKRL 66


>gi|71737493|ref|YP_277059.1| hypothetical protein PSPPH_4974 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71558046|gb|AAZ37257.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 183

 Score = 63.1 bits (152), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 20/141 (14%), Positives = 48/141 (34%), Gaps = 18/141 (12%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            +A FF+ +      P+ H+K+ + +YL     + +    M D+     K GP+      
Sbjct: 10  QMAAFFLAR---REAPMAHIKLMKLLYLADRLSMERYDAPMSDDSQCNMKNGPILSATLD 66

Query: 77  -------------RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
                              ++ + +  D ++    +  ++    I+E ++  +      +
Sbjct: 67  LMNGSRSSDAWSALISPIRNNEVTLQRDFAWDELDE-LSRADLAILEEVFANFGQLKRWE 125

Query: 124 LQEIVQEENKTWRRLYDPNDP 144
           L + V      W      + P
Sbjct: 126 LVDYVHT-LPEWENPGSSSKP 145


>gi|126659195|ref|ZP_01730333.1| hypothetical protein CY0110_04448 [Cyanothece sp. CCY0110]
 gi|126619500|gb|EAZ90231.1| hypothetical protein CY0110_04448 [Cyanothece sp. CCY0110]
          Length = 186

 Score = 62.3 bits (150), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 33/183 (18%), Positives = 68/183 (37%), Gaps = 24/183 (13%)

Query: 12  PYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           P   +  A   +     +  P+ +L + + +Y+     + Q ++ +  +   + K GPV 
Sbjct: 9   PKKAVEAAAILLKL---HGKPMKYLGLLKMLYIADRMALEQIEEPITGDHYFSMKYGPVL 65

Query: 72  VGVYHRFKYFD--------SHPIEVIMDLSF-----RIFPKIANQEIGEIMESIWNKYQS 118
             VY   K           S  I    +  +         +   +E  EI++ ++ K+  
Sbjct: 66  SKVYDLIKGQLVDHTLPLWSEFISPRYNKHYVYLKKDPGNEELCEEEEEIIKKVYKKFGH 125

Query: 119 HSTEQLQEIVQEENKTWRRLYDPNDPNTNRT-ITVEEITKMADGSNISPENVVEQIKKPV 177
                + E   +  K W+      DP  +R  IT+EEI K    ++   E + ++  +  
Sbjct: 126 LDPFTVAEWTHD-LKEWQ------DPGNSRIPITIEEILKYLGKTDEEIEEIRQEAAREY 178

Query: 178 RFD 180
             D
Sbjct: 179 YLD 181


>gi|281420931|ref|ZP_06251930.1| conserved hypothetical protein [Prevotella copri DSM 18205]
 gi|281405223|gb|EFB35903.1| conserved hypothetical protein [Prevotella copri DSM 18205]
          Length = 225

 Score = 62.3 bits (150), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 24/165 (14%), Positives = 56/165 (33%), Gaps = 29/165 (17%)

Query: 23  IDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH------ 76
           I K       +D++ + + +Y    D++ +    ++ +   A K GPV    Y       
Sbjct: 45  ILKAFPEG--VDYIHLFKVMYFAQQDLLKEYGLPIMYDTFVARKHGPVPALTYKVLRGIE 102

Query: 77  --------RFKYFDSH-PIEVIMDLS---------FRIFPKIANQEIGEIMESIWNKYQS 118
                     K F     I +  D                +++  ++  +++    K + 
Sbjct: 103 GKADLSTPELKDFADSLNIAISQDGHQLVLASKNAECDMDELSVADVK-MLDKWIEKCKD 161

Query: 119 HSTEQLQEIVQEENKTWRRL-YDPNDPNTNRTITVEEITKMADGS 162
             +  L +    E++ W+R     +    +  IT+ ++   A  S
Sbjct: 162 VESFDLSDKSH-EDRAWKRAKRQADKTGEDSKITMYDMAAAAGAS 205


>gi|163785376|ref|ZP_02180004.1| hypothetical protein HG1285_11927 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879354|gb|EDP73230.1| hypothetical protein HG1285_11927 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 190

 Score = 62.3 bits (150), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 16/144 (11%), Positives = 46/144 (31%), Gaps = 26/144 (18%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           Y+   +AN  I    +    +   K+ + I+    + + +  + +  E       GPV +
Sbjct: 4   YNIEKIANAIILALDEGVNFLGKTKLMKLIFFADKEHIKRYGRPIFFEFYVKDNMGPVPL 63

Query: 73  GVYHRF--------------------------KYFDSHPIEVIMDLSFRIFPKIANQEIG 106
             Y                             K  +     +           + ++   
Sbjct: 64  KTYSILSSVNDLENEDFKDEVESLLQWLEVEEKDVNRKFPMLTFKKKKEFDQSVFSKSEI 123

Query: 107 EIMESIWNKYQSHSTEQLQEIVQE 130
           E+++ ++ K++ ++ +Q+ E   +
Sbjct: 124 EVLKDVFKKFKDYTAQQISEYSHK 147


>gi|134297909|ref|YP_001111405.1| hypothetical protein Dred_0030 [Desulfotomaculum reducens MI-1]
 gi|134050609|gb|ABO48580.1| hypothetical protein Dred_0030 [Desulfotomaculum reducens MI-1]
          Length = 334

 Score = 62.3 bits (150), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 39/121 (32%), Gaps = 11/121 (9%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY 80
           +F       S+ I   K+ + ++        +   S+          GPV    Y     
Sbjct: 198 YFFALKEITSLYIT--KLNKLMFYADYYYYKKFGTSLSGTRYIRHNYGPV-PNKYQTLYD 254

Query: 81  FDSHPIEVIMD------LSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
                IE+  D                N +   I++ +  K++  +++++     +E K 
Sbjct: 255 -SIDTIEIFEDEYGNYIKPANDLALTFNDKEISILDLVNQKFKHMNSKEISNFSHKE-KC 312

Query: 135 W 135
           W
Sbjct: 313 W 313


>gi|150006143|ref|YP_001300887.1| phage-like protein [Bacteroides vulgatus ATCC 8482]
 gi|294775321|ref|ZP_06740844.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
 gi|149934567|gb|ABR41265.1| conserved hypothetical phage-like protein [Bacteroides vulgatus
           ATCC 8482]
 gi|294450898|gb|EFG19375.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
          Length = 185

 Score = 61.9 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/136 (14%), Positives = 46/136 (33%), Gaps = 17/136 (12%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMD----- 91
           K+ + +Y    D +++  K ++++   A K GP    +Y   +     P E   +     
Sbjct: 29  KLFRILYFAQQDYLVKYGKVLIEDSFMALKYGPAPTYIYRVLQAVKEKPTEESFNDFLAG 88

Query: 92  ---------LSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDP- 141
                     S +      +      +++   KY+      L ++    +  W+      
Sbjct: 89  IEVHEQKIYASAKPDMNYISGSDKRCLDAAITKYKDTDPYDLSDLSH--DLAWKEARARI 146

Query: 142 NDPNTNRTITVEEITK 157
            D      IT+ +I +
Sbjct: 147 KDNPQKNLITIIDIAR 162


>gi|113460682|ref|YP_718748.1| hypothetical protein HS_0537 [Haemophilus somnus 129PT]
 gi|112822725|gb|ABI24814.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 195

 Score = 61.9 bits (149), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/157 (14%), Positives = 54/157 (34%), Gaps = 28/157 (17%)

Query: 13  YSTIAVAN---FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP 69
           ++ + VA    + + K       ++H+K  + +YL       +   S+ ++E  +   GP
Sbjct: 2   FNELKVAQATAYLLHKA---GGTMEHIKAMKLLYLADRLSWQKYNYSISNDEYYSLPYGP 58

Query: 70  VFVGVYHRFKY-----FDSHPI---------------EVIMDLSFRIFPKIANQEIGEIM 109
           V     +  +      + ++ I               +  +D +   F    ++   EI+
Sbjct: 59  VLSNTLNLMRGEEASLYQNNSIWGEWIADKEDHKISLKRTVDTADEYFFDCLSESDTEIL 118

Query: 110 ESIWNKYQSHSTEQLQEIVQEEN--KTWRRLYDPNDP 144
           + I+  + S+    L E          W      + P
Sbjct: 119 DEIFATFGSYKPFALVEYTHNPKYIPEWENPQGRSKP 155


>gi|206601846|gb|EDZ38329.1| Hypothetical protein CGL2_11278038 [Leptospirillum sp. Group II
           '5-way CG']
          Length = 187

 Score = 61.5 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/155 (18%), Positives = 58/155 (37%), Gaps = 14/155 (9%)

Query: 36  LKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDS----HPIEVIMD 91
           +++ + +YL+    +L+    +  +   A K GPV   VY R K  +       I+    
Sbjct: 40  MRLLKLLYLSGRAALLEYGCLITGDRYIAMKLGPVLSNVYDRIKEGEWGGRIRTIKYDAR 99

Query: 92  LSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTIT 151
           L         ++    +++ +    Q++    L ++   E   W       +   N+ I 
Sbjct: 100 LIGPELTGPLSEAGVNLLDEVSRFCQTYDHWNLSDLTH-ELPEW------GETPRNQDIP 152

Query: 152 VEEITKMADGSNISPENVVEQIKKPVRFD---SDS 183
           VE I      S+   +   E+ +    F+   SDS
Sbjct: 153 VERILDTLRKSSKEIKETAEEARDETFFEEVFSDS 187


>gi|153868855|ref|ZP_01998590.1| conserved hypothetical protein [Beggiatoa sp. PS]
 gi|152074576|gb|EDN71417.1| conserved hypothetical protein [Beggiatoa sp. PS]
          Length = 203

 Score = 61.5 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 51/133 (38%), Gaps = 18/133 (13%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF-- 78
           +F     K       +K+ + +Y    +   Q  +S+      AW  GPV V +Y  F  
Sbjct: 24  YFAQNTQKCGK----VKLFKLMYFLDFEHYKQIGRSVTGLNYYAWPLGPVPVDLYAEFDV 79

Query: 79  ------KYFDSHPIEVIMDLSFRIFP------KIANQEIGEIMESIWNKYQSHSTEQLQE 126
                       PI V   L   I P      +  ++    +M  + N+Y   S E++ E
Sbjct: 80  PAADMLSCIQFEPIPVKNGLMLFIQPIAEFDNRYFSKRELRLMAQLVNQYNDTSAEEIIE 139

Query: 127 IVQEENKTWRRLY 139
               E+K W+R+Y
Sbjct: 140 ASHLEHKPWQRVY 152


>gi|281421912|ref|ZP_06252911.1| conserved hypothetical protein [Prevotella copri DSM 18205]
 gi|281404028|gb|EFB34708.1| conserved hypothetical protein [Prevotella copri DSM 18205]
          Length = 197

 Score = 61.1 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/165 (14%), Positives = 54/165 (32%), Gaps = 29/165 (17%)

Query: 23  IDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH------ 76
           I K       +D++ + + +Y    D + +    ++ +   A K GPV    Y       
Sbjct: 17  ILKAFPEG--VDYIHLFKVMYFAQQDQLKEYGLPIMYDTFVARKHGPVPALTYKVLRGIE 74

Query: 77  --------RFKYFDSH-PIEVIMDLS---------FRIFPKIANQEIGEIMESIWNKYQS 118
                     K F     I +  D                +++  ++  ++     K + 
Sbjct: 75  GKADLSSPELKDFADSLNIAISQDGHQLVLASKNAECDMDELSVADVK-MLNKWIEKCKD 133

Query: 119 HSTEQLQEIVQEENKTWRRL-YDPNDPNTNRTITVEEITKMADGS 162
             +  L +    E++ W+R     +    +  IT+ ++   A  S
Sbjct: 134 VESFDLSDKSH-EDRAWKRAKRQADKTGEDSKITMYDMAAAAGAS 177


>gi|303235895|ref|ZP_07322498.1| conserved hypothetical protein [Prevotella disiens FB035-09AN]
 gi|302483768|gb|EFL46760.1| conserved hypothetical protein [Prevotella disiens FB035-09AN]
          Length = 179

 Score = 61.1 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/153 (15%), Positives = 51/153 (33%), Gaps = 29/153 (18%)

Query: 40  QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFK---YFDSHPIEVIMDLSF-- 94
           + +Y      + +    ++ +E  A + GPV   +Y   +   ++    I +  +     
Sbjct: 30  KILYFAQQKHLCKWGSRIVADEFVAMEYGPVPTQLYSAVRHNEHYAKELIPLFAEAIGFA 89

Query: 95  ------------RIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPN 142
                              +    E +     + +  S  +L E     +  WR      
Sbjct: 90  GKDASNTLLAKRDTNMDYLSPADIESLNESIAENKGLSFGELVEKSH--DSAWRAA---- 143

Query: 143 DPNTNRTITVEEITKMADGSNISPENVVEQIKK 175
             N    ++V +I + A G+N   E +VE I +
Sbjct: 144 -SNCG-VMSVGDIAR-AGGAN---EGLVEYINE 170


>gi|319776179|ref|YP_004138667.1| hypothetical protein HICON_15300 [Haemophilus influenzae F3047]
 gi|329123359|ref|ZP_08251924.1| hypothetical protein HMPREF9095_1142 [Haemophilus aegyptius ATCC
           11116]
 gi|317450770|emb|CBY86991.1| Putative uncharacterised protein [Haemophilus influenzae F3047]
 gi|327471359|gb|EGF16811.1| hypothetical protein HMPREF9095_1142 [Haemophilus aegyptius ATCC
           11116]
          Length = 194

 Score = 61.1 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/144 (15%), Positives = 47/144 (32%), Gaps = 27/144 (18%)

Query: 19  ANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV------ 72
           A + + K       + HLK+ + +YL       ++  ++  +E  +   GPV        
Sbjct: 11  AAYLLYKS---GGSMKHLKLMKLLYLADRLSWQERDYAITGDEYYSLPYGPVLSKTLDLM 67

Query: 73  --GVYHRFKYFDSH--------------PIEVIMDLSFRIFPKIANQEIGEIMESIWNKY 116
               +++    +++               +   +D +   F    +    EI+  I NK+
Sbjct: 68  HGETFNQLNSANANVWDKWIADDANYCVKLAKKVDETDEYFWDCLSVSDEEILNQILNKF 127

Query: 117 QSHSTEQLQEIVQEEN--KTWRRL 138
                  L E    +N    W   
Sbjct: 128 GHFEPFALVEYTHNKNYIPEWEDP 151


>gi|294777884|ref|ZP_06743328.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
 gi|294448338|gb|EFG16894.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
          Length = 159

 Score = 61.1 bits (147), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 33/101 (32%), Gaps = 18/101 (17%)

Query: 52  QKKKSMLDEEPQAWKQGPVFVGVY-------HRFKYF-------DSHPIEVIMDLSFRIF 97
           +     +    + W+ GPV   V+          K F           IE + D     F
Sbjct: 8   KFHVPFIGIPFEVWQAGPVAKDVFIDLSDGPFLLKSFVKTDFRDGGTFIEAVADFDDSEF 67

Query: 98  PKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
            +       E+M+ +  KY + +  +L     +E   W R 
Sbjct: 68  SEC----EIEMMDEVLAKYGNMTASELVSETHKEGTLWYRT 104


>gi|167892263|ref|ZP_02479665.1| hypothetical protein Bpse7_00780 [Burkholderia pseudomallei 7894]
 gi|167917020|ref|ZP_02504111.1| hypothetical protein BpseBC_00630 [Burkholderia pseudomallei
           BCC215]
          Length = 189

 Score = 60.8 bits (146), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/144 (16%), Positives = 48/144 (33%), Gaps = 22/144 (15%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFK-------------YFDS 83
           K+ + +Y    +      +S+   +  AWK GPV   +Y                  F S
Sbjct: 28  KLFKLLYFLDFEHFRDTGRSVTGMDYVAWKMGPVPEVLYSELSALDTAAGEWFGKVEFGS 87

Query: 84  HPIEV----IMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLY 139
              +      +       P   ++    I+E +  ++++    ++ E    EN  W ++Y
Sbjct: 88  RETKNGPMLHIRPLGEFDPCFFSRRELRILERLATEFKNSDAAEMIEATHLENLPWNQVY 147

Query: 140 DPNDPNTNRT-----ITVEEITKM 158
                   R      I  +E  +M
Sbjct: 148 VQEGKKRGRIPYEYAIRKQEAAEM 171


>gi|224024688|ref|ZP_03643054.1| hypothetical protein BACCOPRO_01416 [Bacteroides coprophilus DSM
           18228]
 gi|224017910|gb|EEF75922.1| hypothetical protein BACCOPRO_01416 [Bacteroides coprophilus DSM
           18228]
          Length = 255

 Score = 60.4 bits (145), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/101 (19%), Positives = 34/101 (33%), Gaps = 18/101 (17%)

Query: 52  QKKKSMLDEEPQAWKQGPVFVGVY-------HRFKYF-------DSHPIEVIMDLSFRIF 97
           +     +    + W+ GPV   V+       +  K F           IE + D     F
Sbjct: 104 KYHVPFIGIPFEVWQAGPVAKDVFVDLSDGPYLLKSFVKTDFKDGGTFIEAVADFDDSEF 163

Query: 98  PKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
            +       E+M+ I  KY + +   L     +E   W R+
Sbjct: 164 SEC----EIEMMDEILAKYGNMTASDLVAETHKEGTLWYRV 200


>gi|150006144|ref|YP_001300888.1| hypothetical protein BVU_3655 [Bacteroides vulgatus ATCC 8482]
 gi|294775322|ref|ZP_06740845.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
 gi|149934568|gb|ABR41266.1| hypothetical protein BVU_3655 [Bacteroides vulgatus ATCC 8482]
 gi|294450899|gb|EFG19376.1| conserved hypothetical protein [Bacteroides vulgatus PC510]
          Length = 196

 Score = 60.0 bits (144), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 42/116 (36%), Gaps = 18/116 (15%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY-------HRFKYF-------D 82
           K+ + +YL    + L+     +    + W+ GPV   V+       +  K F        
Sbjct: 30  KLLKLLYLMEEHMALKYHVPFIGMPYEVWQAGPVAKDVFIDLSDVPYILKGFVRTEFRDG 89

Query: 83  SHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
              IE I D     F K       EIM+ +  +Y + +   L     +++  W R 
Sbjct: 90  GIFIEAIADFDDSEFSKC----EIEIMDYVLVRYGNMTASDLFLETCKKDSLWYRA 141


>gi|296393069|ref|YP_003657953.1| hypothetical protein Srot_0640 [Segniliparus rotundus DSM 44985]
 gi|296180216|gb|ADG97122.1| hypothetical protein Srot_0640 [Segniliparus rotundus DSM 44985]
          Length = 59

 Score = 60.0 bits (144), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 9/53 (16%), Positives = 20/53 (37%), Gaps = 3/53 (5%)

Query: 14 STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWK 66
          S + VA   I++       ++  K+   +Y      ++     +  E+ Q W 
Sbjct: 3  SVVDVAQHIIER---LGGEVEPEKLHCLLYYCQAWHLVAHGTPLFPEQMQVWP 52


>gi|307565444|ref|ZP_07627933.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
 gi|307345894|gb|EFN91242.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
          Length = 179

 Score = 59.6 bits (143), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/143 (12%), Positives = 47/143 (32%), Gaps = 30/143 (20%)

Query: 40  QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY---FDSHPIE---VIMDLS 93
           + +Y      + +    ++ ++  A + GPV   +Y        +    I      ++ +
Sbjct: 30  KILYFAQQKHLCKWGSRIVADDFVAMEYGPVPTKLYSAVCKNEHYAKELIPLFTEAIEFA 89

Query: 94  FRIFP-----------KIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPN 142
            +                 +    E ++    + +  S  +L +     +  W+      
Sbjct: 90  GKDASNTLLPKREANMDYLSPADIESLKESIAENKGLSFGELVDKSH--DSAWQ------ 141

Query: 143 DPNTNR--TITVEEITKMADGSN 163
              TN    +++ +I K A G+N
Sbjct: 142 --ATNNCCVMSISDIAK-AGGAN 161


>gi|218688964|ref|YP_002397176.1| hypothetical protein ECED1_1155 [Escherichia coli ED1a]
 gi|218426528|emb|CAR07356.1| conserved hypothetical protein [Escherichia coli ED1a]
          Length = 174

 Score = 59.2 bits (142), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/135 (14%), Positives = 45/135 (33%), Gaps = 20/135 (14%)

Query: 36  LKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHP-------IEV 88
           ++  + +YL+    +      +  +   +  +GPV    Y   K    +        I  
Sbjct: 13  MRFIKLMYLSDRKAMELYGFPISGDHYFSMNKGPVLSQTYSLVKDGSENEYSPWESWISD 72

Query: 89  IMDLSFRIFPK--------IANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD 140
           + D    ++            +    E M+ I+ +Y      +L +        WR  + 
Sbjct: 73  VADHKVEMWRTFSSVDELGELSPAEIESMDIIFGQYGGWDAFRLCDETHRICGEWRDPHG 132

Query: 141 PNDPNTNRTITVEEI 155
            + P     I++++I
Sbjct: 133 SSIP-----ISLKDI 142


>gi|225868539|ref|YP_002744487.1| hypothetical protein SZO_09600 [Streptococcus equi subsp.
           zooepidemicus]
 gi|225701815|emb|CAW99247.1| conserved hypothetical protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 170

 Score = 59.2 bits (142), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 30/166 (18%), Positives = 51/166 (30%), Gaps = 32/166 (19%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKK----------------SMLD 59
             + N+      +       +KIQ+ +YL          K                 + +
Sbjct: 10  TDLVNYL----YEVLDNPSPIKIQKTLYLLFAYYGATYGKINLSNDSELDISNYTEFLFE 65

Query: 60  EEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSH 119
              +AW  GPV   VY R K  +    ++  +           Q I    ++I  +    
Sbjct: 66  PNFEAWMYGPVDFEVYERNKNGEYSAQKLSFESLNNELNLSEKQNIVNFSDNIIRQTNVA 125

Query: 120 STEQLQEIVQEENKTWRRLYD--------PNDPNTNRTITVEEITK 157
               L +    E+++W   Y+        P DP     I  E  TK
Sbjct: 126 DDFSLVDRTH-EDESWSIPYEKGNGAAHIPMDPYQ---IVEEYSTK 167


>gi|305664061|ref|YP_003860349.1| hypothetical protein Igag_1672 [Ignisphaera aggregans DSM 17230]
 gi|304378630|gb|ADM28469.1| conserved hypothetical protein [Ignisphaera aggregans DSM 17230]
          Length = 140

 Score = 58.8 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/118 (14%), Positives = 40/118 (33%), Gaps = 7/118 (5%)

Query: 14  STIAVANFFIDK-GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV-- 70
               +  + I +        I  +++ + ++L       +  K + + +   W  GP   
Sbjct: 3   DPRDIVLYTISRYAAIAGRGISRIRLMKLLFLADYIYKKRFNKKLTNAKWIMWLFGPFSK 62

Query: 71  -FVGVYHRFKYFDSHPIEVIMDLSFRIFPKI---ANQEIGEIMESIWNKYQSHSTEQL 124
             + V    +      IE +  +            + E+  I++ +  +Y   S EQL
Sbjct: 63  DILNVLDELEVKGKVIIEDVDGIGIFYSTYERVRLDDEVKNIIDEVIREYGVKSLEQL 120


>gi|261417082|ref|YP_003250765.1| hypothetical protein Fisuc_2700 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373538|gb|ACX76283.1| conserved hypothetical protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302326235|gb|ADL25436.1| conserved hypothetical protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 180

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 46/129 (35%), Gaps = 15/129 (11%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR----------FKYFDSHPI 86
           KI + ++      + +  +++  +   A   GPV   +Y            F+ FD    
Sbjct: 33  KIFKILWFADLYHLKKYGRTVTGDTYIAMNNGPVPSVLYDEMKFTPSEGDAFRRFDKGSE 92

Query: 87  EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNT 146
           +  +     +     ++   E +   ++ Y+  S ++L  +  +    W           
Sbjct: 93  KGFVVPLKTVNSDFLSESDIEALSYSFDLYKDKSFDELTRLSHQH--AW---NSAQKSGM 147

Query: 147 NRTITVEEI 155
           N +I ++EI
Sbjct: 148 NTSIRIDEI 156


>gi|219882948|ref|YP_002478112.1| hypothetical protein Achl_4344 [Arthrobacter chlorophenolicus A6]
 gi|219861954|gb|ACL42295.1| hypothetical protein Achl_4344 [Arthrobacter chlorophenolicus A6]
          Length = 171

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/114 (16%), Positives = 34/114 (29%), Gaps = 9/114 (7%)

Query: 14  STIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG 73
           S   V  F + +   +   +    I +  Y      +      +  EE +  K GPV   
Sbjct: 5   SVHDVVAFLLAQARGH---LSTSAIHRMTYYAQGWHLASAGTPLFAEEIRIRKTGPVAHA 61

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
           ++   K           D               EI+  ++N Y   S   + E+
Sbjct: 62  LFPLQKD------GCTEDSWPAGNAHAITGHSAEIVSYVFNSYGHMSGISMGEL 109


>gi|37524858|ref|NP_928202.1| hypothetical protein plu0863 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784283|emb|CAE13158.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 184

 Score = 58.1 bits (139), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/138 (17%), Positives = 45/138 (32%), Gaps = 30/138 (21%)

Query: 40  QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYF--DSHPIEVIMDLSF--- 94
           + +Y      + +  + +  +   A K GPV V  Y   K    D   I    D+     
Sbjct: 37  KILYFADRLHLERYGRLITGDNYLAMKDGPVAVNAYDIIKVARGDGRFIPNKCDVDVIRS 96

Query: 95  ----------------RIFPK-IANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
                           R F + + +    + +     KY + S +++++I    +  W  
Sbjct: 97  LLSVEGRHGNHQIRALRDFDEDVFSDSDIDCINEAIEKYGNLSFKEIRDISH--DSVW-- 152

Query: 138 LYDPNDPNTNRTITVEEI 155
                  N N  I +E I
Sbjct: 153 ----MTANQNSEIPLEVI 166


>gi|255316706|ref|ZP_05358289.1| hypothetical protein CdifQCD-7_20267 [Clostridium difficile
          QCD-76w55]
          Length = 67

 Score = 57.7 bits (138), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 27/59 (45%), Gaps = 4/59 (6%)

Query: 10 NPPYSTIAVANFFIDKG-VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSML---DEEPQA 64
          +  YS   VA + +     K +  ID+L++ + +YL     +    +S+    DE  +A
Sbjct: 9  DSRYSAKDVAIYVLWYCENKLNKAIDNLRLNKLLYLIQAKYLYLYNESIFLNLDERFEA 67


>gi|261417079|ref|YP_003250762.1| hypothetical protein Fisuc_2697 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373535|gb|ACX76280.1| hypothetical protein Fisuc_2697 [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 187

 Score = 57.7 bits (138), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/130 (14%), Positives = 46/130 (35%), Gaps = 16/130 (12%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP------- 69
            + N  +    K+   +D++K+ + IY    D + +  K+++ E  +A   GP       
Sbjct: 9   KIENVILYVLQKFDDGVDYIKLFKIIYFAQRDYLCRFGKTLVPETFKARMHGPIPTLTDK 68

Query: 70  VFVGV-------YHRFKYF--DSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
           V   V       +   K F      ++  +            ++  E ++  ++  +   
Sbjct: 69  VIKNVEDGVGDDFPDLKEFMESIKVVDQKVYALKEPNLDFIAKKEREYLDKWFDYCKDKK 128

Query: 121 TEQLQEIVQE 130
           +  L E   +
Sbjct: 129 SYDLSEESHD 138


>gi|302327854|gb|ADL27055.1| conserved hypothetical protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 191

 Score = 57.7 bits (138), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/130 (14%), Positives = 46/130 (35%), Gaps = 16/130 (12%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP------- 69
            + N  +    K+   +D++K+ + IY    D + +  K+++ E  +A   GP       
Sbjct: 13  KIENVILYVLQKFDDGVDYIKLFKIIYFAQRDYLCRFGKTLVPETFKARMHGPIPTLTDK 72

Query: 70  VFVGV-------YHRFKYF--DSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
           V   V       +   K F      ++  +            ++  E ++  ++  +   
Sbjct: 73  VIKNVEDGVGDDFPDLKEFMESIKVVDQKVYALKEPNLDFIAKKEREYLDKWFDYCKDKK 132

Query: 121 TEQLQEIVQE 130
           +  L E   +
Sbjct: 133 SYDLSEESHD 142


>gi|37527099|ref|NP_930443.1| hypothetical protein plu3216 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36786532|emb|CAE15590.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 186

 Score = 56.9 bits (136), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/109 (11%), Positives = 32/109 (29%), Gaps = 15/109 (13%)

Query: 45  THCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF---------------KYFDSHPIEVI 89
                +      +  +   +  +GPV     +                 K   ++ I + 
Sbjct: 34  ADRVSMNDYGYPITGDRMVSMPRGPVLSQTLNLITGDYASDEFGWGAWIKSEKNYEISLK 93

Query: 90  MDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
                R   +  +    E++++IW ++   S   + E   +    W+  
Sbjct: 94  RKGITRDDFESLSDAELEVLDAIWEQFGHMSRFDIVEYTHKHCTEWQDP 142


>gi|255533041|ref|YP_003093413.1| hypothetical protein Phep_3156 [Pedobacter heparinus DSM 2366]
 gi|255346025|gb|ACU05351.1| conserved hypothetical protein [Pedobacter heparinus DSM 2366]
          Length = 186

 Score = 56.9 bits (136), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/151 (16%), Positives = 46/151 (30%), Gaps = 30/151 (19%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY---------------- 80
           KI + +Y      +    + +  +  QA   GPV   +Y  FK                 
Sbjct: 29  KIFKILYFAEQQHLKNYGQPLTGDVYQAMPYGPVPSFLYDVFKASENQASPFSEALELSK 88

Query: 81  ----FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
                    I  +         ++A   I  IM SI   Y   + +++ +     +  W 
Sbjct: 89  AFTVSRKDKIPYVSPTREADIDQLAETNIEAIMASIEENYA-LTFKEITDKSH--DSAWA 145

Query: 137 RLYDPNDPNTNRTITVEEITKMADGSNISPE 167
           +     +       T      +A+ +  SPE
Sbjct: 146 KAEQATE-------TEMSYLDIAESAEASPE 169


>gi|219666421|ref|YP_002456856.1| hypothetical protein Dhaf_0353 [Desulfitobacterium hafniense DCB-2]
 gi|219536681|gb|ACL18420.1| helix-turn-helix domain-containing protein [Desulfitobacterium
           hafniense DCB-2]
          Length = 332

 Score = 56.9 bits (136), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/115 (13%), Positives = 37/115 (32%), Gaps = 13/115 (11%)

Query: 29  YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF---------- 78
            +  +   K+Q+ +Y        +    +          GPV    +             
Sbjct: 196 TNRELVKTKLQKLLYYADNLHFKRYGYPITGLVYIHHHFGPV-PVNHDLIHWVLESVGVI 254

Query: 79  --KYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             K +D      I+  + R    + + E  E++ +I   ++  S  ++ +   +E
Sbjct: 255 ETKPYDGLYEGEILMPTERGNQDLFSNEELEVIFAIAEYFKDFSATKISDFSHKE 309


>gi|281412556|ref|YP_003346635.1| XRE family transcriptional regulator [Thermotoga naphthophila
           RKU-10]
 gi|281373659|gb|ADA67221.1| transcriptional regulator, XRE family [Thermotoga naphthophila
           RKU-10]
          Length = 330

 Score = 56.5 bits (135), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 25/142 (17%), Positives = 48/142 (33%), Gaps = 20/142 (14%)

Query: 18  VANFFIDKGVKYSIP-IDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV------ 70
           VA + + K  +     I  +K+ + ++        Q  +S+          GP       
Sbjct: 190 VA-YILQKLREQGYKYITKVKLMKLLWFVDKGYSKQYGRSISGLTYAHLPLGPAPHYHDT 248

Query: 71  ---------FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHST 121
                     + V       DS  I   ++L    F +  N+   +I++ I  KY   +T
Sbjct: 249 LLELLETAGVITVEREINENDSETI--KIELKDETFERYINEREKKILDEILQKYGLMNT 306

Query: 122 EQLQEIVQEENKTWRRLYDPND 143
             L +    E++ W+   D   
Sbjct: 307 SDLIKKSH-EDEIWKSTKDGEK 327


>gi|57505935|ref|ZP_00371859.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195]
 gi|57015735|gb|EAL52525.1| conserved hypothetical protein [Campylobacter upsaliensis RM3195]
          Length = 56

 Score = 56.5 bits (135), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 30/54 (55%), Gaps = 4/54 (7%)

Query: 15 TIAVANFFIDK----GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQA 64
            ++AN F++K     V+ +  I  +K+Q+ ++L   + + + +K +  E+ +A
Sbjct: 3  AQSIANAFLNKVPIEAVENNEGIHKIKLQKLLFLAQKEYLFRYEKPLFKEKIEA 56


>gi|184154580|ref|YP_001842920.1| hypothetical protein LAF_0104 [Lactobacillus fermentum IFO 3956]
 gi|183225924|dbj|BAG26440.1| hypothetical protein [Lactobacillus fermentum IFO 3956]
 gi|299782756|gb|ADJ40754.1| Putative uncharacterized protein [Lactobacillus fermentum CECT
           5716]
          Length = 241

 Score = 56.1 bits (134), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 26/145 (17%), Positives = 51/145 (35%), Gaps = 16/145 (11%)

Query: 14  STIAVANFFIDKGVKYSIPIDHL-KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           +T  VA + I K   Y + +     IQ+ +Y  + D +  + + + + +  A+ +GPV  
Sbjct: 91  TTTEVAAYMIHK---YHLSLHQRYAIQKTLYYLYADHLATEGR-LFEGQFVAYDRGPVDS 146

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIANQ-EIGEIMESIWNKYQSH-STEQLQ----- 125
            + +     D   I+    L          + ++   ++   +KY      E L      
Sbjct: 147 KLLNLM-VHDPKRIDRSRFLFHEKIGVGQKRTQVLTAIDEAVDKYLPFFEQEPLVSDPAA 205

Query: 126 EIVQEENKTWRRLYDPNDPNTNRTI 150
                    W+R Y       N  I
Sbjct: 206 NPTHRPGTPWQRAY---QQGQNTVI 227


>gi|302380318|ref|ZP_07268789.1| hypothetical protein HMPREF9261_0099 [Finegoldia magna
           ACS-171-V-Col3]
 gi|302311923|gb|EFK93933.1| hypothetical protein HMPREF9261_0099 [Finegoldia magna
           ACS-171-V-Col3]
          Length = 203

 Score = 56.1 bits (134), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 33/186 (17%), Positives = 78/186 (41%), Gaps = 28/186 (15%)

Query: 15  TIAVANFFIDKG---VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
            I +A +F+ K    +K  I  +H K+   +  ++   +   K+ ++D++ + ++  PV 
Sbjct: 3   AIEIAKWFLYKNPSLLKGGIDENH-KLNTLLCFSNLMYLSVYKEKLIDDKFEKFEGYPVV 61

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
              Y+ ++    + +   +D +    P I +++I +++E     Y   S  +  ++    
Sbjct: 62  KSAYNEYQ---YNNLCESVDEN----PTILDEKILQVLEINNFVYSDFSLSEFNDM---- 110

Query: 132 NKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQ 191
                        N    +T+ E     D  NI P+++ E +        D +F  + ++
Sbjct: 111 ------------CNNLNILTLVEKESTIDYKNI-PQDLKEFMVNLYNLYKDYDFDNIGTE 157

Query: 192 LVKGFK 197
           +V G K
Sbjct: 158 IVNGNK 163


>gi|294102240|ref|YP_003554098.1| transcriptional regulator, XRE family [Aminobacterium colombiense
           DSM 12261]
 gi|293617220|gb|ADE57374.1| transcriptional regulator, XRE family [Aminobacterium colombiense
           DSM 12261]
          Length = 345

 Score = 55.8 bits (133), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 14/121 (11%), Positives = 40/121 (33%), Gaps = 16/121 (13%)

Query: 27  VKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV-----FVGVYHRFKYF 81
            K    + +LK+ + ++           +S+   +    + GPV        +Y      
Sbjct: 202 SKMGERVSYLKLNKLLFYCDFYAFKTLTRSITGLQYVNMQYGPVPGGAFSYTIYEYLNEV 261

Query: 82  DSHPIEVIMDLSFRIFPKI-----------ANQEIGEIMESIWNKYQSHSTEQLQEIVQE 130
            +  I++I     +    I            +++  ++++ +         ++L  +  E
Sbjct: 262 GALDIDIIECEDEKTQHWILLPQNSSHCGLLSEQEKKLIDEVLEALGPLKGKELTNLSHE 321

Query: 131 E 131
           E
Sbjct: 322 E 322


>gi|270293719|ref|ZP_06199921.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270275186|gb|EFA21046.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 185

 Score = 55.4 bits (132), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 26/172 (15%), Positives = 60/172 (34%), Gaps = 31/172 (18%)

Query: 23  IDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFD 82
           I +     +     K+ + +Y    D +++  K ++++   A K GPV   +Y   +   
Sbjct: 17  IMQSFPQGVEYT--KLFEILYFAQQDYLVKYGKVLIEDSFMALKYGPVPTYIYKALQTAG 74

Query: 83  SHPIEV--------------IMDLSFRIFPKIANQEIGEIMESIWNKYQS---HSTEQLQ 125
             P E                +  S +      +      +++   KY+    +    L 
Sbjct: 75  RKPTEEGFNDFLTGIEVHEKKIYASAKPDMDYISGSDKRCLDAAITKYRDTDPYDQSDLS 134

Query: 126 EIVQEENKTWRR--LYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKK 175
                 +  W+       +DP  N  +T+ +I +    +    + +V+ I+K
Sbjct: 135 N-----DSAWKEFMTRIKDDPQKN-LLTIMDIARAGKAN----KEMVDYIRK 176


>gi|281426291|ref|ZP_06257204.1| conserved hypothetical protein [Prevotella oris F0302]
 gi|281399594|gb|EFB30425.1| conserved hypothetical protein [Prevotella oris F0302]
          Length = 168

 Score = 55.0 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/118 (12%), Positives = 43/118 (36%), Gaps = 12/118 (10%)

Query: 34  DHLKIQQFIYLTHCDVVLQKKKSM--LDEEPQAWKQGPVFVGVYHRFK-----YFDSHP- 85
             LK+ + ++L         ++ +  +  +  A   GPV   +Y+  +      +  +  
Sbjct: 27  TTLKLIKLLFLVVGVSSNDNEEGLTRIFNKFSAMPYGPVESDIYNAIQTNRLNKYRINSS 86

Query: 86  ---IEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD 140
              I+   D++ +   +       +++ +   +       +L +I  +    WR  Y+
Sbjct: 87  SCTIQEERDINLQEQDRQDINNAIKLLLAKNPRILQCQPFELVDITHK-WSCWRTCYN 143


>gi|281422771|ref|ZP_06253770.1| hypothetical protein PREVCOP_06687 [Prevotella copri DSM 18205]
 gi|281403139|gb|EFB33819.1| hypothetical protein PREVCOP_06687 [Prevotella copri DSM 18205]
          Length = 123

 Score = 54.6 bits (130), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/93 (16%), Positives = 33/93 (35%), Gaps = 11/93 (11%)

Query: 46  HCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEI 105
             + ++Q    + +    A   GP    V+  +       I   +     + P    +E 
Sbjct: 2   QRECIVQTGSPLFEAIFYAHTLGPYIPEVHAAY-------ISNSLH---DVLPSSIIEEY 51

Query: 106 GEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
             I +S++    +  T  L  ++  E+  W+R 
Sbjct: 52  KTIFDSVFELLSAKKTRSLSNLIHGEDS-WKRA 83


>gi|312965293|ref|ZP_07779526.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312289967|gb|EFR17854.1| conserved hypothetical protein [Escherichia coli 2362-75]
          Length = 169

 Score = 53.8 bits (128), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/115 (13%), Positives = 39/115 (33%), Gaps = 19/115 (16%)

Query: 49  VVLQKKKSMLDEEPQAWKQGPVFVGVYHRFK-------YFDSHPIEVIM-------DLSF 94
            +L+  + + ++   + K GPV     +  +        +  + IE          D   
Sbjct: 17  SILKHGRMIGEDSLYSMKFGPVMSNTLNLIRGKAEGIGDYWYNLIETNGHNVSLRSDPRE 76

Query: 95  RIFPKIANQ---EIGEIMESIWNKYQSHSTEQLQEIVQEENKT--WRRLYDPNDP 144
               ++ ++       I++ I+++Y   +   L  +   E+    W    +   P
Sbjct: 77  MDADEVFDELSRADIRILDEIYSRYGHMNRFDLANMTHLESVCPEWHDPGNSRKP 131


>gi|288929548|ref|ZP_06423392.1| conserved hypothetical protein [Prevotella sp. oral taxon 317 str.
           F0108]
 gi|288329053|gb|EFC67640.1| conserved hypothetical protein [Prevotella sp. oral taxon 317 str.
           F0108]
          Length = 182

 Score = 53.8 bits (128), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/160 (14%), Positives = 55/160 (34%), Gaps = 27/160 (16%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY 80
           + ++K            + + IY  +   + +    M+ ++  A   GPV   +Y+  K 
Sbjct: 15  YILNKTNGLDYY----HVFKVIYFANVAHLAKYGSLMVSDDFCALPDGPVPSNLYNCVKG 70

Query: 81  --FDSHPIEVIMDLSF---------------RIFPKIANQEIGEIMESIW--NKYQSHST 121
             F    ++ ++D S                    +  ++   E+++     N Y  +  
Sbjct: 71  EQFCDKDLQSMLDESVSKGKDDAYYMLEAKREADEEYLSKADIEVLDESISENAYLPYG- 129

Query: 122 EQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADG 161
             L+     E   W+R ++ +       I + +    +DG
Sbjct: 130 -DLRAKSHGE--EWKRAFEQHGRKVVDVIGMAKDGMASDG 166


>gi|242308942|ref|ZP_04808097.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239524366|gb|EEQ64232.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 186

 Score = 53.8 bits (128), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/130 (13%), Positives = 47/130 (36%), Gaps = 17/130 (13%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF-- 78
           + I  G K    +    + + ++ +    + +  +S+  +   A K G V   V      
Sbjct: 12  YIIKNGKKPYDKVS---LLKLVFFSDRYHLRKYGRSISHDTYYAMKHGAVASNVKDILSQ 68

Query: 79  -------KYFDSHPIEVIMDL----SFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
                  + +  + I +  +     +     ++ ++   E M+     + +  T +L EI
Sbjct: 69  NFESDEEQEYFFNYISISDNKYYITNKEKSLEMLSKTNEEAMDFALKHFGNIETFKLAEI 128

Query: 128 VQEENKTWRR 137
             +  + W++
Sbjct: 129 SHQYPE-WKK 137


>gi|330970595|gb|EGH70661.1| hypothetical protein PSYAR_08896 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 176

 Score = 53.4 bits (127), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 26/176 (14%), Positives = 67/176 (38%), Gaps = 22/176 (12%)

Query: 19  ANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF 78
           A FF+ +       + +LK+ + +YL+  + + +  + + D+   + + GPV        
Sbjct: 2   AAFFLCR---RGGTMSYLKLMKLLYLSDREAIDRFNRPISDDSMVSMEHGPVLSRTLDLM 58

Query: 79  KYF----DSH----------PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQL 124
           K        +           + +   ++        ++   +++ES+W K+      QL
Sbjct: 59  KQKIPSDGWNHWVTSPTHTYDVSLKCGVTDWEELDELSRADLDVLESVWKKFGHMDRYQL 118

Query: 125 QEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVE-QIKKPVRF 179
           ++   +    W      + P    ++    +  +  G+ ++ E   E Q +K +R 
Sbjct: 119 RDYTHDCLPEWENPGRSSRPIDPASL----LQALGRGAEVTSEQARELQERKKLRL 170


>gi|167762949|ref|ZP_02435076.1| hypothetical protein BACSTE_01313 [Bacteroides stercoris ATCC
           43183]
 gi|167699289|gb|EDS15868.1| hypothetical protein BACSTE_01313 [Bacteroides stercoris ATCC
           43183]
          Length = 207

 Score = 53.4 bits (127), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/106 (18%), Positives = 33/106 (31%), Gaps = 15/106 (14%)

Query: 43  YLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY-------HRFKYFDSHPIEVIMDLSFR 95
           Y+     V            + W+ GPV   ++          K F    ++        
Sbjct: 52  YMVKRYHVPFMGLP-----FEIWQAGPVAKDIFIDLSDGPFLLKDFVKTEVQKDATYIRA 106

Query: 96  IFP---KIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
           I P      +    E+M+ I  KY   + +QL   V +E   W   
Sbjct: 107 IKPFCDDEFSDCEMEMMDEIIRKYGKKTAKQLVAEVHKEGSLWFNA 152


>gi|89897252|ref|YP_520739.1| hypothetical protein DSY4506 [Desulfitobacterium hafniense Y51]
 gi|89336700|dbj|BAE86295.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 331

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 36/122 (29%), Gaps = 13/122 (10%)

Query: 22  FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF--- 78
            +    + +  +   K+Q+ +Y        +    +          GPV    +      
Sbjct: 188 MVQIFAETNRDLVKTKLQKLLYYADNLHFKRYGYPITGLAYIHHHFGPV-PANHDLIYWA 246

Query: 79  ---------KYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
                    K +D      I+  +      + + E  E++ ++   +   S  ++ +   
Sbjct: 247 LESVGVIETKPYDGPYEGEILISTEEGNHGLFSDEELEVVLTVAGYFNDFSATRISDFSH 306

Query: 130 EE 131
            E
Sbjct: 307 RE 308


>gi|315122577|ref|YP_004063066.1| hypothetical protein CKC_04145 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495979|gb|ADR52578.1| hypothetical protein CKC_04145 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 47

 Score = 53.1 bits (126), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 9/40 (22%), Positives = 20/40 (50%), Gaps = 1/40 (2%)

Query: 101 ANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD 140
            +Q+   I++ ++  Y   ST +L+ +   E   W+  Y+
Sbjct: 9   IDQKDRNILDDVFEFYGQFSTWKLRNMTHTE-APWKDAYE 47


>gi|160891853|ref|ZP_02072856.1| hypothetical protein BACUNI_04310 [Bacteroides uniformis ATCC 8492]
 gi|317480333|ref|ZP_07939434.1| hypothetical protein HMPREF1007_02551 [Bacteroides sp. 4_1_36]
 gi|156858331|gb|EDO51762.1| hypothetical protein BACUNI_04310 [Bacteroides uniformis ATCC 8492]
 gi|316903508|gb|EFV25361.1| hypothetical protein HMPREF1007_02551 [Bacteroides sp. 4_1_36]
          Length = 189

 Score = 52.7 bits (125), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 16/151 (10%), Positives = 41/151 (27%), Gaps = 35/151 (23%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
           AV  + + +  +       + + + +Y           K ++ +   A ++GPV   +Y 
Sbjct: 12  AVTLYILKQCGELDF----IHLFKILYFAERQHYATYGKHLVKDTFCALERGPVPSFLYD 67

Query: 77  RFKYFDSH-------------------------PIEVIMDLSFRIFPKIANQEIGEIMES 111
             K   +                           I    +       K         +++
Sbjct: 68  AVKVATNSAHAVKGSLLQQLADSLKPGNAECYYFIGAAEEPDMDELSKA----DLACLDA 123

Query: 112 IWNKYQSHSTEQLQEIVQEENKTWRRLYDPN 142
              +      +QL +     +  W+  +D  
Sbjct: 124 SIKENLQKDAKQLSKDSH--DVAWQTAWDAR 152


>gi|213971951|ref|ZP_03400049.1| hypothetical protein PSPTOT1_0783 [Pseudomonas syringae pv. tomato
           T1]
 gi|213923266|gb|EEB56863.1| hypothetical protein PSPTOT1_0783 [Pseudomonas syringae pv. tomato
           T1]
          Length = 186

 Score = 52.3 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 56/147 (38%), Gaps = 20/147 (13%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            +A FF+ +       + +LK+ + +YL+  + + +  + + D+   + + GPV      
Sbjct: 10  QMAAFFLCR---RGGTMSYLKLMKLLYLSDREAIDRFNRPISDDSMVSMEHGPVLSRTLD 66

Query: 77  RFKYF----DSH----------PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTE 122
             K        +           + +   ++        ++   +++ES+W K+      
Sbjct: 67  LMKQKIPSDGWNHWVTSPTHTYDVSLKCGVTDWEELDELSKADLDVLESVWKKFGHMDRY 126

Query: 123 QLQEIVQEENKTWR---RLYDPNDPNT 146
           QL++   +    W    R   P DP +
Sbjct: 127 QLRDYTHDCLPEWENPGRSSRPIDPAS 153


>gi|301386019|ref|ZP_07234437.1| hypothetical protein PsyrptM_25428 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058852|ref|ZP_07250393.1| hypothetical protein PsyrptK_02612 [Pseudomonas syringae pv. tomato
           K40]
          Length = 176

 Score = 51.9 bits (123), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/145 (15%), Positives = 55/145 (37%), Gaps = 20/145 (13%)

Query: 19  ANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF 78
           A FF+ +       + +LK+ + +YL+  + + +  + + D+   + + GPV        
Sbjct: 2   AAFFLCR---RGGTMSYLKLMKLLYLSDREAIDRFNRPISDDSMVSMEHGPVLSRTLDLM 58

Query: 79  KYF----DSH----------PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQL 124
           K        +           + +   ++        ++   +++ES+W K+      QL
Sbjct: 59  KQKIPSDGWNHWVTSPTHTYDVSLKCGVTDWEELDELSKADLDVLESVWKKFGHMDRYQL 118

Query: 125 QEIVQEENKTWR---RLYDPNDPNT 146
           ++   +    W    R   P DP +
Sbjct: 119 RDYTHDCLPEWENPGRSSRPIDPAS 143


>gi|322831302|ref|YP_004211329.1| hypothetical protein Rahaq_0575 [Rahnella sp. Y9602]
 gi|321166503|gb|ADW72202.1| hypothetical protein Rahaq_0575 [Rahnella sp. Y9602]
          Length = 175

 Score = 51.5 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 22/141 (15%), Positives = 43/141 (30%), Gaps = 26/141 (18%)

Query: 40  QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF-----------KYFDSHPIEV 88
           + +Y      + +  + +  +   A K GPV  G +              K  D+  I  
Sbjct: 32  KILYFADRAHLKEYGRMLFGDTYIAMKDGPVASGAFDIIKTARGTASFLPKGLDAETIRK 91

Query: 89  IMDLSFRIFPKI-------ANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDP 141
            + +       +        +    E +     +Y S     ++ I    +  W  +   
Sbjct: 92  ALTVDGYQMKTLRPADENFFSDSDLECINQALEEYGSKPFGVIRRISH--DAIWSSV--- 146

Query: 142 NDPNTNRTITVEEITKMADGS 162
                N+ I +E I K  D S
Sbjct: 147 ---TENKEIPLEVIAKHLDES 164


>gi|255039063|ref|YP_003089684.1| helix-turn-helix domain-containing protein [Dyadobacter fermentans
           DSM 18053]
 gi|254951819|gb|ACT96519.1| helix-turn-helix domain-containing protein [Dyadobacter fermentans
           DSM 18053]
          Length = 328

 Score = 51.5 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/112 (17%), Positives = 42/112 (37%), Gaps = 14/112 (12%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV---FVGVYHRFKY----------FDS 83
           K+ + ++ T  +       S    E +A + GPV   F  +Y               F +
Sbjct: 192 KLNKLLFYTDFNTYKLTGYSTTGLEYRAIQFGPVPSQFQKMYVNLSETGQISIDEQYFGN 251

Query: 84  HPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
                 ++        + + E  +++E + N+Y   ST+ + ++  EE   W
Sbjct: 252 GAYGDEINAKVAFDQTLFSPEELDVLEHVANRYAKLSTDDIVKLSHEETG-W 302


>gi|265753782|ref|ZP_06089137.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|263235496|gb|EEZ21020.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 182

 Score = 51.5 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 34/162 (20%), Positives = 64/162 (39%), Gaps = 32/162 (19%)

Query: 40  QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY--FDSHPIEVIMDLSFR-- 95
           + IY  +   + +    M  +E  A   GPV   +Y+  K   +    ++ ++D S    
Sbjct: 30  KVIYFANISYLAKYGFRMTTDEFCALPDGPVPSILYNCIKNDCYCDKELKAMIDGSVSKG 89

Query: 96  --------------IFPKIANQEIGEIMESI-WNKYQSHSTEQLQEIVQEENKTWRRLYD 140
                             ++  +I EI  SI  N Y  +   +L+E    E   W R Y 
Sbjct: 90  DCDAYYMLTAKREADLDYLSKADIEEIDRSIEKNAYLPYG--ELREKSHGE--EWNRAY- 144

Query: 141 PNDPNTNRTITVEEITKMA-DGSNISPENVVEQIKKPVRFDS 181
                +N    V ++  MA DG  ++  ++++ IK+ +  +S
Sbjct: 145 -----SNSGKKVMDVLGMAKDG--MATNDMLDYIKENLSIES 179


>gi|237722819|ref|ZP_04553300.1| helix-turn-helix domain-containing protein [Bacteroides sp. 2_2_4]
 gi|229447341|gb|EEO53132.1| helix-turn-helix domain-containing protein [Bacteroides sp. 2_2_4]
 gi|295085329|emb|CBK66852.1| hypothetical protein [Bacteroides xylanisolvens XB1A]
          Length = 331

 Score = 51.5 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 40/111 (36%), Gaps = 11/111 (9%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV---FVGVYHRFKYFDSHPIEVIMDLS 93
           K+ + ++ +      +  K +   + QA   GPV   +  +Y          I +    S
Sbjct: 203 KLNKLLFYSDFLSYKKYGKGISGLQYQAISYGPVPVRYSTIYENLDGLKKEIINLGNGYS 262

Query: 94  FRIFPKI-------ANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
             I   +          E  E+++ +   ++     ++ E+   E + WR+
Sbjct: 263 GSIITTVEQFEQSLFTVEELEVLQCVLVHFEKSKANEISEMSHAE-EAWRQ 312


>gi|298482299|ref|ZP_07000486.1| toxin-antitoxin system, antitoxin component, Xre family
           [Bacteroides sp. D22]
 gi|298271586|gb|EFI13160.1| toxin-antitoxin system, antitoxin component, Xre family
           [Bacteroides sp. D22]
          Length = 331

 Score = 51.5 bits (122), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 40/111 (36%), Gaps = 11/111 (9%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV---FVGVYHRFKYFDSHPIEVIMDLS 93
           K+ + ++ +      +  K +   + QA   GPV   +  +Y          I +    S
Sbjct: 203 KLNKLLFYSDFLSYKKYGKGISGLQYQAISYGPVPVRYSTIYENLDGLKKEIINLGNGYS 262

Query: 94  FRIFPKI-------ANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
             I   +          E  E+++ +   ++     ++ E+   E + WR+
Sbjct: 263 GSIITTVEQFEQSLFTVEELEVLQCVLVHFEKSKANEISEMSHAE-EAWRQ 312


>gi|160883589|ref|ZP_02064592.1| hypothetical protein BACOVA_01561 [Bacteroides ovatus ATCC 8483]
 gi|156111002|gb|EDO12747.1| hypothetical protein BACOVA_01561 [Bacteroides ovatus ATCC 8483]
          Length = 331

 Score = 51.1 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 40/111 (36%), Gaps = 11/111 (9%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV---FVGVYHRFKYFDSHPIEVIMDLS 93
           K+ + ++ +      +  K +   + QA   GPV   +  +Y          I +    S
Sbjct: 203 KLNKLLFYSDFLSYKKYGKGISGLQYQAISYGPVPVRYSTIYENLDGLKKEIINLGNGYS 262

Query: 94  FRIFPKI-------ANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
             +   +          E  E+++ +   ++     ++ E+   E + WR+
Sbjct: 263 GSMITTVEQFEQSLFTVEELEVLQCVLAHFEKSKANEISEMSHAE-EAWRQ 312


>gi|289522655|ref|ZP_06439509.1| hypothetical protein HMPREF1705_00562 [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289504491|gb|EFD25655.1| hypothetical protein HMPREF1705_00562 [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 206

 Score = 51.1 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 49/135 (36%), Gaps = 12/135 (8%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
           AVA F  +   +         I +F+ L     + +     +  E  A K GPV   +Y+
Sbjct: 20  AVAYFAFEFNRRKGYYPRQTWIYKFLALLDFRSLKKTGVPCIGLEYDAMKFGPVPNILYN 79

Query: 77  -----RFKYFDSHPI---EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
                RFK F           ++   +        +  ++ME I + Y +     L  ++
Sbjct: 80  SRSCLRFKKFKFIETADGGFRVEPVSKPNLDYFADDEIDLMEEILDDY-TRDGVNLDNLI 138

Query: 129 ---QEENKTWRRLYD 140
               +E K W + +D
Sbjct: 139 ANAHKEIKAWNKAWD 153


>gi|299147612|ref|ZP_07040676.1| toxin-antitoxin system, antitoxin component, Xre family
           [Bacteroides sp. 3_1_23]
 gi|298514399|gb|EFI38284.1| toxin-antitoxin system, antitoxin component, Xre family
           [Bacteroides sp. 3_1_23]
          Length = 331

 Score = 51.1 bits (121), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/111 (15%), Positives = 40/111 (36%), Gaps = 11/111 (9%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV---FVGVYHRFKYFDSHPIEVIMDLS 93
           K+ + ++ +      +  K +   + QA   GPV   +  +Y          I +    S
Sbjct: 203 KLNKLLFYSDFLSYKKYGKGISGLQYQAINYGPVPVRYSTIYENLDGLKKEIINLGNGYS 262

Query: 94  FRIFPKI-------ANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
             I   +          E  E+++ +   ++     ++ E+   E + WR+
Sbjct: 263 GSIITTVEQFEQSLFTVEELEVLQCVLVHFEKSKANEISEMSHAE-EAWRQ 312


>gi|213962003|ref|ZP_03390268.1| conserved hypothetical protein [Capnocytophaga sputigena Capno]
 gi|213955356|gb|EEB66673.1| conserved hypothetical protein [Capnocytophaga sputigena Capno]
          Length = 167

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/107 (11%), Positives = 36/107 (33%), Gaps = 7/107 (6%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRI 96
           K+ + +Y      ++   + +  +     + GPV   + +  +  +   +    +  F  
Sbjct: 29  KVFKILYFADQKHLVNYGRPITGDTYVKMQYGPVPSFLRNVSEGNEKEGLINKTNKHFLT 88

Query: 97  FPKIANQE-----IGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
                ++E       E +     + +  S ++L E     +  W+  
Sbjct: 89  TSYQYDEEDLSESEIECLNEAIAENKDISFKKLTEKSH--DSAWQNA 133


>gi|147679206|ref|YP_001213421.1| hypothetical protein PTH_2871 [Pelotomaculum thermopropionicum SI]
 gi|146275303|dbj|BAF61052.1| hypothetical membrane protein [Pelotomaculum thermopropionicum SI]
          Length = 190

 Score = 50.4 bits (119), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 24/139 (17%), Positives = 48/139 (34%), Gaps = 24/139 (17%)

Query: 22  FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV--------- 72
           F++K  +    +   K+ + I     +   +   S+        K GPV           
Sbjct: 15  FLNKAKE----VPKTKLAKLILFAEIEHFQRTGDSVTGLYFVRMKMGPVIAFFDEVLKDG 70

Query: 73  --GVYHRFKYFDSHPI--EVIMDLSFRIFPK---IANQEIGEIMESIWNKYQSHSTEQLQ 125
              ++   K     PI  E      +   PK     ++E+ E +  +  KY   +  +L 
Sbjct: 71  EGELWD--KKTTPIPIYEERKEKFQYCYAPKREAELSEEVQETVNIVCKKYGWKTGTELS 128

Query: 126 EIVQEENKTWRRLYDPNDP 144
            +  +    W+   +PN+P
Sbjct: 129 RLSHD-LPAWKYS-EPNEP 145


>gi|254440482|ref|ZP_05053976.1| hypothetical protein OA307_5352 [Octadecabacter antarcticus 307]
 gi|198255928|gb|EDY80242.1| hypothetical protein OA307_5352 [Octadecabacter antarcticus 307]
          Length = 65

 Score = 50.0 bits (118), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 7/41 (17%), Positives = 18/41 (43%)

Query: 21 FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE 61
          F I +  +    +  LK+Q+ ++ +    V    + + +E 
Sbjct: 23 FLIVESCERGDLLTPLKLQKLMFYSDAWFVALHDEELTNEY 63


>gi|194336319|ref|YP_002018113.1| hypothetical protein Ppha_1224 [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194308796|gb|ACF43496.1| conserved hypothetical protein [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 183

 Score = 50.0 bits (118), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/157 (16%), Positives = 49/157 (31%), Gaps = 31/157 (19%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRI 96
           K+ + +Y      + +   ++ D+   A   GPV    Y   K      +       F  
Sbjct: 30  KVFKILYFADQKHLSRYGSAITDDTYIAMANGPVPSMAYDILKSLRGEGLFTSQKEQFTP 89

Query: 97  FPKIA------------------NQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
           + ++                     E+  I ESI   Y       L E     +  W++ 
Sbjct: 90  YFELQINKHTVKAKKSPDLDYLSESEMRCIDESIEENY-HLKFSDLTEKSH--DTAWQKA 146

Query: 139 YDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKK 175
                   N  I + ++ K     N    +++E IK+
Sbjct: 147 V------FNSEIDLLDVAKCGGAGN----DMIEYIKE 173


>gi|15838698|ref|NP_299386.1| hypothetical protein XF2107 [Xylella fastidiosa 9a5c]
 gi|9107235|gb|AAF84906.1|AE004026_7 hypothetical protein XF_2107 [Xylella fastidiosa 9a5c]
          Length = 70

 Score = 50.0 bits (118), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 50  VLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIA--NQEIGE 107
           +      ++DE  +AW+ GPV   +Y+  K   S  I   + + +  + + +  +     
Sbjct: 6   MCVHTHPLIDELVEAWRAGPVIRSMYNAIKQDGSSGITERLPVRWFSWGRASKIDATAAA 65

Query: 108 IMESI 112
           I+ S+
Sbjct: 66  ILASV 70


>gi|270265280|ref|ZP_06193541.1| hypothetical protein SOD_m00120 [Serratia odorifera 4Rx13]
 gi|270040684|gb|EFA13787.1| hypothetical protein SOD_m00120 [Serratia odorifera 4Rx13]
          Length = 191

 Score = 49.6 bits (117), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 33/209 (15%), Positives = 75/209 (35%), Gaps = 47/209 (22%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            +A + + K       +  +K+     L+  D +++  + M  ++  + + GP+      
Sbjct: 9   QMAAYLLLKSDGRMAYLKLMKLLY---LSDRDYLIKYGELMSGDKLYSMRFGPILSETLD 65

Query: 77  RFKYF------DSHPIEVIMDLSFRIFPKI---ANQEIG---------EIMESIWNKYQS 118
             K        D     +  D    + P++    + E           + ++ +++ Y  
Sbjct: 66  LIKNVNKVGGDDWEKFIIRDDKDVHLNPRLGGAFDWEEELGELSRADVKTLDGVFDNYGH 125

Query: 119 HSTEQLQEIVQ-EENKT-WRRLYDPNDPNTNRT-ITVEEITKMADGSNISPENVVEQIKK 175
           +    L  +   +E    WR      +P  +R  I   +I   +  S    +N++E ++ 
Sbjct: 126 YYKFDLANLTHLKEICPEWR------NPGRSRLPIFKRDILLYSGKSEREADNILENMR- 178

Query: 176 PVRFDSDSEFATLESQLVKGFKSMPPQLT 204
                        ES ++KGF +   QLT
Sbjct: 179 -------------ESNILKGFSA---QLT 191


>gi|48697279|ref|YP_025046.1| hypothetical protein phiAT3gORF19 [Lactobacillus phage phiAT3]
 gi|47607170|gb|AAT36506.1| unknown [Lactobacillus phage phiAT3]
          Length = 166

 Score = 49.2 bits (116), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 21/137 (15%), Positives = 43/137 (31%), Gaps = 21/137 (15%)

Query: 37  KIQQFIYLTHCDV--------------VLQKKKS--MLDEEPQAWKQGPVFVGVYHRFKY 80
           K+Q+ +Y                      Q      +   E +AWK GPV   VY + K 
Sbjct: 28  KVQKSLYFLWAYYSGTYGNVDKSEETDFGQTNYPANLFKPEFEAWKYGPVDDKVYAKQK- 86

Query: 81  FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD 140
              +   +               E+   +  + ++    +   L      E+++W + + 
Sbjct: 87  ---NGFYLKDKWKEYQPKNSEEVEVVSFINDLLSQINKVNDFGLVNRSH-EDESWSKPFK 142

Query: 141 PNDPNTNRTITVEEITK 157
                 +  +  +EI K
Sbjct: 143 RAHGEPHAHMDPDEIRK 159


>gi|331685794|ref|ZP_08386375.1| conserved hypothetical protein [Escherichia coli H299]
 gi|331076991|gb|EGI48208.1| conserved hypothetical protein [Escherichia coli H299]
          Length = 190

 Score = 49.2 bits (116), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 18/155 (11%), Positives = 48/155 (30%), Gaps = 38/155 (24%)

Query: 17  AVANFFIDK--------GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQG 68
            +A + + K         +   + + + K            +L+  + + ++   + K G
Sbjct: 9   QMAAYLLLKRGGRMAYLKLMKLLYLSNRK-----------SILKHGRMIGEDSLYSMKFG 57

Query: 69  PVFVGVYHRFK-------YFDSHPIEVIM-------DLSFRIFPKIANQ---EIGEIMES 111
           PV     +  +        +  + IE          D       ++ ++       I++ 
Sbjct: 58  PVMSNTLNLIRGKAEGIGDYWYNLIETNGHDVLLRSDPREMDADEVFDELSRADIRILDE 117

Query: 112 IWNKYQSHSTEQLQEIVQEENKT--WRRLYDPNDP 144
           I++ Y   +   L  +   E+    W    +   P
Sbjct: 118 IYSLYGHMNRFDLANMTHLESVCPEWHNPGNSRKP 152


>gi|297617508|ref|YP_003702667.1| XRE family transcriptional regulator [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297145345|gb|ADI02102.1| transcriptional regulator, XRE family [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 314

 Score = 49.2 bits (116), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 45/122 (36%), Gaps = 15/122 (12%)

Query: 30  SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP------VFVGVYHRFKYFDS 83
             P+    + + ++ +      +   S+      A   GP      V +G+    + F +
Sbjct: 180 DNPLSKTALMKHLWFSDFRCFRETSTSISGALYAALPHGPALHKWEVLLGIAQD-RGFVN 238

Query: 84  HPIEVIMDLSFRIF-------PKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
             +E + +    +          +      EIM  + +++Q  S  +L EI  +E + W+
Sbjct: 239 IEVEYLGEFEVEMVRAAREFDGSVFTPTEIEIMGEVKSEFQGLSARELSEISHKE-EAWK 297

Query: 137 RL 138
           + 
Sbjct: 298 KT 299


>gi|146301357|ref|YP_001195948.1| hypothetical protein Fjoh_3615 [Flavobacterium johnsoniae UW101]
 gi|146155775|gb|ABQ06629.1| hypothetical protein Fjoh_3615 [Flavobacterium johnsoniae UW101]
          Length = 170

 Score = 49.2 bits (116), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 12/106 (11%), Positives = 32/106 (30%), Gaps = 21/106 (19%)

Query: 40  QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV--------------FVGVYHRFKYFDSHP 85
           + +Y      +L+  + +  +     + GPV                 V  ++  F+  P
Sbjct: 32  KILYFADQKHLLKYGRPIFGDTYVKMQYGPVPSFVKNVVDEEIEGLEEVVAKYHRFNLQP 91

Query: 86  IEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
           +               +Q   E +     + ++ S  +L     ++
Sbjct: 92  LT-------EANLDYLSQSDLECLRESIEENKNLSFIELTNKSHDD 130


>gi|332667375|ref|YP_004450163.1| XRE family transcriptional regulator [Haliscomenobacter hydrossis
           DSM 1100]
 gi|332336189|gb|AEE53290.1| transcriptional regulator, XRE family [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 323

 Score = 49.2 bits (116), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/136 (13%), Positives = 47/136 (34%), Gaps = 24/136 (17%)

Query: 33  IDHLKIQ--QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIM 90
           +   K Q  + ++        +  +S+   + +A + GPV    +     F  +   VI+
Sbjct: 185 LSPFKTQMNKLLFYADFHHFRKHGRSISGAKYRAIEMGPV-PNNFDAIFQFAENEGFVIL 243

Query: 91  DLSFRIFP---------------KIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
           D                          +   E ++ +  ++++  ++ + ++  EEN  W
Sbjct: 244 DHHEFPNGAIGTKFFPNPAAKIEDYLTELELESLKEVLERFRNVKSQDIIQLSHEEN-AW 302

Query: 136 RRLYDPNDPNTNRTIT 151
                 N+  T   I+
Sbjct: 303 -----VNNAGTRSIIS 313


>gi|308277049|gb|ADO26948.1| Hypothetical protein CpI19_1694 [Corynebacterium
          pseudotuberculosis I19]
          Length = 77

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 21/62 (33%)

Query: 34 DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLS 93
            +K+Q+ ++          K+ +L +    W  G V    +  F  F    I+      
Sbjct: 4  STMKLQKLLHFVASRYQKIAKQPLLGKVTSTWDYGEVVYSAWGEFCSFSKGNIKRYARDD 63

Query: 94 FR 95
           R
Sbjct: 64 AR 65


>gi|302206804|gb|ADL11146.1| Hypothetical protein CpC231_1685 [Corynebacterium
          pseudotuberculosis C231]
          Length = 82

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 21/62 (33%)

Query: 34 DHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLS 93
            +K+Q+ ++          K+ +L +    W  G V    +  F  F    I+      
Sbjct: 9  STMKLQKLLHFVASRYQKIAKQPLLGKVTSTWDYGEVVYSAWGEFCSFSKGNIKRYARDD 68

Query: 94 FR 95
           R
Sbjct: 69 AR 70


>gi|320537552|ref|ZP_08037492.1| hypothetical protein HMPREF9554_02244 [Treponema phagedenis
          F0421]
 gi|320145600|gb|EFW37276.1| hypothetical protein HMPREF9554_02244 [Treponema phagedenis
          F0421]
          Length = 50

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/42 (21%), Positives = 20/42 (47%)

Query: 13 YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK 54
          Y    +A F ++   + +  + +LK+Q+ +Y  H  V    +
Sbjct: 3  YKAKDIAQFVVNYAAEKNKNVTNLKLQKMLYFLHSFVFTIHQ 44


>gi|225621476|ref|YP_002722735.1| hypothetical protein BHWA1_02578 [Brachyspira hyodysenteriae WA1]
 gi|225216297|gb|ACN85031.1| hypothetical protein BHWA1_02578 [Brachyspira hyodysenteriae WA1]
          Length = 177

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/138 (14%), Positives = 54/138 (39%), Gaps = 18/138 (13%)

Query: 9   TNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQG 68
            N  Y T  + ++ I+        +  +K+ + ++ + CD+ ++K K++ +++    + G
Sbjct: 7   ENKKYET--IVHYIINSCD-DIRKLGSIKLNKILFYSDCDMFIRKNKTITNDKYIKRQYG 63

Query: 69  PVFVGVYHRFKYF-DSHPIEVIMDLSFRIFPKIA-----NQEIGEIME----SIWNKY-- 116
           PV   +            I +      R++         +    +I+     SI   Y  
Sbjct: 64  PVPKKILTILSNLEKKKKISIRKPSQNRLYDTTLYFSLTDDMDLDILTAEEVSILEHYLK 123

Query: 117 ---QSHSTEQLQEIVQEE 131
               +++ +++ EI  + 
Sbjct: 124 IISNNYTAKEISEISHDR 141


>gi|309704461|emb|CBJ03810.1| hypothetical phage protein [Escherichia coli ETEC H10407]
          Length = 181

 Score = 48.4 bits (114), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/153 (11%), Positives = 48/153 (31%), Gaps = 38/153 (24%)

Query: 19  ANFFIDK--------GVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
           A + + K         +   + + + +            +L+  + + ++   + K GPV
Sbjct: 2   AAYLLLKRGGRMAYLKLMKLLYLSNRQ-----------SILKHGRMIGEDSLYSMKFGPV 50

Query: 71  FVGVYHRFK-------YFDSHPIEVIM-------DLSFRIFPKIANQ---EIGEIMESIW 113
                +  +        +  + IE          D       ++ ++       I++ I+
Sbjct: 51  MSNTLNLIRGKAEGIGDYWYNLIETNGHNVSLRSDPREMDADEVFDELSRADIRILDEIY 110

Query: 114 NKYQSHSTEQLQEIVQEENKT--WRRLYDPNDP 144
           ++Y   +   L  +   E+    W    +   P
Sbjct: 111 SRYGHMNRFDLANMTHLESVCPEWHDPGNSRKP 143


>gi|302331358|gb|ADL21552.1| Hypothetical protein Cp1002_1685 [Corynebacterium
          pseudotuberculosis 1002]
          Length = 72

 Score = 48.1 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/60 (18%), Positives = 21/60 (35%)

Query: 36 LKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFR 95
          +K+Q+ ++          K+ +L +    W  G V    +  F  F    I+       R
Sbjct: 1  MKLQKLLHFVASRYQKIAKQPLLGKVTSTWDYGEVVYSAWGEFCSFSKGNIKRYARDDAR 60


>gi|126651034|ref|ZP_01723245.1| hypothetical protein BB14905_20305 [Bacillus sp. B14905]
 gi|126592235|gb|EAZ86284.1| hypothetical protein BB14905_20305 [Bacillus sp. B14905]
          Length = 128

 Score = 48.1 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/89 (15%), Positives = 32/89 (35%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           YS   +A++ I +  +  + +++  IQ  + L           S   E+  A   G    
Sbjct: 5   YSAQNIASYLIYELNEGHVFVNNQSIQHILTLVEHKWQQIFGHSAYQEQVCADDIGYTIK 64

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIA 101
            VY  ++ +    I++     +  +    
Sbjct: 65  EVYETYEKYGVSHIQLPATEFYLKYGTFQ 93


>gi|313205461|ref|YP_004044118.1| helix-turN-helix domain protein [Paludibacter propionicigenes WB4]
 gi|312444777|gb|ADQ81133.1| helix-turn-helix domain protein [Paludibacter propionicigenes WB4]
          Length = 266

 Score = 48.1 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 37/127 (29%), Gaps = 14/127 (11%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV----FVGVYH 76
           + ++K       +    + + +Y +  +     ++ +   + +    GPV       ++ 
Sbjct: 109 YILEKC-AGKPNVGETVLYKLLYFSDFNYYELYEEHLTGAKYRKLPYGPVPQKLESIIHQ 167

Query: 77  --------RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
                   RFK       +       +           EI++ +  +    S   +    
Sbjct: 168 MIEQDKIKRFKSEYHGFPQTRYIPLVKADLTNLKASEKEIIDRVIEQMSDWSASAISNYS 227

Query: 129 QEENKTW 135
            + +  W
Sbjct: 228 HK-DMPW 233


>gi|328957230|ref|YP_004374616.1| hypothetical protein CAR_c09070 [Carnobacterium sp. 17-4]
 gi|328673554|gb|AEB29600.1| hypothetical protein CAR_c09070 [Carnobacterium sp. 17-4]
          Length = 188

 Score = 47.7 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/101 (16%), Positives = 43/101 (42%), Gaps = 9/101 (8%)

Query: 36  LKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFR 95
           +K+Q++++  +      + KS   +  + ++ GPVF  VY  +  +     E  +D++  
Sbjct: 1   MKLQKYLFF-YELFSKVEGKSYSLDYLKGYENGPVFSEVYGDY-TYRIDEFEPNVDVNGN 58

Query: 96  IFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
           +  +    +    +  I       + ++L  +  E N  W+
Sbjct: 59  LEIEKDIAQKASFLAQI------LTKKELSNLTHEMN-IWK 92


>gi|71893366|ref|YP_278812.1| hypothetical protein MHJ_0007 [Mycoplasma hyopneumoniae J]
          Length = 214

 Score = 47.7 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/88 (14%), Positives = 30/88 (34%), Gaps = 7/88 (7%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR-------FKYFDSHPIEVIM 90
           +Q+ ++ TH       +     E  Q++K GP+   V          FK    +  E++ 
Sbjct: 56  VQKILWFTHWKFYRMYQIPFFSENFQSYKYGPISWTVLQTQFFGIESFKNSQYNIDEILD 115

Query: 91  DLSFRIFPKIANQEIGEIMESIWNKYQS 118
                +  +  N+   + +      +  
Sbjct: 116 FHQNNLVDEFKNRLKEDFLNDFNEDFGE 143


>gi|72080349|ref|YP_287407.1| hypothetical protein MHP7448_0007 [Mycoplasma hyopneumoniae 7448]
          Length = 214

 Score = 47.7 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/88 (14%), Positives = 30/88 (34%), Gaps = 7/88 (7%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR-------FKYFDSHPIEVIM 90
           +Q+ ++ TH       +     E  Q++K GP+   V          FK    +  E++ 
Sbjct: 56  VQKILWFTHWKFYRMYQIPFFSENFQSYKYGPISWTVLQTQFFGIESFKNSQYNIDEILD 115

Query: 91  DLSFRIFPKIANQEIGEIMESIWNKYQS 118
                +  +  N+   + +      +  
Sbjct: 116 FHQNNLVDEFKNRLKEDFLNDFNEDFGE 143


>gi|222149380|ref|YP_002550337.1| hypothetical protein Avi_9916 [Agrobacterium vitis S4]
 gi|221737238|gb|ACM38201.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 203

 Score = 47.7 bits (112), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/138 (11%), Positives = 41/138 (29%), Gaps = 21/138 (15%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH---- 76
           + I    + S       + + ++L     + +  + +  +   A K GPV    Y+    
Sbjct: 34  YVIFTAQRKSKKPTQYDVVKSLFLADRTHLNKYGRLVSSDRYVAMKHGPVPSTAYNVLKN 93

Query: 77  ---RFKYFDSHPIE-----------VIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTE 122
                K ++   +               D       ++ +      +E   +   S S  
Sbjct: 94  DGPTLKRYELDHLPWNSEAGDGGKIYYSDPDISSVDEVLSPSDKVAIEDAVSTVLSLSFG 153

Query: 123 QLQEIVQEENK---TWRR 137
           Q++ +  ++      W  
Sbjct: 154 QIRRLTHDDPAYIDAWED 171


>gi|144227421|gb|AAZ44101.2| hypothetical protein MHJ_0007 [Mycoplasma hyopneumoniae J]
          Length = 189

 Score = 47.3 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/88 (14%), Positives = 30/88 (34%), Gaps = 7/88 (7%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR-------FKYFDSHPIEVIM 90
           +Q+ ++ TH       +     E  Q++K GP+   V          FK    +  E++ 
Sbjct: 31  VQKILWFTHWKFYRMYQIPFFSENFQSYKYGPISWTVLQTQFFGIESFKNSQYNIDEILD 90

Query: 91  DLSFRIFPKIANQEIGEIMESIWNKYQS 118
                +  +  N+   + +      +  
Sbjct: 91  FHQNNLVDEFKNRLKEDFLNDFNEDFGE 118


>gi|54019976|ref|YP_115522.1| hypothetical protein mhp007 [Mycoplasma hyopneumoniae 232]
 gi|53987149|gb|AAV27350.1| hypothetical protein mhp007 [Mycoplasma hyopneumoniae 232]
 gi|312600980|gb|ADQ90235.1| Putative uncharacterized protein [Mycoplasma hyopneumoniae 168]
          Length = 189

 Score = 47.3 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/88 (14%), Positives = 30/88 (34%), Gaps = 7/88 (7%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR-------FKYFDSHPIEVIM 90
           +Q+ ++ TH       +     E  Q++K GP+   V          FK    +  E++ 
Sbjct: 31  VQKILWFTHWKFYRMYQIPFFSENFQSYKYGPISWTVLQTQFFGIESFKNSQYNIDEILD 90

Query: 91  DLSFRIFPKIANQEIGEIMESIWNKYQS 118
                +  +  N+   + +      +  
Sbjct: 91  FHQNNLVDEFKNRLKEDFLNDFNEDFGE 118


>gi|144575234|gb|AAZ53384.2| hypothetical protein MHP7448_0007 [Mycoplasma hyopneumoniae 7448]
          Length = 189

 Score = 47.3 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/88 (14%), Positives = 30/88 (34%), Gaps = 7/88 (7%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR-------FKYFDSHPIEVIM 90
           +Q+ ++ TH       +     E  Q++K GP+   V          FK    +  E++ 
Sbjct: 31  VQKILWFTHWKFYRMYQIPFFSENFQSYKYGPISWTVLQTQFFGIESFKNSQYNIDEILD 90

Query: 91  DLSFRIFPKIANQEIGEIMESIWNKYQS 118
                +  +  N+   + +      +  
Sbjct: 91  FHQNNLVDEFKNRLKEDFLNDFNEDFGE 118


>gi|110597223|ref|ZP_01385511.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
 gi|110341059|gb|EAT59527.1| conserved hypothetical protein [Chlorobium ferrooxidans DSM 13031]
          Length = 182

 Score = 47.3 bits (111), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/143 (9%), Positives = 46/143 (32%), Gaps = 24/143 (16%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRI 96
           K+ + +Y      + +   ++ +++  A   GPV    Y   K      +       F  
Sbjct: 30  KVFKILYFADQKHLARYGSAITEDKYIAMTYGPVPSMAYDIVKSIRGDGLMATFQDQFTP 89

Query: 97  FPKI----------------ANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD 140
           + ++                 ++     +    ++ +  + ++  +     +  W     
Sbjct: 90  YFELVGKYSIRAKINPDLDYLSESEMLCLNESVSESEQLTFQKRTDKSH--DSAWHNA-- 145

Query: 141 PNDPNTNRTITVEEITKMADGSN 163
               + N  +++ +I K+   +N
Sbjct: 146 ----DENGEMSLMDIAKVGGANN 164


>gi|160890736|ref|ZP_02071739.1| hypothetical protein BACUNI_03181 [Bacteroides uniformis ATCC
          8492]
 gi|237708246|ref|ZP_04538727.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|156859735|gb|EDO53166.1| hypothetical protein BACUNI_03181 [Bacteroides uniformis ATCC
          8492]
 gi|229457799|gb|EEO63520.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
          Length = 190

 Score = 46.9 bits (110), Expect = 0.003,   Method: Composition-based stats.
 Identities = 10/50 (20%), Positives = 21/50 (42%), Gaps = 3/50 (6%)

Query: 21 FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV 70
          + + K  +    I   K+ + IY    + ++   K +  +  +A   GPV
Sbjct: 16 YVLRKFPEGVDYI---KLFKIIYFAQKEYLVNYGKVLCPDTFKARTFGPV 62


>gi|169826429|ref|YP_001696587.1| hypothetical protein Bsph_0841 [Lysinibacillus sphaericus C3-41]
 gi|168990917|gb|ACA38457.1| hypothetical protein Bsph_0841 [Lysinibacillus sphaericus C3-41]
          Length = 142

 Score = 46.5 bits (109), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 32/89 (35%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
           YS   +A++ I +  +  + +++  IQ  + L           S   E+      G +  
Sbjct: 19  YSAQNIASYLIYELNEGHVFVNNQSIQHILTLVERKWQQIFGHSAYQEQVCTDDNGFMVK 78

Query: 73  GVYHRFKYFDSHPIEVIMDLSFRIFPKIA 101
            VY  ++ +    I++     +  +    
Sbjct: 79  EVYEIYEKYGVSHIQLPATEFYLKYGTFQ 107


>gi|226377680|ref|YP_002790729.1| hypothetical protein lb338_phage_50 [Lactobacillus phage Lb338-1]
 gi|225921458|gb|ACO36971.1| hypothetical protein lb338_phage_50 [Lactobacillus phage Lb338-1]
          Length = 160

 Score = 46.5 bits (109), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/141 (12%), Positives = 35/141 (24%), Gaps = 27/141 (19%)

Query: 20  NFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK----------------KSMLDEEPQ 63
           N  +            LK+Q+ +Y                           +S+     +
Sbjct: 11  NVLVFHIYSSLDNPTMLKVQKSLYFLWAYYAGTYGSLLSKGGLDISKEDYPESLFKGNFK 70

Query: 64  AWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHST-- 121
           A   GPV   V  + K       +                   E+M  + +     +   
Sbjct: 71  ALMYGPVDTDVLKKQKENFYSKDKWKG-------YTPKGSSEIEVMGFVNDLLGQINAVN 123

Query: 122 -EQLQEIVQEENKTWRRLYDP 141
              L      E+  W++ Y+ 
Sbjct: 124 DFGLINRCH-EDNCWKQAYEN 143


>gi|160914791|ref|ZP_02077005.1| hypothetical protein EUBDOL_00798 [Eubacterium dolichum DSM 3991]
 gi|158433331|gb|EDP11620.1| hypothetical protein EUBDOL_00798 [Eubacterium dolichum DSM 3991]
          Length = 98

 Score = 45.7 bits (107), Expect = 0.008,   Method: Composition-based stats.
 Identities = 9/84 (10%), Positives = 28/84 (33%), Gaps = 16/84 (19%)

Query: 8  QTNPPYSTIAVANFFIDKGVKY---SIPID----------HLKIQQFIYLTHCDVVLQKK 54
               Y  + +A +F+   V     +  +           ++++ +F++      + +  
Sbjct: 1  MNTMTYKALDIAKWFLLNDVDKTLFNKELTSKNGITFCEENVRLNKFLFFVQNIHIAKYG 60

Query: 55 KSMLDEEPQAWKQGPVFVGVYHRF 78
             ++E    +  G V   V   +
Sbjct: 61 ---INERFYEYDDGAVVEEVRTNY 81


>gi|284039708|ref|YP_003389638.1| XRE family transcriptional regulator [Spirosoma linguale DSM 74]
 gi|283819001|gb|ADB40839.1| transcriptional regulator, XRE family [Spirosoma linguale DSM 74]
          Length = 333

 Score = 45.4 bits (106), Expect = 0.009,   Method: Composition-based stats.
 Identities = 14/118 (11%), Positives = 35/118 (29%), Gaps = 21/118 (17%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRI 96
           K+ + ++        + + S+     +A + GPV    Y              +      
Sbjct: 201 KLNKLMFYADFLCFKRHQMSISGATYRAIQLGPV-PNNYDALYAHGVKEDLYRVHYEEFD 259

Query: 97  F---------------PKIANQEIGEIMESIWNKYQSHST--EQLQEIVQEENKTWRR 137
                            ++ + E   ++E +  ++  +S     +  I  EE + W  
Sbjct: 260 NRIGEQYCSCEHVAFRNELFSNEELAVLEEVVKRF--YSARTSDIVGISHEE-RAWTD 314


>gi|110639844|ref|YP_680054.1| hypothetical protein CHU_3477 [Cytophaga hutchinsonii ATCC 33406]
 gi|110282525|gb|ABG60711.1| hypothetical protein CHU_3477 [Cytophaga hutchinsonii ATCC 33406]
          Length = 176

 Score = 45.0 bits (105), Expect = 0.012,   Method: Composition-based stats.
 Identities = 20/115 (17%), Positives = 39/115 (33%), Gaps = 11/115 (9%)

Query: 36  LKIQQFIYLTHCDVVLQKKKSMLD--EEPQAWKQGPVFVGVYH-----RFKYFDSHPIEV 88
           LK+ +  +        ++   +L+  ++  A   G V   VY       F    S+   +
Sbjct: 37  LKVLKLNFFAAAVNANKENNGLLNIFDKFHAMPYGHVESEVYENLNNLNFFSVSSNKTTI 96

Query: 89  IMDLSFRIFPKIANQEI---GEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD 140
             +  F    +    EI    E ++   N    +S   L E+       WR  ++
Sbjct: 97  NNNPDFEKLKQETRSEINFAIESLKKENNNLIKYSAMDLVELSHTYFS-WRASFN 150


>gi|284103426|ref|ZP_06386091.1| conserved hypothetical protein [Candidatus Poribacteria sp. WGA-A3]
 gi|283830260|gb|EFC34502.1| conserved hypothetical protein [Candidatus Poribacteria sp. WGA-A3]
          Length = 255

 Score = 44.6 bits (104), Expect = 0.018,   Method: Composition-based stats.
 Identities = 11/119 (9%), Positives = 37/119 (31%), Gaps = 21/119 (17%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV----------------FVGVYHRFKYF 81
           + + +Y    D   + +++++         GP                   GV  ++  +
Sbjct: 117 LHKLLYFIDFDYYEKFEENLMGATYIKNHHGPTSVELGKILQDMQKHGEIEGVNSQYFKY 176

Query: 82  DSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD 140
                  +   +  I     +    E ++ +  +    + ++++     E+  W+   D
Sbjct: 177 GQKKYLPLKRPNLAI----LSARDVEHIDGVLARLSDKNAKEIELYSH-EDIPWKSAQD 230


>gi|261417070|ref|YP_003250753.1| hypothetical protein Fisuc_2688 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373526|gb|ACX76271.1| hypothetical protein Fisuc_2688 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302325507|gb|ADL24708.1| conserved domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 101

 Score = 43.8 bits (102), Expect = 0.028,   Method: Composition-based stats.
 Identities = 12/66 (18%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 97  FPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYD--PNDPNTNRTITVEE 154
            P+ +  E+  + +S++++Y   S+  L ++   E   W+        D   N  +++++
Sbjct: 13  LPENSITELKPVFDSVFSRYAGRSSWSLSDLTHGETS-WQNARKGLARDAAGNVPMSIDD 71

Query: 155 ITKMAD 160
           I   A+
Sbjct: 72  IRHDAE 77


>gi|222530461|ref|YP_002574343.1| XRE family transcriptional regulator [Caldicellulosiruptor bescii
           DSM 6725]
 gi|222457308|gb|ACM61570.1| transcriptional regulator, XRE family [Caldicellulosiruptor bescii
           DSM 6725]
          Length = 333

 Score = 43.8 bits (102), Expect = 0.028,   Method: Composition-based stats.
 Identities = 11/107 (10%), Positives = 38/107 (35%), Gaps = 13/107 (12%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG-VYHRFKYFDSH------------ 84
           + + ++         + +S+       +  GPV     Y+    + S             
Sbjct: 205 LNKILWYIDFLHFKYRLRSVTGLRYIKYTYGPVIENFAYNEIIAYPSDKYTVEQYEMPDG 264

Query: 85  PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
            I+ ++  +      + +++   I++ + N  +  +  ++ E+  +E
Sbjct: 265 AIQTVIKSTGNYDLSVFDEKELAIIDKVINLLKDKTCREISEMSHKE 311


>gi|296126965|ref|YP_003634217.1| hypothetical protein Bmur_1940 [Brachyspira murdochii DSM 12563]
 gi|296018781|gb|ADG72018.1| conserved hypothetical protein [Brachyspira murdochii DSM 12563]
          Length = 184

 Score = 43.8 bits (102), Expect = 0.028,   Method: Composition-based stats.
 Identities = 25/158 (15%), Positives = 58/158 (36%), Gaps = 29/158 (18%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV---FVGVYHR 77
           + IDK  K    +  +K+ + +  T   ++ +  K++ ++     + GPV    + + + 
Sbjct: 27  YIIDKC-KNPYKLGSIKLNKILLFTDGILLRKTGKTLTEDTYIKRQFGPVPKNILKILNI 85

Query: 78  FKYFDSHPIEV------------IMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
            K  ++  I              + + +      I    +      I+N ++    +++ 
Sbjct: 86  LKNDNAIAIREGEKNNDARLFFSLKEPNISNLSSIEIDALYTFTMHIYNNFK---AKEIS 142

Query: 126 EIVQEENKTWR--------RLYDPNDPNTNRTITVEEI 155
           +I  +  K W          LY P   +    IT E+I
Sbjct: 143 DISYQ-FKIWDFLNIGDEVDLY-PYFISEEAEITKEDI 178


>gi|253566202|ref|ZP_04843656.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|251945306|gb|EES85744.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
          Length = 174

 Score = 43.4 bits (101), Expect = 0.038,   Method: Composition-based stats.
 Identities = 19/144 (13%), Positives = 48/144 (33%), Gaps = 16/144 (11%)

Query: 24  DKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSM-LDEEPQAWKQGPVFVGVYHRFKYFD 82
           ++G +    +  L   + ++L            + +  +  A   GPV   +Y+  +  +
Sbjct: 26  NRGFENCSKLSML---KLLFLAAAPKGEGTGDLLNIFNKFFALPYGPVESDIYNAIQGNN 82

Query: 83  SHPIEVIMDLSFRIFPKIANQEIGEIME--------SIWNKYQS-HSTEQLQEIVQEENK 133
                +      +         I + ++         + NK+    +   L +I  +   
Sbjct: 83  LPSYTITERSITKKVIDTLPYRIEDYVKVEEAVNALKVKNKHLILLNAFDLVDITHKWES 142

Query: 134 TWRRLYDPND--PNTNRTITVEEI 155
            W++  D       ++  +TVE I
Sbjct: 143 -WKQSIDFAKLMEMSSYKMTVESI 165


>gi|119873420|ref|YP_931427.1| hypothetical protein Pisl_1937 [Pyrobaculum islandicum DSM 4184]
 gi|119674828|gb|ABL89084.1| hypothetical protein Pisl_1937 [Pyrobaculum islandicum DSM 4184]
          Length = 185

 Score = 43.4 bits (101), Expect = 0.043,   Method: Composition-based stats.
 Identities = 13/136 (9%), Positives = 35/136 (25%), Gaps = 47/136 (34%)

Query: 37  KIQQFIYLTHCD--------VVLQKKKSMLDEEPQAWKQGPVFVGV-----------YHR 77
           K+Q+ ++L             +              W  GP    V           Y  
Sbjct: 27  KVQKLMFLVEHWDGGRGVSKSLGLTGYR-----FVVWLYGPYSPQVDEDLEWLVEEGYIS 81

Query: 78  FKYFDSHPI-EVIMDLSFRIFPKIANQEIGEIM----------------------ESIWN 114
            + +       V+ D          + E  +++                      +++ +
Sbjct: 82  ERVYGYDSYHSVVADGEVVRLGFYDDDESPKVIYVYRPTLRARFVRIGEPLRARIDAVVD 141

Query: 115 KYQSHSTEQLQEIVQE 130
           K+  ++  +L+ +   
Sbjct: 142 KFGRYTANELETLTTA 157


>gi|150388702|ref|YP_001318751.1| hypothetical protein Amet_0867 [Alkaliphilus metalliredigens QYMF]
 gi|149948564|gb|ABR47092.1| hypothetical protein Amet_0867 [Alkaliphilus metalliredigens QYMF]
          Length = 338

 Score = 43.4 bits (101), Expect = 0.045,   Method: Composition-based stats.
 Identities = 17/135 (12%), Positives = 41/135 (30%), Gaps = 17/135 (12%)

Query: 22  FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY- 80
            I+        I  +K+ + ++        +  K++      A   G      Y      
Sbjct: 198 MINYLASKVSSIHKVKLMKMLWYADMLHFKRTGKAIGGLVYGALPMG-AVPKGYEAIVSL 256

Query: 81  ---------FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
                    +  H I            K   +   E ++ I +K+   +T+++ +++ +E
Sbjct: 257 EGVQYDTVLYGEH-IGYKFKPVPGFEIKKLIKSEIETLDEIISKFGHLNTDEIVDMMHDE 315

Query: 132 NKTWRRLYDPNDPNT 146
                  Y   + N 
Sbjct: 316 -----EAYKCTEGNC 325


>gi|160881609|ref|YP_001560577.1| hypothetical protein Cphy_3487 [Clostridium phytofermentans ISDg]
 gi|160430275|gb|ABX43838.1| hypothetical protein Cphy_3487 [Clostridium phytofermentans ISDg]
          Length = 274

 Score = 43.0 bits (100), Expect = 0.047,   Method: Composition-based stats.
 Identities = 12/104 (11%), Positives = 36/104 (34%), Gaps = 19/104 (18%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQA----WKQGPVFVGVYH 76
           + I++       I+  +IQ  ++ +    ++   + + +E+ Q            + +Y 
Sbjct: 110 YIINQANAE---INARQIQYILFYSQILSLVFLGEEIFEEDAQLTYNQMPY----LNLYE 162

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
             K      I         + P   ++   +I++ + N    + 
Sbjct: 163 ALKKQGIRTI--------EMNPDKLSRNDKDIIDCVHNACGWYG 198


>gi|18312390|ref|NP_559057.1| hypothetical protein PAE1074 [Pyrobaculum aerophilum str. IM2]
 gi|18159843|gb|AAL63239.1| hypothetical protein PAE1074 [Pyrobaculum aerophilum str. IM2]
          Length = 184

 Score = 42.7 bits (99), Expect = 0.069,   Method: Composition-based stats.
 Identities = 17/134 (12%), Positives = 46/134 (34%), Gaps = 26/134 (19%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDV-----------VLQKKKSMLDEE 61
           Y    V  + + +  + +      K+ + ++L   +             L + + +   E
Sbjct: 3   YRVEDVVYYVVKRLGEVNGI---KKLMKLVFLLQYEARPRLGRRIVVKYLYEGQPVARSE 59

Query: 62  PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEI---------MESI 112
              W  GP+   VY   +  ++   E +++ S   + KI  +              ++ +
Sbjct: 60  FYIWSFGPMSNEVYDAVEALEN---EGLLETSLGDYIKIITKGEKAFELPPPVARRVDEV 116

Query: 113 WNKYQSHSTEQLQE 126
             +Y      +L++
Sbjct: 117 AERYGRCRGWELEK 130


>gi|153865266|ref|ZP_01997832.1| conserved hypothetical protein [Beggiatoa sp. SS]
 gi|152145256|gb|EDN72167.1| conserved hypothetical protein [Beggiatoa sp. SS]
          Length = 79

 Score = 42.7 bits (99), Expect = 0.071,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 29/73 (39%), Gaps = 5/73 (6%)

Query: 97  FPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLY--DPNDPNTNRTITVEE 154
            P   N E  E +  +   Y    ++ L ++   E   WR      PN+   +R IT   
Sbjct: 7   NPDRLNDEQRETVLVVLKDYGDKPSQCLSDLTHLE-APWREARIGLPNNERGHREITHLA 65

Query: 155 ITKMADGSNISPE 167
           + +  +  N+ PE
Sbjct: 66  MAEYYE--NLCPE 76


>gi|160902673|ref|YP_001568254.1| helix-turn-helix domain-containing protein [Petrotoga mobilis SJ95]
 gi|160360317|gb|ABX31931.1| helix-turn-helix domain protein [Petrotoga mobilis SJ95]
          Length = 339

 Score = 42.7 bits (99), Expect = 0.072,   Method: Composition-based stats.
 Identities = 15/110 (13%), Positives = 37/110 (33%), Gaps = 18/110 (16%)

Query: 40  QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG--------VYHRFK--------YFDS 83
           + ++L   +      + + + +   +  GP+  G        + +  K         F  
Sbjct: 216 KLLWLVEKESKKSLGRQIANLKFIHYNYGPIPKGAKNEEGVLLDYLIKTNLIRMNIDFSK 275

Query: 84  HPIEVIMDLS--FRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
             ++    +    +   +    E  +I+E I  KY   S  +L E+   +
Sbjct: 276 KFLQETYKIGLVDQTPLRNLTDEERKIVEKIVKKYGGLSASELVEVSHND 325


>gi|304316397|ref|YP_003851542.1| hypothetical protein Tthe_0922 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777899|gb|ADL68458.1| conserved hypothetical protein [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 184

 Score = 42.7 bits (99), Expect = 0.077,   Method: Composition-based stats.
 Identities = 27/184 (14%), Positives = 54/184 (29%), Gaps = 30/184 (16%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRF-- 78
             I +  KY   +    + + IY+      +         +   +  GP    +      
Sbjct: 14  HIIKETEKYEYRLGRTALVKLIYILQEKFNVPIGY-----DFSLYTYGPFSKEILDDLDY 68

Query: 79  -------------KYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
                        + ++  P E               +E  + +  +  ++   S + L+
Sbjct: 69  LSYLDAAKIKMNNERYNILPGEDSAMEYIYEKAGQFIEENKDTISDVVKEFGQLSAKSLE 128

Query: 126 EIVQEENKTWRRLYDPNDPNTNRT-ITVEEITKMADGSNISPENVVEQIKKPVRFDSDSE 184
            I           Y  ND   +    T E+I+K+     I P    ++I K +     S 
Sbjct: 129 LITTIH-------YVINDYKESNINFTKEDISKLI--HEIKPYFSEDEIIKKIDELESSN 179

Query: 185 FATL 188
           F  L
Sbjct: 180 FVKL 183


>gi|302872688|ref|YP_003841324.1| helix-turn-helix domain protein [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302575547|gb|ADL43338.1| helix-turn-helix domain protein [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 336

 Score = 42.7 bits (99), Expect = 0.077,   Method: Composition-based stats.
 Identities = 15/114 (13%), Positives = 38/114 (33%), Gaps = 14/114 (12%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG-VYHRFKYFDSH------------ 84
           + ++++        +  +S+       +  GPV  G VY+    + S             
Sbjct: 205 LNKYLWYIDFLHFKRYSRSITGLSYIRYTYGPVIKGFVYNEIATYPSDKFFVEEYETEDG 264

Query: 85  PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
            I+            +  QE  + +  + N  +  +   + E+  +E   W++ 
Sbjct: 265 AIKTSFKSRKNYDLSLFTQEELDTINIVINFLKDKNCRTISELSHQE-LAWQQT 317


>gi|312135992|ref|YP_004003330.1| helix-turn-helix domain-containing protein [Caldicellulosiruptor
           owensensis OL]
 gi|311776043|gb|ADQ05530.1| helix-turn-helix domain protein [Caldicellulosiruptor owensensis
           OL]
          Length = 336

 Score = 42.7 bits (99), Expect = 0.078,   Method: Composition-based stats.
 Identities = 15/114 (13%), Positives = 38/114 (33%), Gaps = 14/114 (12%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG-VYHRFKYFDSH------------ 84
           + ++++        +  +S+       +  GPV  G VY+    + S             
Sbjct: 205 LNKYLWYIDFLHFKRYSRSITGLSYIRYTYGPVIKGFVYNEIATYPSDKFFVEEYETEDG 264

Query: 85  PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
            I+            +  QE  + +  + N  +  +   + E+  +E   W++ 
Sbjct: 265 AIKTSFKSRKNYDLSLFTQEELDTINIVINFLKDKNCRTISELSHQE-LAWQQT 317


>gi|307565079|ref|ZP_07627592.1| putative K+-dependent Na+/Ca+ exchanger [Prevotella amnii CRIS
           21A-A]
 gi|307346248|gb|EFN91572.1| putative K+-dependent Na+/Ca+ exchanger [Prevotella amnii CRIS
           21A-A]
          Length = 321

 Score = 42.3 bits (98), Expect = 0.088,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 47/88 (53%), Gaps = 6/88 (6%)

Query: 203 LTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLLTQIINSNV 262
           + K  QEA+  +K D A ++SI   NI+     ++  WV+++W   I+  LL  I+ SN+
Sbjct: 140 MIKTLQEAKSDVKIDKANSKSIISENIIS-EKQHKKIWVSVIW---IIVGLLCLILGSNL 195

Query: 263 FAQLCESKYIATVVSLSAIICGFWAIVG 290
           F  +  +  +A+ + +S  I G   + G
Sbjct: 196 F--VSGAVKVASSLGVSDAIIGLTIVAG 221


>gi|312878193|ref|ZP_07738121.1| helix-turn-helix domain-containing protein [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795030|gb|EFR11431.1| helix-turn-helix domain-containing protein [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 135

 Score = 42.3 bits (98), Expect = 0.090,   Method: Composition-based stats.
 Identities = 15/114 (13%), Positives = 38/114 (33%), Gaps = 14/114 (12%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVG-VYHRFKYFDSH------------ 84
           + ++++        +  + +       +  GPV  G VY+    + S             
Sbjct: 4   LNKYLWYIDFLHFKRYSRFITGLSYIRYTYGPVIKGFVYNEIATYPSDKFSGEEYKTEDG 63

Query: 85  PIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
            I+            +  QE  + + ++ N  +  S   + E+  +E   W++ 
Sbjct: 64  AIKTSFKSRRNYDLSLLTQEELDTINTVINFLKDKSCRCISELSHQE-LAWQKT 116


>gi|189499111|ref|YP_001958581.1| hypothetical protein Cphamn1_0120 [Chlorobium phaeobacteroides BS1]
 gi|189494552|gb|ACE03100.1| conserved hypothetical protein [Chlorobium phaeobacteroides BS1]
          Length = 191

 Score = 41.9 bits (97), Expect = 0.13,   Method: Composition-based stats.
 Identities = 10/106 (9%), Positives = 36/106 (33%), Gaps = 23/106 (21%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP------------------VFVGVYHRFK 79
           +++ ++       ++        + + +  GP                    + V + F 
Sbjct: 34  LEKLVFFLQEIYGIKCGY-----DFELYSYGPFDSQLLGDLDLVEHWGGVTVLRVNNSFG 88

Query: 80  YFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQ 125
            +   P E +  +  +    I +Q+  + ++ + + Y + +   L+
Sbjct: 89  GYRIQPSEKVDSIVGKAKEFIEDQKTEKALDDLVSNYGAMTARDLE 134


>gi|171185579|ref|YP_001794498.1| hypothetical protein Tneu_1121 [Thermoproteus neutrophilus V24Sta]
 gi|170934791|gb|ACB40052.1| conserved hypothetical protein [Thermoproteus neutrophilus V24Sta]
          Length = 188

 Score = 41.1 bits (95), Expect = 0.18,   Method: Composition-based stats.
 Identities = 13/136 (9%), Positives = 36/136 (26%), Gaps = 47/136 (34%)

Query: 37  KIQQFIYLTHCD--------VVLQKKKSMLDEEPQAWKQGPVFVGV-----------YHR 77
           K+Q+ ++L             +              W  GP    V           Y  
Sbjct: 30  KVQKLMFLVEHWDGGRGVSRSLGLTGY-----GFVVWLYGPYSPQVDEDLEWLVEEGYIS 84

Query: 78  FKYFDSHPI------EVIMDLSFRIFPKI-----------------ANQEIGEIMESIWN 114
            + +             ++ L F    K                    +++   ++++ +
Sbjct: 85  ERVYGYDSYHSVVADGEVVRLGFYDDDKSPKVIYVYRPTWRARFVRVEEKLRARIDAVVD 144

Query: 115 KYQSHSTEQLQEIVQE 130
           K+  ++  +L+ +   
Sbjct: 145 KFGRYTANELEILTTA 160


>gi|114567932|ref|YP_755086.1| hypothetical protein Swol_2426 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|114338867|gb|ABI69715.1| hypothetical protein Swol_2426 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 336

 Score = 41.1 bits (95), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/117 (11%), Positives = 43/117 (36%), Gaps = 8/117 (6%)

Query: 23  IDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQ-AWKQGPVFVGVYHRFKYF 81
           I   +K   P+    + + ++        + ++  L          GPV +   + +   
Sbjct: 197 ILFFLKSGDPVYETGMNKLLWYVDMLCYKRSQRQALTGLCYKHNIYGPVPLWYSYLYGSL 256

Query: 82  DSHPIEVIMDLSFRIF-------PKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
           D   I ++ D               + + +  +++E++ N ++  S +++ +   +E
Sbjct: 257 DDVYITLVEDKYGTQIGALADFSTDVFSDDELDVLETVANNFKGWSAKKISQYSHQE 313


>gi|257877357|ref|ZP_05657010.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
 gi|257811523|gb|EEV40343.1| conserved hypothetical protein [Enterococcus casseliflavus EC20]
          Length = 594

 Score = 40.7 bits (94), Expect = 0.24,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 17/126 (13%)

Query: 157 KMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKG---FKSMPPQLTKEFQEAQVQ 213
           ++ D +N    + + Q+ +P+RF SDSE +T ++ L K    F      L    +E  + 
Sbjct: 212 QLNDDANFY-SDTINQVGEPIRFSSDSELSTADTFLKKNDDRFLIAKSTLPMSNKEDIIT 270

Query: 214 IKKDSAIARSIQESNIMRFAYSNRSFWVTIVWI----TIIVAFLLTQIINSNVFAQLCES 269
           I      A S   +N++R        W TIV +    T I+ FL  +     + +QL ++
Sbjct: 271 IYSADTNAYSNLRANLIR--------WSTIVLVILITTFIIVFLFARFFTKRI-SQLQQA 321

Query: 270 KYIATV 275
            Y A++
Sbjct: 322 VYFASI 327


>gi|255280461|ref|ZP_05345016.1| toxin-antitoxin system, antitoxin component, Xre family [Bryantella
           formatexigens DSM 14469]
 gi|255268926|gb|EET62131.1| toxin-antitoxin system, antitoxin component, Xre family [Bryantella
           formatexigens DSM 14469]
          Length = 326

 Score = 40.7 bits (94), Expect = 0.24,   Method: Composition-based stats.
 Identities = 19/157 (12%), Positives = 46/157 (29%), Gaps = 41/157 (26%)

Query: 15  TIAVANFFIDKGVKYSIPIDHL---KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
            + V  +F       S  + +L   K+ + ++        ++  ++     QA   G V 
Sbjct: 182 AVDVMRYF-----AASAHVTNLYKVKLMKLMWYADALSYKKRGFAITGLVYQALPMGAV- 235

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPK-----------------IANQEIGEIMESIWN 114
                       + I  + D+                          ++E   I++++  
Sbjct: 236 --------PVGHNSIIDLKDVPCEEVDMGETNAYHFSLKGDVSFPFLSREDKGILDTVIE 287

Query: 115 KYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTIT 151
           K    S  ++   + +E     + Y    P     I+
Sbjct: 288 KLGKMSKNEIISFMHKE-----QAYIETMP--RNIIS 317


>gi|146173942|ref|XP_001019205.2| hypothetical protein TTHERM_00997650 [Tetrahymena thermophila]
 gi|146144816|gb|EAR98960.2| hypothetical protein TTHERM_00997650 [Tetrahymena thermophila
           SB210]
          Length = 468

 Score = 40.7 bits (94), Expect = 0.25,   Method: Composition-based stats.
 Identities = 32/140 (22%), Positives = 68/140 (48%), Gaps = 14/140 (10%)

Query: 105 IGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGSNI 164
           + EI+ +I    ++ +  + +EIVQ+    W++ ++ N P T + +  ++  K+A G N+
Sbjct: 1   MEEILSNILESKKTKTLREYEEIVQKSGMIWKKSFEYNTPITGQ-VNFDDFFKIA-GKNV 58

Query: 165 SPENVVEQIKKPVRFDSDSEFA--------TLESQLVKGFKSMPPQLTK--EFQEAQVQI 214
             + V + I K +      E+         T+  ++V+GF+ M PQ     +F E   ++
Sbjct: 59  --QKVCKFIVKCIDRGDSIEYVRSVQFFYKTVSGEIVEGFQQMHPQAPSKGKFAEKIFEL 116

Query: 215 KKDSAIARSIQESNIMRFAY 234
           + D  I + I  + +   A+
Sbjct: 117 EDDEYIIKMIGRTGLFLDAF 136


>gi|55378999|ref|YP_136849.1| hypothetical protein rrnAC2319 [Haloarcula marismortui ATCC 43049]
 gi|55231724|gb|AAV47143.1| unknown [Haloarcula marismortui ATCC 43049]
          Length = 177

 Score = 40.3 bits (93), Expect = 0.30,   Method: Composition-based stats.
 Identities = 23/173 (13%), Positives = 55/173 (31%), Gaps = 24/173 (13%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQK-KKSMLDEEPQAW 65
           +  +PP S   V   F+         +   ++Q+ IYL       +   + + + E + +
Sbjct: 12  SDKDPPVSLQEVIKAFLQ----THQFLHQYRLQKLIYLAELMYREKHEGRPLTEAEYKPY 67

Query: 66  KQGPVFVGVYHRFKYFDSHPIEVIMD----------LSFRIFPKIANQEIGEIMESIWNK 115
             G     V          P     +              I       ++ +++E + N 
Sbjct: 68  MYGAYSEDVDDTLSELRGDPEVKAENQHRYRNSKTTYKGEIEDLDIPSDVEDLVEVVTNM 127

Query: 116 YQSHSTEQLQEIVQEENKTWRR-LYDPNDPNTNRTITVEEITKMADGSNISPE 167
            +  S++ L +        W +  Y  ++ + N  +  E+         + P+
Sbjct: 128 TRRMSSDDLAQ--------WSKSTYLFDETDYNDEMEFEKYLSAIREGEVEPD 172


>gi|223935989|ref|ZP_03627903.1| conserved hypothetical protein [bacterium Ellin514]
 gi|223895211|gb|EEF61658.1| conserved hypothetical protein [bacterium Ellin514]
          Length = 198

 Score = 40.3 bits (93), Expect = 0.32,   Method: Composition-based stats.
 Identities = 11/115 (9%), Positives = 36/115 (31%), Gaps = 15/115 (13%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV--------FVGVYHRFKYFDSHPIEVI 89
           + + +Y       L+  K +   +    + GP                 +  +  P+E  
Sbjct: 47  LNKVLYYIDHVHYLKHGKKLTGFKYIKQRLGPTPKPSEFLPIRESLIDNEKINEKPVEFF 106

Query: 90  MDLSFRIFPKIANQ------EIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRL 138
             +  R+             +   +++++ +     + + + ++  EE   W+  
Sbjct: 107 GRVQKRLSALTEPDLKGFTVDEISLIDNVISALSPFNGKAISDVTHEELS-WKFA 160


>gi|330963932|gb|EGH64192.1| hypothetical protein PSYAC_04678 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 172

 Score = 40.0 bits (92), Expect = 0.47,   Method: Composition-based stats.
 Identities = 19/147 (12%), Positives = 44/147 (29%), Gaps = 23/147 (15%)

Query: 1   MKKRTFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDE 60
           M  +   Q        A   +   +    S   + LK+    YL     + +  + + D+
Sbjct: 3   MDYKAIEQKKRTLEAFA---YIAARMKAKSNIYNVLKV---FYLADKMHMERFGRFIFDD 56

Query: 61  EPQAWKQGPVFVGVYHRFKYF--DSHPIEVIMDLSF----------RIFPKIANQEIGEI 108
           +  A  +GPV    Y+           +E I                    + +    E 
Sbjct: 57  QYAALDKGPVPSKAYNMICQIQAGRRVLEDIESPVAVEGYKVVAVRDFDDDLFSDSDLEC 116

Query: 109 MESIWNKYQSHSTEQLQEIVQEENKTW 135
           ++ + +  +    + L ++    +  W
Sbjct: 117 IDEVIDISKR---KDLGKLSH--DGAW 138


>gi|288559895|ref|YP_003423381.1| hypothetical protein mru_0638 [Methanobrevibacter ruminantium M1]
 gi|288542605|gb|ADC46489.1| hypothetical protein mru_0638 [Methanobrevibacter ruminantium M1]
          Length = 165

 Score = 40.0 bits (92), Expect = 0.48,   Method: Composition-based stats.
 Identities = 15/133 (11%), Positives = 46/133 (34%), Gaps = 14/133 (10%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP-------VFVG 73
           + I K    +  +    + + +Y +  +      KS+ +E  +   +GP       V   
Sbjct: 14  YIIYKCGIKN-TVGRTVLHKLLYFSDFNYFELYNKSLTNECYRKLARGPVPVHFESVVEE 72

Query: 74  VYHRFK---YFDSHPIEVIMDLSFRIFPKIAN--QEIGEIMESIWNKYQSHSTEQLQEIV 128
           +    K        P   +M+  F +     +  ++   +++ +       + + + E  
Sbjct: 73  LIDEKKISLKNRRLPCGKLMNRYFSLEKPEIDLKEDELAVIDEVIKDLSHMNGKMIGEYS 132

Query: 129 QEENKTWRRLYDP 141
             ++   ++ +D 
Sbjct: 133 -LKDMPVKQAHDN 144


>gi|325660773|ref|ZP_08149401.1| hypothetical protein HMPREF0490_00133 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325472847|gb|EGC76057.1| hypothetical protein HMPREF0490_00133 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 643

 Score = 40.0 bits (92), Expect = 0.51,   Method: Composition-based stats.
 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 10/98 (10%)

Query: 119 HSTEQLQEIVQEENKTWRRLY-------DPNDPNTNRTITVEEITKMADGSNISPENVVE 171
            +   L +I +E  K W  +        D  D +   TIT+ +  K  DGS I+ ++ V 
Sbjct: 98  MNGYGLTDITRERVKEWDPVVVKSHEETDNEDGSRTYTITINDNLKWNDGSKITAKDYVF 157

Query: 172 QI--KKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEF 207
            I  +   +F      AT+ S LV GF +     TKEF
Sbjct: 158 HILLRSSKQFAECEGDATMGSTLV-GFDTFREGKTKEF 194


>gi|206601868|gb|EDZ38351.1| Hypothetical protein CGL2_05939002 [Leptospirillum sp. Group II
           '5-way CG']
          Length = 175

 Score = 39.6 bits (91), Expect = 0.51,   Method: Composition-based stats.
 Identities = 19/136 (13%), Positives = 46/136 (33%), Gaps = 18/136 (13%)

Query: 17  AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH 76
            V ++   K     + +   K+ + ++ +     L   KS+   +    + GPV   +  
Sbjct: 9   KVIHYICWKAQDPGV-LRATKLNKILWYSDIFNYLSSGKSITGTKYIKHQYGPVPKEIDK 67

Query: 77  RFKYFDSHPIEVIMDLSFRIFPKI------------ANQEIGEIMESIWNK--YQSHSTE 122
                    + VI   S+  +PK                E  ++++ ++N   Y  H+ +
Sbjct: 68  AISNLKKEGVLVIRQGSYFGYPKKEFVALKKPDISGFKPEHIDLIDEVFNVICY-DHTAK 126

Query: 123 QLQEIVQEENKTWRRL 138
            +       +  W+  
Sbjct: 127 SISLESH--DVIWKTA 140


>gi|295695551|ref|YP_003588789.1| helix-turn-helix domain-containing protein [Bacillus tusciae DSM
           2912]
 gi|295411153|gb|ADG05645.1| helix-turn-helix domain-containing protein [Bacillus tusciae DSM
           2912]
          Length = 328

 Score = 39.6 bits (91), Expect = 0.55,   Method: Composition-based stats.
 Identities = 8/109 (7%), Positives = 31/109 (28%), Gaps = 14/109 (12%)

Query: 40  QFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV-------------GVYHRFKYFDSHPI 86
           ++++      +    + ++         GPV                +           +
Sbjct: 201 KYLFYIDFLNLKWHGEPLMGLAYVKNHYGPVPRYHGLLLEYLEASGAIRREEIERGGEIV 260

Query: 87  EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
              ++       +   +   ++++ +    +  + E++ E   EE   W
Sbjct: 261 GEYVEGLPVERAEPLEEHERDVVDYVIETLKGMNAERISEFSHEE-PAW 308


>gi|71275020|ref|ZP_00651308.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
 gi|71164752|gb|EAO14466.1| conserved hypothetical protein [Xylella fastidiosa Dixon]
          Length = 50

 Score = 39.6 bits (91), Expect = 0.57,   Method: Composition-based stats.
 Identities = 6/30 (20%), Positives = 15/30 (50%), Gaps = 3/30 (10%)

Query: 40 QFIYLTHCDVVLQKKKSMLDEE---PQAWK 66
          + +Y+ H   +  +K+ ++DE       W+
Sbjct: 3  KLVYIAHAWHLRFRKQPLIDEHVLNFLGWE 32


>gi|15838036|ref|NP_298724.1| hypothetical protein XF1435 [Xylella fastidiosa 9a5c]
 gi|9106450|gb|AAF84244.1|AE003973_12 hypothetical protein XF_1435 [Xylella fastidiosa 9a5c]
          Length = 50

 Score = 39.6 bits (91), Expect = 0.59,   Method: Composition-based stats.
 Identities = 6/30 (20%), Positives = 15/30 (50%), Gaps = 3/30 (10%)

Query: 40 QFIYLTHCDVVLQKKKSMLDEE---PQAWK 66
          + +Y+ H   +  +K+ ++DE       W+
Sbjct: 3  KLVYIAHAWHLGFRKQPLIDEHVLNFLGWE 32


>gi|194335237|ref|YP_002017031.1| transcriptional regulator, XRE family [Pelodictyon
           phaeoclathratiforme BU-1]
 gi|194307714|gb|ACF42414.1| transcriptional regulator, XRE family [Pelodictyon
           phaeoclathratiforme BU-1]
          Length = 326

 Score = 39.2 bits (90), Expect = 0.67,   Method: Composition-based stats.
 Identities = 18/122 (14%), Positives = 38/122 (31%), Gaps = 16/122 (13%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV---FVGVYHRFKYFDSHPIEVIM--- 90
           K+ + ++            S+      A   GPV   F  ++   +      +E      
Sbjct: 191 KLNKLLFYADFLNFKTTGYSISGARYCAISMGPVPDNFNTIFEWIEKQGDVTVEETEFDN 250

Query: 91  --------DLSFRIFP-KIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDP 141
                       R F  ++ + E    + ++   +   ST ++  I  EE K W    + 
Sbjct: 251 GGTGEQFFPGDGRKFNAEMFSAEELHTLTTVAETFSRISTREIIRISHEE-KAWIENVNA 309

Query: 142 ND 143
            +
Sbjct: 310 TN 311


>gi|297583098|ref|YP_003698878.1| hypothetical protein Bsel_0783 [Bacillus selenitireducens MLS10]
 gi|297141555|gb|ADH98312.1| conserved hypothetical protein [Bacillus selenitireducens MLS10]
          Length = 151

 Score = 39.2 bits (90), Expect = 0.68,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 42/124 (33%), Gaps = 19/124 (15%)

Query: 13  YSTI-AVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF 71
           Y+TI  V  +FI+K   Y   +   +I + +YL          + + + +      GP  
Sbjct: 2   YNTISDVLLYFINK-YPYPDELSKTRITKMVYLADLYKTQVIGEQLTEIKWYFDHYGPYV 60

Query: 72  VGVYHRFKYFDSHPIEVIMDLSFRIFPKI---------------ANQEIGEIMESIWNKY 116
             VY   K    + I      S    PK                  +E  +I++ +  + 
Sbjct: 61  SDVYDAAKK--DNRISFENTFSAFGHPKTVIRKNNTQEDLEYLYLEEEDKKILDQVIEET 118

Query: 117 QSHS 120
           +  +
Sbjct: 119 KYLN 122


>gi|257889232|ref|ZP_05668885.1| predicted protein [Enterococcus faecium 1,231,410]
 gi|257825592|gb|EEV52218.1| predicted protein [Enterococcus faecium 1,231,410]
          Length = 225

 Score = 39.2 bits (90), Expect = 0.76,   Method: Composition-based stats.
 Identities = 21/112 (18%), Positives = 42/112 (37%), Gaps = 18/112 (16%)

Query: 36  LKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY-------HRFKYFDSHPIEV 88
           LK+Q+F++  +          +  +  + +K GPV+  VY         F+      I  
Sbjct: 27  LKLQKFLFF-YEIFNYSLDNEIHLDYLKGYKNGPVYSDVYGDYTYRMEEFQTKLEEIISG 85

Query: 89  IMDLSFRIFPKIANQEIGE---IMESIWNKYQSHSTEQLQEIVQEENKTWRR 137
           + D       +  N++I +    + S+       S  +L E+   E   W+ 
Sbjct: 86  VKDKVALNVFEPVNEDIAKKAAFLVSV------LSKSELSELSH-EFDIWKN 130


>gi|152990493|ref|YP_001356215.1| hypothetical protein NIS_0745 [Nitratiruptor sp. SB155-2]
 gi|151422354|dbj|BAF69858.1| hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 162

 Score = 39.2 bits (90), Expect = 0.76,   Method: Composition-based stats.
 Identities = 14/113 (12%), Positives = 37/113 (32%), Gaps = 15/113 (13%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY 80
           ++I K       + + ++ + IYL      +   K + + +      GP    V    K 
Sbjct: 9   YYILKKYPNKKHLSNARLTKLIYLIDWYSAIHYNKQISNIKWYFDNYGPFVWDVLDEIKK 68

Query: 81  -------------FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
                        F ++  + I++     +    N    +++  I +  +  +
Sbjct: 69  NPKLFKIKHTTNFFGNN--KKIIENIENNYNPNINDHEKQVINKIIDITKDKN 119


>gi|325474310|gb|EGC77498.1| hypothetical protein HMPREF9353_01848 [Treponema denticola F0402]
          Length = 186

 Score = 39.2 bits (90), Expect = 0.79,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 53/147 (36%), Gaps = 15/147 (10%)

Query: 16  IAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVY 75
           I + N+ + K   Y   +++ K+ + +YL           S+  +   A   GP+    Y
Sbjct: 7   IQIINYILKK---YDYSLNYTKLLKLLYLADRQSFDDIGTSITGDVYAALPYGPILSYTY 63

Query: 76  HRFKYFDSHPIEVIMDLSFRIFPKI------------ANQEIGEIMESIWNKYQSHSTEQ 123
                   +  + + +  F                   +    E++++I  ++  ++  Q
Sbjct: 64  DLICNNIKNKDQQLWNSVFYTEKWNLISKDKNTSLGELSDYEIEVLDNIDKQFHKYTFGQ 123

Query: 124 LQEIVQEENKTWRRLYDPNDPNTNRTI 150
           + + V E    W+     + P TN +I
Sbjct: 124 MIDYVHENCPEWQNPQGSSYPITNESI 150


>gi|308273303|emb|CBX29906.1| hypothetical protein N47_F16010 [uncultured Desulfobacterium sp.]
          Length = 173

 Score = 39.2 bits (90), Expect = 0.79,   Method: Composition-based stats.
 Identities = 10/110 (9%), Positives = 34/110 (30%), Gaps = 12/110 (10%)

Query: 38  IQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSF--- 94
           + + +Y    +   + ++ ++       K GP         +  +   +  + D  F   
Sbjct: 35  LYKLLYFMDFNFYEKYEEQLIGATYIKNKYGPTPKEFVKIIEEMEGKDLVKVKDSYFKYP 94

Query: 95  --------RIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWR 136
                   +           E+++ + N   + +  ++ E     +  W+
Sbjct: 95  QTKYLPLRKSDLTQLKAHEKEVIDDVLNTLSNMNASEISEYSHN-DVPWK 143


>gi|268323300|emb|CBH36888.1| hypothetical protein BSM_03650 [uncultured archaeon]
          Length = 230

 Score = 39.2 bits (90), Expect = 0.81,   Method: Composition-based stats.
 Identities = 11/92 (11%), Positives = 31/92 (33%), Gaps = 2/92 (2%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY 80
           + I++  K        K+ + ++    + +++ K    +     W  GP    VY    Y
Sbjct: 33  YLINEVNKQGELSGITKLMKLLFFAEKE-MVKNKVKGFNYNFYKWHLGPFTSEVYRDLDY 91

Query: 81  FDSHP-IEVIMDLSFRIFPKIANQEIGEIMES 111
              +  +     +      K   + +  +++ 
Sbjct: 92  LTENELVTEHETIELTDRGKALLEGVTYLLDE 123


>gi|307579695|gb|ADN63664.1| hypothetical protein XFLM_08860 [Xylella fastidiosa subsp.
          fastidiosa GB514]
          Length = 50

 Score = 39.2 bits (90), Expect = 0.83,   Method: Composition-based stats.
 Identities = 6/30 (20%), Positives = 15/30 (50%), Gaps = 3/30 (10%)

Query: 40 QFIYLTHCDVVLQKKKSMLDEE---PQAWK 66
          + +Y+ H   +  +K+ ++DE       W+
Sbjct: 3  KLVYIAHAWHLGFRKQPLIDEHVLNFWGWE 32


>gi|56750782|ref|YP_171483.1| hypothetical protein syc0773_d [Synechococcus elongatus PCC 6301]
 gi|81299573|ref|YP_399781.1| hypothetical protein Synpcc7942_0762 [Synechococcus elongatus PCC
           7942]
 gi|56685741|dbj|BAD78963.1| unknown protein [Synechococcus elongatus PCC 6301]
 gi|81168454|gb|ABB56794.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 183

 Score = 38.8 bits (89), Expect = 0.90,   Method: Composition-based stats.
 Identities = 17/150 (11%), Positives = 46/150 (30%), Gaps = 28/150 (18%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGV----------------YHRFKY 80
           K+ + ++     V  Q  K +   + +  + GPV V +                Y   + 
Sbjct: 30  KLNKILWFLDSIVYRQTGKPITGAKYKKLQHGPVPVDILAIQKELESEGKISVSYD--RS 87

Query: 81  FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQS-HSTEQLQEIVQEENKTWRRLY 139
           +       I          +  ++  + ++ + ++    H+   + E     +  W    
Sbjct: 88  YGFGFRTTIYTSLQEPDKSLLEEDELKFVDIVISRICDGHTARSISE--HSHDVIWEAAA 145

Query: 140 DPNDPNTNRTITVEEITKMADGSNISPENV 169
              +      +  EE       + + PE++
Sbjct: 146 MGEEIPLEAVLASEE-------APLEPEDI 168


>gi|254569824|ref|XP_002492022.1| hypothetical protein [Pichia pastoris GS115]
 gi|238031819|emb|CAY69742.1| Hypothetical protein PAS_chr2-2_0178 [Pichia pastoris GS115]
 gi|328351485|emb|CCA37884.1| Protein ERGIC-53-like [Pichia pastoris CBS 7435]
          Length = 445

 Score = 38.8 bits (89), Expect = 0.91,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 56/119 (47%), Gaps = 7/119 (5%)

Query: 155 ITKMADGSNI-SPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQ 213
           ++ ++D SNI + E + E ++     +     A    + +   K   P+ ++  + AQ  
Sbjct: 318 LSSISDLSNILNDEYIDEYVQNESENEVKERIAKQRHRRLTKDKRPEPEASERRKTAQRL 377

Query: 214 IKKDSAIARSIQESNIMRFAYSNR------SFWVTIVWITIIVAFLLTQIINSNVFAQL 266
            K +  + R  +E+N+ ++ Y +R      + W+ + W  II++FLL   I  N   +L
Sbjct: 378 RKAEERLRRQHRENNLNKYGYESRLTYFLQTVWLLLKWTFIIISFLLVGFILYNRIRKL 436


>gi|254497781|ref|ZP_05110551.1| hypothetical protein LDG_3506 [Legionella drancourtii LLAP12]
 gi|254352995|gb|EET11760.1| hypothetical protein LDG_3506 [Legionella drancourtii LLAP12]
          Length = 298

 Score = 38.8 bits (89), Expect = 0.99,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 47/122 (38%), Gaps = 16/122 (13%)

Query: 84  HPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQ-SHSTEQLQE---IVQEENKTWRRLY 139
            P           F + +N    E++E  W  Y+       L +   ++  + +      
Sbjct: 136 DPRTPFKHKFEESFSECSNNLPKELLEKSWQYYKTHVDALNLVDGACLIHRDFRP----- 190

Query: 140 DPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSM 199
                  N  I  EEIT + D ++ +  +  E+   P+  +  SE + L+   +KG+ S+
Sbjct: 191 ------GNIIIFDEEITGIIDWAS-ARASFAEEDFSPLELNEWSEESKLKKSFLKGYASI 243

Query: 200 PP 201
            P
Sbjct: 244 RP 245


>gi|84489996|ref|YP_448228.1| cation transport ATPase [Methanosphaera stadtmanae DSM 3091]
 gi|84373315|gb|ABC57585.1| predicted cation transport ATPase [Methanosphaera stadtmanae DSM
           3091]
          Length = 839

 Score = 38.8 bits (89), Expect = 1.0,   Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 44/123 (35%), Gaps = 16/123 (13%)

Query: 79  KYFDSHPIEVIMDLSFRIFPKIANQEIGEIM---ESIWNKYQSHSTEQLQE------IVQ 129
           K      I      +          +   ++       + Y  +S E+L+E      ++ 
Sbjct: 431 KEDKVSEITTEEIKTIEKIETEYTDKALRVLLLAYKEIDDYSKYSAEELEEDLVFVGLIG 490

Query: 130 EENKTWRRLYDPNDPNTNRTITVEEI------TKMADGSNISPENVVEQIKKP-VRFDSD 182
             +   + ++D     TN  ITV+ I      T MA G  +  EN  + +  P +   SD
Sbjct: 491 MMDPPRKEVFDAIKTCTNAGITVKMITGDHKNTAMAIGKQVGIENPDKSLTGPEIDKLSD 550

Query: 183 SEF 185
            EF
Sbjct: 551 EEF 553


>gi|218961365|ref|YP_001741140.1| hypothetical protein CLOAM1062 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730022|emb|CAO80934.1| conserved hypothetical protein [Candidatus Cloacamonas
           acidaminovorans]
          Length = 289

 Score = 38.8 bits (89), Expect = 1.0,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 38/106 (35%), Gaps = 25/106 (23%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP-----------VFVGVYHRFKYFDSHP 85
           K+Q+ ++      +   K+  +  +   +K GP           +    +  FK+     
Sbjct: 23  KLQKLMF------LANYKQDEVSYDFVPYKYGPYSFILQKDLDYLVRNNFLIFKHNKYRA 76

Query: 86  IEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEE 131
           I                 +  +I+ SI ++Y   ST++L + V  E
Sbjct: 77  INPNY--------INITPKRRDILNSIISRYSMFSTKKLMQYVYRE 114


>gi|332672365|ref|YP_004421609.1| hypothetical protein [Campylobacter phage NCTC12673]
 gi|327493542|gb|AEA86401.1| hypothetical protein [Campylobacter phage NCTC12673]
          Length = 158

 Score = 38.8 bits (89), Expect = 1.0,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 48/126 (38%), Gaps = 11/126 (8%)

Query: 11  PPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEE---PQAWKQ 67
               +  +A+F +    K    + +L++Q  + L   D   +  + +L++E    +++  
Sbjct: 3   SKIKSKDLADFILFHSKKD---LSNLELQVLMNLISIDYEDKFYRKLLEDELTNFKSYSF 59

Query: 68  GPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEI 127
             +   VY  F+ + ++ I    D   +      ++     + +    Y  +       +
Sbjct: 60  -KISEDVYWDFRNYGANSI----DKPEKEIKLNLSKGKVRFIINRLEYYNENGYWNNVSL 114

Query: 128 VQEENK 133
           +Q+  +
Sbjct: 115 IQKHYQ 120


>gi|256088823|ref|XP_002580523.1| calcium-binding protein [Schistosoma mansoni]
 gi|1711398|sp|Q07167|SM16_SCHMA RecName: Full=16 kDa calcium-binding protein; AltName: Full=Egg
           antigen SME16
 gi|294856|gb|AAA29859.1| calcium-binding protein [Schistosoma mansoni]
 gi|238666107|emb|CAZ36762.1| calcium-binding protein, putative [Schistosoma mansoni]
          Length = 143

 Score = 38.4 bits (88), Expect = 1.2,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 130 EENKTWRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLE 189
            E K W  ++   D + N  +T EEI +      + P NV ++I K    +SD +  +LE
Sbjct: 2   SEEKQWTEVFHAIDKDKNGFLTREEIAQCLKEVGVCP-NVADKIIKETDMNSDGKI-SLE 59

Query: 190 SQLVKGFKSMPP--QLTKEFQEAQVQIKKDSAIARSIQE 226
             L    + +PP  +    ++E    I KD +   SI+E
Sbjct: 60  EYL-NALRKLPPREKCVARWREVFQSIDKDGSGKVSIKE 97


>gi|71901704|ref|ZP_00683779.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
 gi|71728546|gb|EAO30702.1| conserved hypothetical protein [Xylella fastidiosa Ann-1]
          Length = 35

 Score = 38.4 bits (88), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/31 (25%), Positives = 17/31 (54%)

Query: 62 PQAWKQGPVFVGVYHRFKYFDSHPIEVIMDL 92
           +AW+ GPV   +Y+  K + S  +  ++ +
Sbjct: 1  MKAWRAGPVIRSLYNAIKQYGSSGVTKLLPV 31


>gi|262275918|ref|ZP_06053727.1| periplasmic sensor signal transduction histidine kinase [Grimontia
           hollisae CIP 101886]
 gi|262219726|gb|EEY71042.1| periplasmic sensor signal transduction histidine kinase [Grimontia
           hollisae CIP 101886]
          Length = 666

 Score = 38.4 bits (88), Expect = 1.3,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 58/123 (47%), Gaps = 11/123 (8%)

Query: 148 RTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKG-FKSMPPQLTKE 206
            T+TV +I    +   + P+N + Q  K +  D ++     E+QL+ G  +S+  Q    
Sbjct: 250 STVTVRQIATQVEALTLGPKNPISQSLKRLELDENNRTLLTENQLLIGSVRSIIDQAV-S 308

Query: 207 FQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIV-AFLLTQIIN--SNVF 263
           F E Q      + I    Q SN ++F        V IV +T+ V A+L +Q++N  SNV 
Sbjct: 309 FAEQQSSETSQALIDVIEQSSNQLKFTL------VGIVILTLFVGAYLRSQLLNRLSNVL 362

Query: 264 AQL 266
             +
Sbjct: 363 RSM 365


>gi|227541291|ref|ZP_03971340.1| hypothetical protein HMPREF0293_0610 [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227182842|gb|EEI63814.1| hypothetical protein HMPREF0293_0610 [Corynebacterium
           glucuronolyticum ATCC 51866]
          Length = 125

 Score = 38.4 bits (88), Expect = 1.3,   Method: Composition-based stats.
 Identities = 8/58 (13%), Positives = 18/58 (31%), Gaps = 6/58 (10%)

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           F  +Y   K     P+    +            ++  I E +W+ +   +   L+   
Sbjct: 74  FPSLYSALKGNGKEPLSPHTE------RLTIGPDLETIYEIVWDDFGDMTASNLRNFT 125


>gi|119355921|ref|YP_910565.1| helix-turn-helix domain-containing protein [Chlorobium
           phaeobacteroides DSM 266]
 gi|119353270|gb|ABL64141.1| helix-turn-helix domain protein [Chlorobium phaeobacteroides DSM
           266]
          Length = 335

 Score = 38.4 bits (88), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/114 (12%), Positives = 37/114 (32%), Gaps = 16/114 (14%)

Query: 37  KIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPV---FVGVYHRFKYFDSHPIEVIM--- 90
           K+ + ++        +   S+      A   GPV   F  ++   +   +  I       
Sbjct: 200 KLNKLLFYADFLHFKRSGFSISGTRYCAIPLGPVPDNFNSIFEWMEKKGALAIIEQEFPD 259

Query: 91  ----DLSFRIFPKIANQ-----EIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
               +  F    +  ++     +  + + ++   +    T+++  I   EN  W
Sbjct: 260 GGTGERFFPAESRSFDERKFSAKELDTLNTVAFAFLKTGTKEIIAISHNEN-AW 312


>gi|332292026|ref|YP_004430635.1| A/G-specific adenine glycosylase [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170112|gb|AEE19367.1| A/G-specific adenine glycosylase [Krokinobacter diaphorus 4H-3-7-5]
          Length = 351

 Score = 38.0 bits (87), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/113 (15%), Positives = 40/113 (35%), Gaps = 21/113 (18%)

Query: 5   TFTQTNPPYSTIAVANFFIDKGVKYSIPIDHLKI-QQFIYLTHCDVVLQKKKSMLDEEPQ 63
            FT++ P  +   +AN       +  +    LK+ Q   Y +    +    + +++E   
Sbjct: 50  AFTKSFP--TVQDLAN-----ATEEEV----LKLWQGLGYYSRGRNLHASAQIIVNE--- 95

Query: 64  AWKQGPVFVGVYHRFKY---FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIW 113
               G VF   Y   K       +    I  +SF     + +  +  ++  ++
Sbjct: 96  ---HGGVFPNTYEEIKKLKGVGDYTASAIASISFNEPTAVVDGNVYRVLSRVY 145


>gi|326422409|gb|EGD71811.1| hypothetical protein CSMARM4_0051 [Candidatus Parvarchaeum
           acidiphilum ARMAN-4_'5-way FS']
          Length = 153

 Score = 38.0 bits (87), Expect = 1.5,   Method: Composition-based stats.
 Identities = 21/116 (18%), Positives = 39/116 (33%), Gaps = 11/116 (9%)

Query: 21  FFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKK---KSMLDEEPQAWKQGP----VFVG 73
           + + K           KI + ++L     V +++   +  +      +  G     V   
Sbjct: 16  YILKKLDSNKDN-GRKKIMKLMFLVDYFDVAKERITLRKAIGNTFFIYNYGVFSTEVMRD 74

Query: 74  VYHRFKYFDSHPIEVIMDLSFRIFPK-IANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           +    K      IE   DL  R   +   N+EI E +E +  KY      +L+   
Sbjct: 75  LSDLIKS--GELIETEHDLKVRKGTEPSLNEEIKEKVEQVIKKYGKLKPRELEVFT 128


>gi|270156803|ref|ZP_06185460.1| hypothetical protein LLB_0238 [Legionella longbeachae D-4968]
 gi|289164752|ref|YP_003454890.1| hypothetical protein LLO_1415 [Legionella longbeachae NSW150]
 gi|269988828|gb|EEZ95082.1| hypothetical protein LLB_0238 [Legionella longbeachae D-4968]
 gi|288857925|emb|CBJ11780.1| hypothetical protein LLO_1415 [Legionella longbeachae NSW150]
          Length = 355

 Score = 38.0 bits (87), Expect = 1.6,   Method: Composition-based stats.
 Identities = 9/91 (9%), Positives = 27/91 (29%), Gaps = 10/91 (10%)

Query: 42  IYLTHCDVVLQKKKSM---------LDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDL 92
           +Y      +  +   +         +D   +  K   V   +    + F    +   +  
Sbjct: 237 LYYAQAKYLSIENIPVHISEIFSPEIDSNFELSKHD-VLEALSKIEQKFGKDCLGDFLKN 295

Query: 93  SFRIFPKIANQEIGEIMESIWNKYQSHSTEQ 123
                   ++ +  +I+ ++  KYQ     +
Sbjct: 296 LKDEMNLTSSDDFKQILHTVLMKYQDKEAYK 326


>gi|325846328|ref|ZP_08169318.1| hypothetical protein HMPREF9246_0844 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|325481592|gb|EGC84631.1| hypothetical protein HMPREF9246_0844 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 151

 Score = 38.0 bits (87), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/111 (14%), Positives = 32/111 (28%), Gaps = 13/111 (11%)

Query: 23  IDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHR----- 77
           I K   Y   +   +I + +YL   +   +  K M +        GP    V        
Sbjct: 12  IVKNYPYGDDLTKTRITKLVYLIDWEYTKKYGKQMTEISWYFDHYGPYVSDVLDEADEDK 71

Query: 78  -------FKYFDSHPIEVIMDLSFRIFP-KIANQEIGEIMESIWNKYQSHS 120
                  F  F +    V       +   +  +    E++  ++   +  S
Sbjct: 72  TVSIKSTFSNFGTIKYIVRPKYDKELIHYEGLDVSEIEVINEVFENTKMLS 122


>gi|271963929|ref|YP_003338125.1| GTPase subunit of restriction endonuclease-like protein
           [Streptosporangium roseum DSM 43021]
 gi|270507104|gb|ACZ85382.1| GTPase subunit of restriction endonuclease-like protein
           [Streptosporangium roseum DSM 43021]
          Length = 822

 Score = 38.0 bits (87), Expect = 1.8,   Method: Composition-based stats.
 Identities = 19/120 (15%), Positives = 37/120 (30%), Gaps = 21/120 (17%)

Query: 44  LTHCDVVLQKKKSMLDEEPQAWKQGP--VFVGVYHRF---------KYFDSHPIEVIMDL 92
                 + +K +    +  +A + GP      +Y            +    H I ++ D 
Sbjct: 226 FLDAFALAEKGQVAAVDGIEALRSGPSLTAKTLYVYIPDRMLPVYGREHVRHFISLLSD- 284

Query: 93  SFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITV 152
                 K+   E   +++ + ++    S    +EI          LY  N P  N  I  
Sbjct: 285 --EDPSKLEPFEAHALLKQLIDETGHFSGWHSREIAH-------FLYWWNSPRQNAAIVK 335


>gi|257421740|ref|ZP_05598730.1| predicted protein [Enterococcus faecalis X98]
 gi|257163564|gb|EEU93524.1| predicted protein [Enterococcus faecalis X98]
 gi|295114575|emb|CBL33212.1| hypothetical protein [Enterococcus sp. 7L76]
          Length = 224

 Score = 38.0 bits (87), Expect = 1.9,   Method: Composition-based stats.
 Identities = 22/113 (19%), Positives = 43/113 (38%), Gaps = 19/113 (16%)

Query: 34  DHLKIQQFIYLTHCDVVLQKKKSMLD-EEPQAWKQGPVFVGVY----HRFKYFDSHPIEV 88
             LK+Q+F++              +D      +K GPVF  VY    +R+  F +H + +
Sbjct: 25  SSLKLQKFLFFYESYSFAMNDD--VDMSYLTGYKNGPVFTDVYGDYTYRYSEFKNHLLTI 82

Query: 89  IMD--LSFRIFPKIANQEIGE---IMESIWNKYQSHSTEQLQEIVQEENKTWR 136
             +    F       + +I +    + SI       S  +L ++    +  W+
Sbjct: 83  YDETKEKFNALDISIDMDIAKKAAFLVSI------LSESELSDLSHSFD-VWK 128


>gi|301617175|ref|XP_002938022.1| PREDICTED: transient receptor potential cation channel subfamily V
           member 4-like, partial [Xenopus (Silurana) tropicalis]
          Length = 694

 Score = 37.7 bits (86), Expect = 2.1,   Method: Composition-based stats.
 Identities = 28/139 (20%), Positives = 46/139 (33%), Gaps = 21/139 (15%)

Query: 9   TNPPYSTIAVA---NFFIDKGVK-----------YSIPIDHL----KIQQFIYLTHCDVV 50
            N P +TI V    N  + K  K               +  L    K+ +     H   +
Sbjct: 179 DNSPENTIFVTEMYNHLVIKCAKLCETLSLEAVLNKENMSPLMMAAKLGKIGIFQHIMQL 238

Query: 51  LQKKKSML--DEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEI 108
             K +  L    + + W  GPV+  +Y          I V    +      +A + I E+
Sbjct: 239 EMKDEEALHLSRKFRDWNYGPVYSSLYDLSMLDSVLEILVYKSTAKNRHEMLAVEPINEL 298

Query: 109 MESIWNKYQSHSTEQLQEI 127
           +   W K+ + S   L  I
Sbjct: 299 LSDKWKKFGAVS-FYLSFI 316


>gi|253742181|gb|EES99028.1| Hypothetical protein GL50581_3764 [Giardia intestinalis ATCC 50581]
          Length = 796

 Score = 37.7 bits (86), Expect = 2.1,   Method: Composition-based stats.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 154 EITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQ 213
           + TK      +  E + EQ+KKP R  S   FA +E+  +    S  PQ+ +EF  A VQ
Sbjct: 667 KQTKRLVRKQVPTEKIPEQVKKP-RSKSRVMFAGVETSEMSSALSSSPQIQREFIPAAVQ 725

Query: 214 IKKDSAIARSIQ 225
            K ++ + R ++
Sbjct: 726 PKINAHVTRRLE 737


>gi|304391363|ref|ZP_07373305.1| hypothetical protein R2A130_0012 [Ahrensia sp. R2A130]
 gi|303295592|gb|EFL89950.1| hypothetical protein R2A130_0012 [Ahrensia sp. R2A130]
          Length = 197

 Score = 37.7 bits (86), Expect = 2.2,   Method: Composition-based stats.
 Identities = 9/52 (17%), Positives = 19/52 (36%)

Query: 29 YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKY 80
                  +I + +++     +L+  + +  +   A K GPV    Y   K 
Sbjct: 33 KGEKPSQYEIVKSLFIADRVHLLEYGRPITFDNYVAMKDGPVGSFAYDLLKP 84


>gi|295698283|ref|YP_003602938.1| tRNA (guanine-N1)-methyltransferase [Candidatus Riesia pediculicola
           USDA]
 gi|291157179|gb|ADD79624.1| tRNA (guanine-N1)-methyltransferase [Candidatus Riesia pediculicola
           USDA]
          Length = 254

 Score = 37.7 bits (86), Expect = 2.3,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 41/120 (34%), Gaps = 16/120 (13%)

Query: 22  FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQG------PVFVGVY 75
            I K +K       LK+    Y       +   +  +D+ P     G      PV   +Y
Sbjct: 26  IIHKAIKKRF----LKL----YFYDLKSQVDTYRKSIDDRPYGGGYGTIVMASPVIRSIY 77

Query: 76  HRFKYFDSHPIEVIMDLSFRIFPKIANQEI--GEIMESIWNKYQSHSTEQLQEIVQEENK 133
              K    +   + +    +I  + + ++    E++  +  +Y+      ++  + EE  
Sbjct: 78  SAKKKLGKNSKVLYLSPQGKILDQNSIRKFLKEEVLLLVCGRYRGIDERIIENEIHEEWS 137


>gi|262373386|ref|ZP_06066665.1| predicted protein [Acinetobacter junii SH205]
 gi|262313411|gb|EEY94496.1| predicted protein [Acinetobacter junii SH205]
          Length = 814

 Score = 37.3 bits (85), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/95 (17%), Positives = 37/95 (38%), Gaps = 9/95 (9%)

Query: 35  HLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF-VGVYHRFKYFDSHPIEVIMDLS 93
           HLK+Q+ IYL     +     +   ++  A    PV    +   FK  +    +   DL 
Sbjct: 657 HLKLQKLIYLCQQ--LKHMDLAADFKQHAAGPYDPVMARYLDKEFKDHEWFSYDPKRDLK 714

Query: 94  FRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIV 128
           ++   +  +          +NKY +    ++ +++
Sbjct: 715 YKPLSRCNDHRSA------FNKYFAKDVSEIYDLI 743


>gi|19881243|gb|AAM00852.1|AF486551_3 HsdS [Campylobacter jejuni]
          Length = 380

 Score = 37.3 bits (85), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 33/92 (35%), Gaps = 6/92 (6%)

Query: 44  LTHCDVVLQKKKSMLDE---EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI 100
           L     +   K    +    +  + + G  F      F  + ++ +  I ++S  I   +
Sbjct: 170 LAQTLFLNWFKDREFNSTISDFISMQNGFAFKS--KDFIDYGNNGVIKIKNISNGIVDIV 227

Query: 101 ANQEI-GEIMESIWNKYQSHSTEQLQEIVQEE 131
              +I    +  + NK+  +S + L  +   E
Sbjct: 228 NTDKISQNTINEVNNKFNINSGDILFAMTGAE 259


>gi|86149261|ref|ZP_01067492.1| HsdS [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|88596768|ref|ZP_01100005.1| HsdS [Campylobacter jejuni subsp. jejuni 84-25]
 gi|121612440|ref|YP_001001191.1| hypothetical protein CJJ81176_1536 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167006083|ref|ZP_02271841.1| HsdS [Campylobacter jejuni subsp. jejuni 81-176]
 gi|218563144|ref|YP_002344923.1| putative type I restriction enzyme S protein [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|19881204|gb|AAM00820.1|AF486544_3 HsdS [Campylobacter jejuni]
 gi|19881210|gb|AAM00825.1|AF486545_3 HsdS [Campylobacter jejuni]
 gi|19881237|gb|AAM00847.1|AF486550_3 HsdS [Campylobacter jejuni]
 gi|19881285|gb|AAM00887.1|AF486558_3 HsdS [Campylobacter jejuni subsp. jejuni 81-176]
 gi|19881289|gb|AAM00890.1|AF486559_1 HsdS [Campylobacter jejuni]
 gi|19881291|gb|AAM00891.1|AF486560_1 HsdS [Campylobacter jejuni]
 gi|19881293|gb|AAM00892.1|AF486561_1 HsdS [Campylobacter jejuni]
 gi|19881295|gb|AAM00893.1|AF486562_1 HsdS [Campylobacter jejuni]
 gi|19881297|gb|AAM00894.1|AF486563_1 HsdS [Campylobacter jejuni]
 gi|19881301|gb|AAM00896.1|AF486565_1 HsdS [Campylobacter jejuni]
 gi|19881303|gb|AAM00897.1|AF486566_1 HsdS [Campylobacter jejuni]
 gi|19881306|gb|AAM00898.1|AF486568_1 HsdS [Campylobacter jejuni]
 gi|19881308|gb|AAM00899.1|AF486569_1 HsdS [Campylobacter jejuni]
 gi|85840043|gb|EAQ57301.1| HsdS [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|87249550|gb|EAQ72509.1| HsdS [Campylobacter jejuni subsp. jejuni 81-176]
 gi|88191609|gb|EAQ95581.1| HsdS [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112360850|emb|CAL35651.1| putative type I restriction enzyme S protein [Campylobacter jejuni
           subsp. jejuni NCTC 11168]
 gi|284926750|gb|ADC29102.1| putative type I restriction enzyme S protein [Campylobacter jejuni
           subsp. jejuni IA3902]
 gi|315926726|gb|EFV06104.1| type I restriction modification DNA specificity domain protein
           [Campylobacter jejuni subsp. jejuni DFVF1099]
 gi|315929698|gb|EFV08873.1| type I restriction modification DNA specificity domain protein
           [Campylobacter jejuni subsp. jejuni 305]
          Length = 380

 Score = 37.3 bits (85), Expect = 2.9,   Method: Composition-based stats.
 Identities = 14/92 (15%), Positives = 33/92 (35%), Gaps = 6/92 (6%)

Query: 44  LTHCDVVLQKKKSMLDE---EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKI 100
           L     +   K    +    +  + + G  F      F  + ++ +  I ++S  I   +
Sbjct: 170 LAQTLFLNWFKDREFNSTISDFISMQNGFAFKS--KDFIDYGNNGVIKIKNISNGIVDIV 227

Query: 101 ANQEI-GEIMESIWNKYQSHSTEQLQEIVQEE 131
              +I    +  + NK+  +S + L  +   E
Sbjct: 228 NTDKISQNTINEVNNKFNINSGDILFAMTGAE 259


>gi|225851259|ref|YP_002731493.1| nucleoside diphosphate kinase [Persephonella marina EX-H1]
 gi|254767245|sp|C0QS47|NDK_PERMH RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP
           kinase; AltName: Full=Nucleoside-2-P kinase
 gi|225645984|gb|ACO04170.1| nucleoside diphosphate kinase [Persephonella marina EX-H1]
          Length = 140

 Score = 37.3 bits (85), Expect = 3.0,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 27/90 (30%), Gaps = 14/90 (15%)

Query: 45  THCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQE 104
                ++ K +   DE  +    GP+   V+        + I  I ++     P+ A + 
Sbjct: 47  AQQFYIVHKDRPFYDELCEFMSSGPIVAMVWE-----GENAISRIREIMGATNPEEAEEG 101

Query: 105 IGEIMESIWNKYQSHSTEQLQEIVQEENKT 134
                      Y ++     +  V   +  
Sbjct: 102 TLR------KLYGTNVG---ENAVHGSDSP 122


>gi|313905678|ref|ZP_07839039.1| transcriptional regulator, XRE family [Eubacterium cellulosolvens
           6]
 gi|313469502|gb|EFR64843.1| transcriptional regulator, XRE family [Eubacterium cellulosolvens
           6]
          Length = 334

 Score = 37.3 bits (85), Expect = 3.2,   Method: Composition-based stats.
 Identities = 13/116 (11%), Positives = 34/116 (29%), Gaps = 19/116 (16%)

Query: 44  LTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYH------------RFKYFDSHPIEVIMD 91
            +      +   S+   +      GPV    +               + F     E    
Sbjct: 212 YSDMIFYKENGLSISGLKYAHLPYGPV-PDNFDMILGKMAADHIAHIEVFYDGSYENHQV 270

Query: 92  LSFRIFPK-IANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNT 146
           +     P+ + + E  E++  I+ K+++  + ++     +E       Y+      
Sbjct: 271 VPECDVPEGVLSDEEIEVLTRIYEKFKNFGSAEISNYSHKETG-----YNATKTGQ 321


>gi|169835878|ref|ZP_02869066.1| hypothetical protein cdivTM_01991 [candidate division TM7
          single-cell isolate TM7a]
          Length = 42

 Score = 36.9 bits (84), Expect = 3.3,   Method: Composition-based stats.
 Identities = 10/38 (26%), Positives = 17/38 (44%), Gaps = 1/38 (2%)

Query: 16 IAVANF-FIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQ 52
          I VA + F +        ID +K+Q+ +Y      +L 
Sbjct: 5  IDVAQYIFSEYKRVAGEIIDEMKLQKLLYFLKEKHLLF 42


>gi|319777229|ref|YP_004136880.1| cof family had hydrolase protein, conserved [Mycoplasma fermentans
           M64]
 gi|318038304|gb|ADV34503.1| COF family HAD hydrolase protein, conserved [Mycoplasma fermentans
           M64]
          Length = 274

 Score = 36.9 bits (84), Expect = 3.7,   Method: Composition-based stats.
 Identities = 18/116 (15%), Positives = 41/116 (35%), Gaps = 24/116 (20%)

Query: 23  IDKGVKYSIPIDH--LKIQQFIYLTHCDVVL----------QKKKSMLDEEPQAWKQGPV 70
           +   +    PI    LK+ + +Y    D ++          +  K + +E  +A     V
Sbjct: 39  LSFNIATGNPICPRMLKLAKLVY---ADYMIGSSGVQIYDYKHNKYLHEEYLKAS----V 91

Query: 71  FVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQE 126
              ++  FK           D+ +     +  +   E +  I+ +Y++    +L E
Sbjct: 92  VKKIFKLFKESKVSAAAWSSDVFY-----VFKEADKEFLNKIYYRYETFEQFELYE 142


>gi|301617171|ref|XP_002938020.1| PREDICTED: transient receptor potential cation channel subfamily V
           member 4-like [Xenopus (Silurana) tropicalis]
          Length = 819

 Score = 36.9 bits (84), Expect = 4.3,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 27/67 (40%), Gaps = 1/67 (1%)

Query: 61  EPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHS 120
           + + WK GPV+  +Y          I V    +      +A + I E++   W K+ + S
Sbjct: 355 KFRDWKYGPVYSSLYDLSMLDSVLKILVYKSTAKNRHEMLAVEPINELLNDKWKKFGAVS 414

Query: 121 TEQLQEI 127
              L  I
Sbjct: 415 -FYLSFI 420


>gi|320105381|ref|YP_004180971.1| permease [Terriglobus saanensis SP1PR4]
 gi|319923902|gb|ADV80977.1| permease [Terriglobus saanensis SP1PR4]
          Length = 884

 Score = 36.5 bits (83), Expect = 4.3,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 175 KPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIARSIQES 227
           +PVR   D+     E++  KGFK +P ++ + F + ++++   SA   S+QES
Sbjct: 300 EPVRAKLDAVSRGFETERAKGFKDIPKKMIQNFLDQRMEMIPASAGTSSLQES 352


>gi|24373042|ref|NP_717084.1| hypothetical protein SO_1468 [Shewanella oneidensis MR-1]
 gi|24347215|gb|AAN54529.1|AE015592_2 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 353

 Score = 36.5 bits (83), Expect = 4.4,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 40/127 (31%), Gaps = 27/127 (21%)

Query: 30  SIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGP---VFVGVYHRFKY---FDS 83
              +  L++Q+ +Y      +    + +     +    GP   V   V  + +    +  
Sbjct: 187 GYRLSLLEVQKLVYF-----LTVVGEPLNKVVFKKHHYGPYADVLRHVLDKMEGHFIYGF 241

Query: 84  --------HPIEVIMDLSFRIFP-KIANQEIGEIMESI---WNKYQSHSTEQLQEIVQ-- 129
                    PI++  D +         + +  +  + +      Y+S +  +L   V   
Sbjct: 242 ADGLNKPETPIDLKDDAAKEALDFLAQHPDTKQRFDKVAKLIEGYESQNGMELLSTVHWV 301

Query: 130 --EENKT 134
             +E+  
Sbjct: 302 VTQESNP 308


>gi|317129462|ref|YP_004095744.1| hypothetical protein Bcell_2758 [Bacillus cellulosilyticus DSM
           2522]
 gi|315474410|gb|ADU31013.1| protein of unknown function DUF214 [Bacillus cellulosilyticus DSM
           2522]
          Length = 451

 Score = 36.5 bits (83), Expect = 5.2,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 58/134 (43%), Gaps = 8/134 (5%)

Query: 84  HPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQL-QEIVQ-EENKTWRRLYDP 141
           + I    D++     ++AN+ + ++   +   Y+  ++  L   +   +    W ++Y P
Sbjct: 172 NTIANENDINIGDSIELANKFLDDLSLEVVGIYE--TSVVLDSSVTYVQHRLPWNQVYTP 229

Query: 142 -NDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMP 200
             +P TN ++ VE +      SN++P   +E+ K+    D D  F+ + S       + P
Sbjct: 230 FTEPLTNDSLMVEAVFYFDSVSNMAP--FIEKAKQTSSLDFD-HFSLMTSTDYYEEMAGP 286

Query: 201 PQLTKEFQEAQVQI 214
            ++  +     V I
Sbjct: 287 LEMVSDLSNTMVNI 300


>gi|281425143|ref|ZP_06256056.1| conserved hypothetical protein [Prevotella oris F0302]
 gi|281400735|gb|EFB31566.1| conserved hypothetical protein [Prevotella oris F0302]
          Length = 190

 Score = 36.1 bits (82), Expect = 5.6,   Method: Composition-based stats.
 Identities = 10/43 (23%), Positives = 19/43 (44%), Gaps = 2/43 (4%)

Query: 4   RTFTQTNPPYSTIAVA-NFFIDKGVKYSIPIDHLKIQQFIYLT 45
           + F +      ++ VA N+ +    K    ID +K Q+ +Y  
Sbjct: 101 KAFEEMPSEVDSVQVAGNYVLGHSKKGYFLID-MKTQKLVYYA 142


>gi|149641782|ref|XP_001508753.1| PREDICTED: similar to Transient receptor potential cation channel,
           subfamily V, member 3 [Ornithorhynchus anatinus]
          Length = 751

 Score = 36.1 bits (82), Expect = 5.8,   Method: Composition-based stats.
 Identities = 16/138 (11%), Positives = 41/138 (29%), Gaps = 33/138 (23%)

Query: 28  KYSIPIDHLKIQ----QFIYLTHCDVVLQKKKSM------LDEEPQAWKQGPVFVGVY-- 75
           + +  +  L++     +         +L ++  +      L      W  GP+   +Y  
Sbjct: 337 RNNEGLTPLQLAAKEGKLQLF---RHILSREFPINDRMHHLSRRFVEWTYGPICTSLYDL 393

Query: 76  ---HRFKYFDSHPIEVIMDLSFRIFPKIANQEIGEIMESIWNKYQSH-----STEQLQEI 127
                     +  I V  +   +    +  + + E++E  W  + +      +   L  I
Sbjct: 394 DEVDTTDQQSALKIVVYSNKQDKYCNLLDVEPLKELIEVKWKMFAALMFGVSTAWYLHYI 453

Query: 128 V----------QEENKTW 135
           +            E+  W
Sbjct: 454 ILFTLITALQPHSESSFW 471


>gi|163785005|ref|ZP_02179743.1| transketolase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879725|gb|EDP73491.1| transketolase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 502

 Score = 36.1 bits (82), Expect = 5.9,   Method: Composition-based stats.
 Identities = 29/178 (16%), Positives = 59/178 (33%), Gaps = 26/178 (14%)

Query: 36  LKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFR 95
           LK+ + IYL   + +             AW        +  RFK    H I V       
Sbjct: 13  LKLGKLIYLYDDNHITIDGT-----TDIAW-----NEDIELRFKAHGWHVITVPDGEDLE 62

Query: 96  ----IFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTIT 151
                     +++    +  I      HS +Q        +    +++     +     T
Sbjct: 63  AIYGAIKAAQDEKEKPSLIRIKTHIGWHSPKQ--------DSP--KVHGAPLSDEETKAT 112

Query: 152 VEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQE 209
            + +    D +   PE  +   ++ V  +   +     +++ + +K   PQL K+F+E
Sbjct: 113 KKALGFPEDKTFYIPEEALNHCRQAV--EKGKKIEENWNKMFEEYKKEYPQLAKQFEE 168


>gi|209878500|ref|XP_002140691.1| hypothetical protein [Cryptosporidium muris RN66]
 gi|209556297|gb|EEA06342.1| hypothetical protein, conserved [Cryptosporidium muris RN66]
          Length = 232

 Score = 36.1 bits (82), Expect = 6.8,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 24/56 (42%), Gaps = 2/56 (3%)

Query: 7   TQTNPPYSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEP 62
           TQ    YST+ ++   +D+  K  +   +L +Q+  Y         K + + + + 
Sbjct: 99  TQNTIEYSTVEISKNLVDRSEKRKLRHKYLYMQK--YYHKGSFFQDKDEPLYNRDF 152


>gi|75758279|ref|ZP_00738404.1| hypothetical protein RBTH_06376 [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228904910|ref|ZP_04068964.1| hypothetical protein bthur0014_60340 [Bacillus thuringiensis IBL
           4222]
 gi|74494333|gb|EAO57424.1| hypothetical protein RBTH_06376 [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228854924|gb|EEM99528.1| hypothetical protein bthur0014_60340 [Bacillus thuringiensis IBL
           4222]
          Length = 451

 Score = 36.1 bits (82), Expect = 6.9,   Method: Composition-based stats.
 Identities = 29/164 (17%), Positives = 56/164 (34%), Gaps = 24/164 (14%)

Query: 71  FVGVYHRFK-----YFDSHPIEVIMDLSFRIFPKIAN--QEIGEIMESIWNKYQSHSTEQ 123
               Y  FK      +    I    + +     +I    ++  E    +   Y+++    
Sbjct: 170 VEEGYFLFKETVLKNYLDGDIPAEPERNKDFTEQIEEAVKKQKEWFGQVTKLYKNNEGTY 229

Query: 124 LQEIVQEENKT--------WRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKK 175
            + +  E            + +   P D       T+ E++ + DG  I+ E+  + IK 
Sbjct: 230 YESLRTEYGSPEFFKASDEYLKAKRPYDIAIREEKTLNEMSSLVDGLLIASEDCSDSIKS 289

Query: 176 PV----RFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIK 215
            +      DS+     LE+Q      S   QLT   +  Q+ +K
Sbjct: 290 GLVLGSEIDSEGVMNLLENQ-----ASTKEQLTDLLKLTQLSLK 328


>gi|281201792|gb|EFA76000.1| hypothetical protein PPL_10579 [Polysphondylium pallidum PN500]
          Length = 697

 Score = 36.1 bits (82), Expect = 7.0,   Method: Composition-based stats.
 Identities = 19/113 (16%), Positives = 47/113 (41%), Gaps = 13/113 (11%)

Query: 43  YLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFKYFDSHPIEVIMDLSFRIFPKIAN 102
           Y  + D     +  +  ++ +A         +  +F  +D + IE   ++   +  ++  
Sbjct: 239 YFVYTDASDIDQAILTKDQLKAL-------ELLSQF-NYDINHIEGKNNVGADVLSRLQC 290

Query: 103 QEIG---EIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITV 152
            +I      ++ I N Y+S    +L ++  +E+  WR+L   ++ +    IT 
Sbjct: 291 YQIPLDFSYLDEIKNSYKSSKDVELVKLRHKES--WRKLLLVDEKHIKEVITE 341


>gi|228288745|ref|YP_002841997.1| restriction modification system DNA specificity domain protein
           [Sulfolobus islandicus Y.N.15.51]
 gi|228014315|gb|ACP50075.1| restriction modification system DNA specificity domain protein
           [Sulfolobus islandicus Y.N.15.51]
          Length = 576

 Score = 35.7 bits (81), Expect = 7.4,   Method: Composition-based stats.
 Identities = 13/125 (10%), Positives = 44/125 (35%), Gaps = 28/125 (22%)

Query: 21  FFIDKGVK-YSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFVGVYHRFK 79
           + + +  K    P+   ++ ++++L   +  +           + +K GP    +Y   +
Sbjct: 447 YLVYQASKIKGRPVYMTELMKYLFLLQKEYNINLAY-----NFEPYKYGPFTPQLYKDLE 501

Query: 80  YFDSH----PIEVIMDLSF------------------RIFPKIANQEIGEIMESIWNKYQ 117
                     ++  +D S                    +  +  N+++ E++  ++ KY 
Sbjct: 502 ELKDRIEVKEVKDNVDKSLITSKELPQVNQDIANAVNDLINRFGNKDLKELLSYVYKKYP 561

Query: 118 SHSTE 122
            ++ +
Sbjct: 562 EYTVK 566


>gi|228982607|ref|ZP_04142866.1| Cdse [Bacillus thuringiensis Bt407]
 gi|228776790|gb|EEM25098.1| Cdse [Bacillus thuringiensis Bt407]
          Length = 76

 Score = 35.7 bits (81), Expect = 7.6,   Method: Composition-based stats.
 Identities = 10/36 (27%), Positives = 18/36 (50%), Gaps = 1/36 (2%)

Query: 100 IANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTW 135
           + N +  E++ S+W  Y  +S   L+E+   E   W
Sbjct: 1   MINSKRKEVINSVWLVYGHYSGNFLEELPVLE-SPW 35


>gi|262279999|ref|ZP_06057784.1| type-1 restriction enzyme EcoEI specificity protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|262260350|gb|EEY79083.1| type-1 restriction enzyme EcoEI specificity protein [Acinetobacter
           calcoaceticus RUH2202]
          Length = 815

 Score = 35.7 bits (81), Expect = 7.9,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 30/86 (34%), Gaps = 6/86 (6%)

Query: 35  HLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVF-VGVYHRFKYFDSHPIEVIMDLS 93
           HLK+Q+ +YL     +     +   ++  A    PV    +   FK  +    +   DL 
Sbjct: 658 HLKLQKLVYLCQQ--LKHMDLAADFKQHAAGPYDPVMARYLDKEFKNREWFSYDPKRDLK 715

Query: 94  FRIFPKIANQEI---GEIMESIWNKY 116
           ++   +  +          E +   Y
Sbjct: 716 YKPLSRCNDHRSAFNRYFAEDVSEIY 741


>gi|188590327|ref|YP_001921305.1| hypothetical protein CLH_1924 [Clostridium botulinum E3 str. Alaska
           E43]
 gi|188500608|gb|ACD53744.1| putative sulfurtransferase DndC [Clostridium botulinum E3 str.
           Alaska E43]
          Length = 542

 Score = 35.7 bits (81), Expect = 8.3,   Method: Composition-based stats.
 Identities = 20/95 (21%), Positives = 35/95 (36%), Gaps = 17/95 (17%)

Query: 67  QGPVFVGVYHRFKYFDSHPI-----EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHST 121
            GP        F +     I     EV   ++     ++  +E  EI++SIW++ +  + 
Sbjct: 400 YGP--------FNFEGRQLILKKLLEVQKHINEEFEIELITKEELEIIDSIWDEEEDLTR 451

Query: 122 EQLQEI---VQEENKTWRRLYDPN-DPNTNRTITV 152
             L ++   V +E   W     P  D  T   I  
Sbjct: 452 RTLVDLYYEVMDERLPWDTYKKPMFDEATRSEIEK 486


>gi|118356247|ref|XP_001011382.1| Protein kinase domain containing protein [Tetrahymena thermophila]
 gi|89293149|gb|EAR91137.1| Protein kinase domain containing protein [Tetrahymena thermophila
            SB210]
          Length = 1474

 Score = 35.7 bits (81), Expect = 9.3,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 38/85 (44%)

Query: 148  RTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEF 207
              I     + M +  N   +N+   IKKP   D++ +    E +      +  P + KE 
Sbjct: 1225 NIIEKNSASNMNNIHNTDKQNINVVIKKPENIDNNGQSFQSEMKKQDQTNNQTPSINKEV 1284

Query: 208  QEAQVQIKKDSAIARSIQESNIMRF 232
            +E ++++  +S + +  Q SN  ++
Sbjct: 1285 KEPKIRVISESPMCKKDQHSNESKY 1309


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.313    0.142    0.433 

Lambda     K      H
   0.267   0.0438    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,033,376,846
Number of Sequences: 14124377
Number of extensions: 131085825
Number of successful extensions: 404579
Number of sequences better than 10.0: 594
Number of HSP's better than 10.0 without gapping: 486
Number of HSP's successfully gapped in prelim test: 108
Number of HSP's that attempted gapping in prelim test: 403415
Number of HSP's gapped (non-prelim): 611
length of query: 302
length of database: 4,842,793,630
effective HSP length: 138
effective length of query: 164
effective length of database: 2,893,629,604
effective search space: 474555255056
effective search space used: 474555255056
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.3 bits)
S2: 81 (35.7 bits)