RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254781013|ref|YP_003065426.1| phage-associated protein
[Candidatus Liberibacter asiaticus str. psy62]
         (302 letters)



>gnl|CDD|33400 COG3600, GepA, Uncharacterized phage-associated protein [Function
           unknown].
          Length = 154

 Score = 72.7 bits (178), Expect = 1e-13
 Identities = 37/126 (29%), Positives = 64/126 (50%), Gaps = 4/126 (3%)

Query: 13  YSTIAVANFFIDKGVKYSIPIDHLKIQQFIYLTHCDVVLQKKKSMLDEEPQAWKQGPVFV 72
               A+AN+F+DK  +  IP+  LK+Q+ +Y  H   +    + + DE+ +AWK GPV  
Sbjct: 5   VDPRAIANWFLDKADELDIPVTPLKLQKLLYYAHGWFLAVTGRPLFDEKIEAWKHGPVIP 64

Query: 73  GVYHRFKYFDSHPI---EVIMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQ 129
            +Y+ FK + S+ I     +  LS      I + ++  I+  +W+ Y  +S  QL +I  
Sbjct: 65  SLYNAFKQYGSNSIDERLPVRGLSNGNALPI-DADVSAILARVWDTYGRYSAWQLVDITH 123

Query: 130 EENKTW 135
            E+   
Sbjct: 124 AESPWI 129


>gnl|CDD|36630 KOG1416, KOG1416, KOG1416, tRNA(1-methyladenosine)
           methyltransferase, subunit GCD10 [Translation, ribosomal
           structure and biogenesis].
          Length = 475

 Score = 31.1 bits (70), Expect = 0.34
 Identities = 17/92 (18%), Positives = 35/92 (38%), Gaps = 4/92 (4%)

Query: 95  RIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEE 154
           R+  +       E  + + +   S    ++ EI  E +   R +    D    + +T EE
Sbjct: 64  RLLGQEFEVTNEEKDDGLSSPPLSKKEREVLEI-SESSADNREI---VDDGKAQKLTQEE 119

Query: 155 ITKMADGSNISPENVVEQIKKPVRFDSDSEFA 186
           I +M        E + + I+    F + + F+
Sbjct: 120 IEEMRQEGLSGEEIIEKLIENSKTFHNKTVFS 151


>gnl|CDD|36500 KOG1286, KOG1286, KOG1286, Amino acid transporters [Amino acid
           transport and metabolism].
          Length = 554

 Score = 30.6 bits (69), Expect = 0.50
 Identities = 15/77 (19%), Positives = 20/77 (25%), Gaps = 12/77 (15%)

Query: 236 NRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSA----------IICGF 285
                    WI   +AF+L  IIN        E ++      +            II G 
Sbjct: 149 LVDTVNPGGWIPDFLAFIL--IINLFGVLAYGEVEFSLAFNKILTAVGFIILAIVIIAGG 206

Query: 286 WAIVGKGLFGVHNDTQP 302
                K   G      P
Sbjct: 207 GPADVKNWIGFRYWHDP 223


>gnl|CDD|30527 COG0178, UvrA, Excinuclease ATPase subunit [DNA replication,
           recombination, and repair].
          Length = 935

 Score = 29.8 bits (67), Expect = 0.95
 Identities = 19/63 (30%), Positives = 26/63 (41%), Gaps = 1/63 (1%)

Query: 135 WRRLYDPNDPNTNRTITVEEITKMADGSNISPENVVEQIKKPVRFDSDSEFATLESQLVK 194
           + R+  P  PN    I  + ++++ D     PE    QI  PV      E   L  QL K
Sbjct: 114 FARVGTPYCPNCGLPIESQTVSQIVDRILALPEGTKIQILAPVVRGRKGEHKKLLEQLRK 173

Query: 195 -GF 196
            GF
Sbjct: 174 QGF 176


>gnl|CDD|35737 KOG0517, KOG0517, KOG0517, Beta-spectrin [Cytoskeleton].
          Length = 2473

 Score = 29.2 bits (65), Expect = 1.4
 Identities = 18/123 (14%), Positives = 32/123 (26%), Gaps = 21/123 (17%)

Query: 103  QEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNRTITVEEITKMADGS 162
            Q++ E+      K  +      + I +       R  D   P   R   +E         
Sbjct: 1429 QKVAELQSQ--AKAMAEEGHSAENIEETTLAVLERFEDLLGPLQERRKQLEA-------- 1478

Query: 163  NISPENVVEQIKKPVRFDSDSEFATLESQLVKGFKSMPPQLTKEFQEAQVQIKKDSAIAR 222
                     +       D D E   +  +L            +  Q  Q   KK+  +  
Sbjct: 1479 --------SKELHQFVRDVDDELLWVAERLPLA---SSTDYGENLQTVQSLHKKNQTLQA 1527

Query: 223  SIQ 225
             I+
Sbjct: 1528 EIK 1530


>gnl|CDD|31156 COG0814, SdaC, Amino acid permeases [Amino acid transport and
           metabolism].
          Length = 415

 Score = 28.7 bits (64), Expect = 1.9
 Identities = 15/80 (18%), Positives = 28/80 (35%), Gaps = 9/80 (11%)

Query: 224 IQESNIMRFAYSNRSFWVTIVWITI---IVAFLLTQIINSNVFAQLCES-----KYIATV 275
              +N+     +++SFW   + + I   + +F     I S V      S     K I   
Sbjct: 176 WNPANLFALPSASQSFWKY-LLLAIPVFVFSFGFHGNIPSLVNYMRKNSKKAVRKAILIG 234

Query: 276 VSLSAIICGFWAIVGKGLFG 295
             ++ ++         G FG
Sbjct: 235 SLIALVLYILVGFFVFGCFG 254


>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large
           and diverse group of secondary transporters that
           includes uniporters, symporters, and antiporters. MFS
           proteins facilitate the transport across cytoplasmic or
           internal membranes of a variety of substrates including
           ions, sugar phosphates, drugs, neurotransmitters,
           nucleosides, amino acids, and peptides. They do so using
           the electrochemical potential of the transported
           substrates. Uniporters transport a single substrate,
           while symporters and antiporters transport two
           substrates in the same or in opposite directions,
           respectively, across membranes. MFS proteins are
           typically 400 to 600 amino acids in length, and the
           majority contain 12 transmembrane alpha helices (TMs)
           connected by hydrophilic loops. The N- and C-terminal
           halves of these proteins display weak similarity and may
           be the result of a gene duplication/fusion event. Based
           on kinetic studies and the structures of a few bacterial
           superfamily members, GlpT (glycerol-3-phosphate
           transporter), LacY (lactose permease), and EmrD
           (multidrug transporter), MFS proteins are thought to
           function through a single substrate binding site,
           alternating-access mechanism involving a rocker-switch
           type of movement. Bacterial members function primarily
           for nutrient uptake, and as drug-efflux pumps to confer
           antibiotic resistance. Some MFS proteins have medical
           significance in humans such as the glucose transporter
           Glut4, which is impaired in type II diabetes, and
           glucose-6-phosphate transporter (G6PT), which causes
           glycogen storage disease when mutated..
          Length = 352

 Score = 28.4 bits (64), Expect = 2.2
 Identities = 7/65 (10%), Positives = 18/65 (27%)

Query: 232 FAYSNRSFWVTIVWITIIVAFLLTQIINSNVFAQLCESKYIATVVSLSAIICGFWAIVGK 291
            A +     + +  + +             + ++L   +   T   L          +G 
Sbjct: 259 LALAPSLALLLVALLLLGFGLGFAFPALLTLASELAPPEARGTASGLFNTFGSLGGALGP 318

Query: 292 GLFGV 296
            L G+
Sbjct: 319 LLAGL 323


>gnl|CDD|144170 pfam00476, DNA_pol_A, DNA polymerase family A. 
          Length = 383

 Score = 27.7 bits (62), Expect = 4.4
 Identities = 11/62 (17%), Positives = 20/62 (32%), Gaps = 13/62 (20%)

Query: 89  IMDLSFRIFPKIANQEIGEIMESIWNKYQSHSTEQLQEIVQEENKTWRRLYDPNDPNTNR 148
            ++  F  FP +         E    + +             E    RR Y P+  + NR
Sbjct: 243 FIEKYFERFPGVKRY-----REKTRKEAKKGGYV--------ETLFGRRRYLPDIDSRNR 289

Query: 149 TI 150
           ++
Sbjct: 290 SL 291


>gnl|CDD|38952 KOG3748, KOG3748, KOG3748, Uncharacterized conserved protein
           [Function unknown].
          Length = 477

 Score = 27.0 bits (59), Expect = 7.1
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 200 PPQLTKEFQEAQVQIKKDSAIARSIQESNIMRFAYSNRSFWVTIVWITIIVAFLL 254
           P Q  +  +   V  K DSA+   ++E    + AY+ R+ W+T+V   +++ +LL
Sbjct: 424 PFQKNRHLRNVVVSKKGDSAVDFLLEELQ-HKNAYNYRNPWITVVSTILLMIYLL 477


>gnl|CDD|35390 KOG0169, KOG0169, KOG0169, Phosphoinositide-specific phospholipase
           C [Signal transduction mechanisms].
          Length = 746

 Score = 26.8 bits (59), Expect = 7.3
 Identities = 15/93 (16%), Positives = 31/93 (33%), Gaps = 5/93 (5%)

Query: 46  HCDVVLQKKKSMLDEEPQAWKQGPVFVG---VYHRFKYFD-SHPIEVIMDLSFRIFPKIA 101
                 +      DE     KQ  V +        FK  D S   ++  +   +   ++ 
Sbjct: 143 QEADKNKNGHMSFDEVLDLLKQLNVQLSESKARRLFKESDNSQTGKLEEEEFVKFRKELT 202

Query: 102 NQ-EIGEIMESIWNKYQSHSTEQLQEIVQEENK 133
            + E+  +     +  +  ST+ L   ++EE  
Sbjct: 203 KRPEVYFLFVQYSHGKEYLSTDDLLRFLEEEQG 235


>gnl|CDD|32550 COG2419, COG2419, Uncharacterized conserved protein [Function
           unknown].
          Length = 336

 Score = 26.8 bits (59), Expect = 7.6
 Identities = 15/80 (18%), Positives = 30/80 (37%), Gaps = 6/80 (7%)

Query: 111 SIWNKYQSHSTEQLQEIVQEENKTWRR-LYDPNDPNTNRTITVEEITKMADGSNISPENV 169
            +W+++      +L+  +     T RR L+D +   TN     +E  K+           
Sbjct: 106 RLWDEHSDKEKSKLELQIAVTLGTVRRYLWDRHLVLTNTNPEAKERLKLPLEKIGYEGKT 165

Query: 170 VE-----QIKKPVRFDSDSE 184
            E      I + V  D +++
Sbjct: 166 EEFLKEIGIDRVVLLDPNAD 185


>gnl|CDD|37443 KOG2232, KOG2232, KOG2232, Ceramidases [Signal transduction
           mechanisms].
          Length = 734

 Score = 26.9 bits (59), Expect = 7.9
 Identities = 15/69 (21%), Positives = 26/69 (37%), Gaps = 6/69 (8%)

Query: 81  FDSHPIEVIMDLSFRIFPKIANQEIGEIMESIW------NKYQSHSTEQLQEIVQEENKT 134
            D  PI           P  +    G  ++  +      N   +  T    E ++E +KT
Sbjct: 604 VDGTPIGTDFGDVKSDVPNKSYFRRGTQVKVTFRSANPRNDLMTEGTFATVERLEEGDKT 663

Query: 135 WRRLYDPND 143
           W+ +YD +D
Sbjct: 664 WKPVYDDDD 672


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.320    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0728    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 3,701,727
Number of extensions: 190399
Number of successful extensions: 584
Number of sequences better than 10.0: 1
Number of HSP's gapped: 584
Number of HSP's successfully gapped: 28
Length of query: 302
Length of database: 6,263,737
Length adjustment: 93
Effective length of query: 209
Effective length of database: 4,254,100
Effective search space: 889106900
Effective search space used: 889106900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (25.7 bits)