Query         gi|254781015|ref|YP_003065428.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 78
No_of_seqs    10 out of 12
Neff          1.7 
Searched_HMMs 23785
Date          Wed Jun  1 00:22:08 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781015.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3chb_D Cholera toxin; toxin/re  27.6      21 0.00089   17.0   1.6   26   37-62     33-60  (104)
  2 2bjq_A MFP2A; motility, nemato  27.6     8.9 0.00037   19.0  -0.4   17   12-31    219-235 (345)
  3 2bjr_A MFP2B; motility, nemato  27.6     8.9 0.00037   19.0  -0.4   18   12-32    231-248 (368)
  4 1ltr_D ETB-R2, heat-labIle ent  25.2      25  0.0011   16.6   1.6   26   37-62     32-59  (113)
  5 1b44_D ETB-POL, protein (B-POL  16.5      49  0.0021   15.0   1.6   26   37-62     32-59  (129)
  6 2d4p_A Hypothetical protein TT  10.7      76  0.0032   13.9   1.2   31    4-36     46-76  (141)
  7 1yrk_A NPKC-delta, protein kin  10.2      81  0.0034   13.8   1.2   12   18-29      1-12  (126)
  8 3bx1_D BASI, alpha-amylase/sub   6.7 1.4E+02  0.0061   12.4   1.8   17   44-60    119-135 (181)
  9 3o12_A Uncharacterized protein   6.3 1.5E+02  0.0064   12.3   2.7   26   46-75    145-170 (221)
 10 1i58_A Chemotaxis protein CHEA   5.7 1.6E+02  0.0069   12.1   1.4   13   44-56    175-187 (189)

No 1  
>3chb_D Cholera toxin; toxin/receptor complex, pentasaccharide; HET: GAL NGA SIA BGC MES; 1.25A {Vibrio cholerae} SCOP: b.40.2.1 PDB: 2chb_D* 1jr0_D* 1fgb_D 1eei_D* 1llr_D* 1md2_D* 1pzj_D* 1pzk_D* 1rcv_D* 1rd9_D* 1rdp_D* 1rf2_D* 1s5b_D 1s5c_D 1s5d_D* 1s5e_D* 1s5f_D* 1chp_D 1chq_D 1ct1_D* ...
Probab=27.61  E-value=21  Score=16.98  Aligned_cols=26  Identities=35%  Similarity=0.464  Sum_probs=20.0

Q ss_pred             HHCCCCC--CCCCCEEEEEECCCCCCCE
Q ss_conf             2178735--5357128999416765430
Q gi|254781015|r   37 LGSGSEV--SKDKGITFKVEKVGDQHNK   62 (78)
Q Consensus        37 lg~g~~v--e~~~~TTF~IER~gd~~~~   62 (78)
                      +|+++-|  .-.+|.||.+|-||.||-+
T Consensus        33 agkremviisf~ngatfqvevpgsqh~~   60 (104)
T 3chb_D           33 AGKREMAIITFKNGATFQVEVPGSQHID   60 (104)
T ss_dssp             STTCCEEEEECTTCCEEEECCCCTTSCH
T ss_pred             CCCEEEEEEEECCCCEEEEECCCCHHHH
T ss_conf             5760699999428967999668610134


No 2  
>2bjq_A MFP2A; motility, nematode, MSP; 1.75A {Ascaris suum} SCOP: b.169.1.1 b.169.1.1
Probab=27.59  E-value=8.9  Score=19.04  Aligned_cols=17  Identities=41%  Similarity=0.970  Sum_probs=9.9

Q ss_pred             HHHHCCCCCCCCEEEECCCC
Q ss_conf             02206898877415630876
Q gi|254781015|r   12 ALWNQTGKHPSPIFTTRHPQ   31 (78)
Q Consensus        12 alwyq~g~hpsp~lrtr~P~   31 (78)
                      |||||+|   .|++---=|.
T Consensus       219 ALWY~hG---ePVmGRaw~~  235 (345)
T 2bjq_A          219 ALWYEHG---QPVFGRAYPD  235 (345)
T ss_dssp             EEEEETT---EEEEEEEEEC
T ss_pred             EEHHHCC---CCCEECCCCC
T ss_conf             3264549---8442000357


No 3  
>2bjr_A MFP2B; motility, nematode, MSP; 1.8A {Ascaris suum} SCOP: b.169.1.1 b.169.1.1
Probab=27.55  E-value=8.9  Score=19.03  Aligned_cols=18  Identities=33%  Similarity=0.711  Sum_probs=9.9

Q ss_pred             HHHHCCCCCCCCEEEECCCCC
Q ss_conf             022068988774156308764
Q gi|254781015|r   12 ALWNQTGKHPSPIFTTRHPQS   32 (78)
Q Consensus        12 alwyq~g~hpsp~lrtr~P~a   32 (78)
                      |||||+|   .|++---=|.+
T Consensus       231 ALWY~hG---ePVmGRaw~~~  248 (368)
T 2bjr_A          231 ALWYQSG---EPVMGRIWNDG  248 (368)
T ss_dssp             EEEEETT---EEEEEEEEEET
T ss_pred             EEHHHCC---CCCEEEECCCC
T ss_conf             3211438---83311112779


No 4  
>1ltr_D ETB-R2, heat-labIle enterotoxin; B subunit, anti-HSV; 3.04A {Escherichia coli} SCOP: b.40.2.1
Probab=25.18  E-value=25  Score=16.58  Aligned_cols=26  Identities=38%  Similarity=0.497  Sum_probs=19.7

Q ss_pred             HHCCCCC--CCCCCEEEEEECCCCCCCE
Q ss_conf             2178735--5357128999416765430
Q gi|254781015|r   37 LGSGSEV--SKDKGITFKVEKVGDQHNK   62 (78)
Q Consensus        37 lg~g~~v--e~~~~TTF~IER~gd~~~~   62 (78)
                      +|+++-|  .-.+|.||.+|-||.||-+
T Consensus        32 agkrem~iitf~ngatfqvevpgsqhid   59 (113)
T 1ltr_D           32 AGKREMVIITFKSGATFQVEVPGSQHID   59 (113)
T ss_dssp             STTCCCEEEECTTSCEEEECCCSTTSCS
T ss_pred             CCCEEEEEEEECCCCEEEEECCCCHHHH
T ss_conf             6760689999438977999668601125


No 5  
>1b44_D ETB-POL, protein (B-POL subunit of heat-labIle enterotoxin); B subunit, heat-labIle enterotoxin anti-HSV; 3.30A {Escherichia coli} SCOP: b.40.2.1
Probab=16.53  E-value=49  Score=15.00  Aligned_cols=26  Identities=38%  Similarity=0.497  Sum_probs=19.5

Q ss_pred             HHCCCCC--CCCCCEEEEEECCCCCCCE
Q ss_conf             2178735--5357128999416765430
Q gi|254781015|r   37 LGSGSEV--SKDKGITFKVEKVGDQHNK   62 (78)
Q Consensus        37 lg~g~~v--e~~~~TTF~IER~gd~~~~   62 (78)
                      +|+++-|  .-.+|.||.+|-||.||-+
T Consensus        32 agkrem~iitf~~gatfqvevpgsqhid   59 (129)
T 1b44_D           32 AGKREMVIITFKSGATFQVEVPGSQHID   59 (129)
T ss_dssp             BTTBCCEEEECTTSCEEEECCCCTTSCS
T ss_pred             CCCEEEEEEEECCCCEEEEECCCCHHHH
T ss_conf             6760689999438967999668601124


No 6  
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.70A {Thermus thermophilus HB8} SCOP: d.108.1.1 PDB: 2d4o_A
Probab=10.67  E-value=76  Score=13.93  Aligned_cols=31  Identities=19%  Similarity=0.389  Sum_probs=22.5

Q ss_pred             EEEECCCCHHHHCCCCCCCCEEEECCCCCHHHH
Q ss_conf             314110010220689887741563087640223
Q gi|254781015|r    4 FFCWILSNALWNQTGKHPSPIFTTRHPQSYRIF   36 (78)
Q Consensus         4 ~F~fv~analwyq~g~hpsp~lrtr~P~a~r~~   36 (78)
                      +-+||.|.|.|.  |..|.-+++.-+|.+.-..
T Consensus        46 ~~GfvLAQaVWq--G~rptVlv~rl~~~~~~~~   76 (141)
T 2d4p_A           46 PMGFALAQAVWQ--GEATTVLVTRIEGRSVEAL   76 (141)
T ss_dssp             EEEEEEEEEEEC--SSSEEEEEEEEEESSHHHH
T ss_pred             CEEEEEHHHHHC--CCCCEEEEEECCCCCHHHH
T ss_conf             146654135665--8874699982489747999


No 7  
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A
Probab=10.18  E-value=81  Score=13.78  Aligned_cols=12  Identities=25%  Similarity=0.570  Sum_probs=10.3

Q ss_pred             CCCCCCEEEECC
Q ss_conf             988774156308
Q gi|254781015|r   18 GKHPSPIFTTRH   29 (78)
Q Consensus        18 g~hpsp~lrtr~   29 (78)
                      |.|-+|+||++.
T Consensus         1 ~~~~~~~lr~~v   12 (126)
T 1yrk_A            1 GSHMAPFLRIAF   12 (126)
T ss_dssp             CCCCCCEEEEEE
T ss_pred             CCCCCCEEEEEE
T ss_conf             984575699998


No 8  
>3bx1_D BASI, alpha-amylase/subtilisin inhibitor; complex (proteinase/inhibitor) enzyme inhibition, savinase, barley alpha-amylase/subtilisin inhibitor; 1.85A {Hordeum vulgare} SCOP: b.42.4.1 PDB: 1ava_C 2iwt_B*
Probab=6.70  E-value=1.4e+02  Score=12.42  Aligned_cols=17  Identities=18%  Similarity=0.384  Sum_probs=11.3

Q ss_pred             CCCCCEEEEEECCCCCC
Q ss_conf             53571289994167654
Q gi|254781015|r   44 SKDKGITFKVEKVGDQH   60 (78)
Q Consensus        44 e~~~~TTF~IER~gd~~   60 (78)
                      .+..-..|+|||.++..
T Consensus       119 ~~~~~~~FkIek~~~~~  135 (181)
T 3bx1_D          119 PSGRENAFRIEKYSGAE  135 (181)
T ss_dssp             TTCCTTCEEEEECTTSC
T ss_pred             CCCCCCEEEEEECCCCC
T ss_conf             66667428999847887


No 9  
>3o12_A Uncharacterized protein YJL217W; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 1.50A {Saccharomyces cerevisiae}
Probab=6.32  E-value=1.5e+02  Score=12.30  Aligned_cols=26  Identities=15%  Similarity=0.053  Sum_probs=17.7

Q ss_pred             CCCEEEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             571289994167654302322116788642
Q gi|254781015|r   46 DKGITFKVEKVGDQHNKILLKEYSSDNNNN   75 (78)
Q Consensus        46 ~~~TTF~IER~gd~~~~~~~~~~~~d~~n~   75 (78)
                      .+-..+||+|.||.-    .-.||.||.+=
T Consensus       145 ~~~vwLRl~R~gd~~----~~~yS~DG~~W  170 (221)
T 3o12_A          145 ARDFWLRVTVEKGVL----RIQVSSDKKTW  170 (221)
T ss_dssp             TTSEEEEEEEETTEE----EEEEESSSSCC
T ss_pred             CCCEEEEEEEECCEE----EEEEECCCCCE
T ss_conf             873899999989999----99993699833


No 10 
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A*
Probab=5.73  E-value=1.6e+02  Score=12.11  Aligned_cols=13  Identities=31%  Similarity=0.442  Sum_probs=8.6

Q ss_pred             CCCCCEEEEEECC
Q ss_conf             5357128999416
Q gi|254781015|r   44 SKDKGITFKVEKV   56 (78)
Q Consensus        44 e~~~~TTF~IER~   56 (78)
                      ++++||||.|+=|
T Consensus       175 ~~g~GTtf~i~lP  187 (189)
T 1i58_A          175 EKDKGTKVTIRLP  187 (189)
T ss_dssp             ETTTEEEEEEEEE
T ss_pred             CCCCCEEEEEEEE
T ss_conf             1899779999995


Done!