RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781014|ref|YP_003065427.1| hypothetical protein CLIBASIA_04580 [Candidatus Liberibacter asiaticus str. psy62] (116 letters) >2h8z_A Xenobiotic reductase A; beta-alpha barrel, oxidoreductase; HET: FMN 8CM; 1.42A {Pseudomonas putida} PDB: 2h90_A* 2h8x_A* (A:1-104,A:149-359) Length = 315 Score = 26.3 bits (57), Expect = 1.4 Identities = 2/47 (4%), Positives = 10/47 (21%), Gaps = 3/47 (6%) Query: 38 ITDFMTATSGTVGYASNLCNAKPEICLLWKKIMRNVKRHTLNGAKIV 84 + + + +++ +K G+ Sbjct: 53 VVEATAVAPEGRITPGCAGIWSDAHAQAFVPVVQAIKA---AGSVPG 96 >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 24.8 bits (54), Expect = 3.7 Identities = 6/18 (33%), Positives = 7/18 (38%), Gaps = 3/18 (16%) Query: 95 NERESVAIHSKNEYPPPL 112 RE HS +Y P Sbjct: 9 TAREH---HSSVKYASPN 23 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.319 0.133 0.408 Gapped Lambda K H 0.267 0.0606 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 859,899 Number of extensions: 30771 Number of successful extensions: 46 Number of sequences better than 10.0: 1 Number of HSP's gapped: 46 Number of HSP's successfully gapped: 3 Length of query: 116 Length of database: 4,956,049 Length adjustment: 69 Effective length of query: 47 Effective length of database: 2,623,504 Effective search space: 123304688 Effective search space used: 123304688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.3 bits)