BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781015|ref|YP_003065428.1| hypothetical protein
CLIBASIA_04585 [Candidatus Liberibacter asiaticus str. psy62]
         (78 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781015|ref|YP_003065428.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040692|gb|ACT57488.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 78

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/78 (100%), Positives = 78/78 (100%)

Query: 1  MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60
          MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH
Sbjct: 1  MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60

Query: 61 NKILLKEYSSDNNNNKKL 78
          NKILLKEYSSDNNNNKKL
Sbjct: 61 NKILLKEYSSDNNNNKKL 78


>gi|315122514|ref|YP_004063003.1| hypothetical protein CKC_03830 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495916|gb|ADR52515.1| hypothetical protein CKC_03830 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 138

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/79 (55%), Positives = 56/79 (70%), Gaps = 3/79 (3%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGS---GSEVSKDKGITFKVEKVGDQ 59
           + F WIL NALWNQ GKHPSPIFTTRH QS RI LGS     +  ++K +TFKV+++GD+
Sbjct: 40  VIFLWILFNALWNQKGKHPSPIFTTRHSQSNRIILGSNHNSKDFFQEKSMTFKVKRMGDR 99

Query: 60  HNKILLKEYSSDNNNNKKL 78
           ++ ILL + SS   N K L
Sbjct: 100 YDTILLHDSSSVEKNKKLL 118


>gi|218674837|ref|ZP_03524506.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli GR56]
          Length = 318

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           F+ F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 68  FVIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGDVTTFRIERPED 125


>gi|327193899|gb|EGE60774.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli CNPAF512]
          Length = 318

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 125


>gi|218508965|ref|ZP_03506843.1| putative peptidoglycan binding (cell wall degradation) protein
          [Rhizobium etli Brasil 5]
          Length = 272

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3  LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
          + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 23 VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 79


>gi|190890966|ref|YP_001977508.1| peptidoglycan binding (cell wall degradation) protein [Rhizobium
           etli CIAT 652]
 gi|218516730|ref|ZP_03513570.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli 8C-3]
 gi|190696245|gb|ACE90330.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli CIAT 652]
          Length = 318

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 125


>gi|209548488|ref|YP_002280405.1| peptidoglycan-binding protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534244|gb|ACI54179.1| Peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 307

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 58  VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGDVTTFRIERPED 114


>gi|116251151|ref|YP_766989.1| peptidoglycan binding transmembrane protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115255799|emb|CAK06880.1| putative peptidoglycan binding transmembrane protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 317

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPIFRTRDPQSPTV-LGARRPAEEQQGDVTTFRIERPQD 125


>gi|241203749|ref|YP_002974845.1| peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857639|gb|ACS55306.1| Peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 317

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPIFRTRDPQSPTV-LGARRPAEEQQGDVTTFRIERPRD 125


>gi|86356893|ref|YP_468785.1| putative peptidoglycan-binding protein (cell wall degradation
           activity) [Rhizobium etli CFN 42]
 gi|86280995|gb|ABC90058.1| putative peptidoglycan-binding protein (cell wall degradation
           activity) [Rhizobium etli CFN 42]
          Length = 296

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           F+ F ++ +NALW Q G HP PIF TR PQS  + LG+     +      TF++E+  D
Sbjct: 47  FVIFSFVAANALWYQPGLHPHPIFRTRDPQSPTV-LGARRPADEQPADVTTFRIERPED 104


>gi|218661838|ref|ZP_03517768.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli IE4771]
          Length = 318

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PI  TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPILRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 125


>gi|307304332|ref|ZP_07584084.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti
           BL225C]
 gi|307319437|ref|ZP_07598864.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti
           AK83]
 gi|306894809|gb|EFN25568.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti
           AK83]
 gi|306902800|gb|EFN33393.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti
           BL225C]
          Length = 319

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 5   FCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVGD 58
           F ++ +NA+W Q G HPSP+  TR P      + R+    G  V +    TF +E+ GD
Sbjct: 57  FSFVAANAMWYQNGTHPSPLLRTRVPLVSPEVAERLAAAKGEPVEQRDVTTFVIEREGD 115


>gi|195970188|ref|NP_385109.2| hypothetical protein SMc00060 [Sinorhizobium meliloti 1021]
 gi|187904159|emb|CAC45575.2| Hypothetical protein SMc00060 [Sinorhizobium meliloti 1021]
          Length = 319

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 5/59 (8%)

Query: 5   FCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVGD 58
           F ++ +NA+W Q G HPSP+  TR P      + R+    G  V +    TF +E+ GD
Sbjct: 57  FSFVAANAMWYQNGTHPSPLLRTRVPLVSPEVAERLAAAKGEPVEQRDVTTFVIEREGD 115


>gi|227821338|ref|YP_002825308.1| putative peptidoglycan-binding protein [Sinorhizobium fredii
           NGR234]
 gi|227340337|gb|ACP24555.1| putative peptidoglycan-binding protein [Sinorhizobium fredii
           NGR234]
          Length = 326

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 5   FCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVGDQ 59
           F ++ +NA+W Q G HPSP+  TR P      + R+   +G  V   K  TF +E+ G+ 
Sbjct: 61  FSFVAANAMWYQHGNHPSPLLRTRVPLVGPEVAERLAAANGEAVEPRKVTTFVIEREGEA 120

Query: 60  HNK 62
            ++
Sbjct: 121 RSE 123


>gi|150395842|ref|YP_001326309.1| peptidoglycan binding domain-containing protein [Sinorhizobium
           medicae WSM419]
 gi|150027357|gb|ABR59474.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium medicae
           WSM419]
          Length = 312

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 5   FCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVGD 58
           F ++ +NA+W Q G+HPSP+  TR P      + R+    G  V +    TF +E+ G+
Sbjct: 57  FSFVAANAMWYQHGRHPSPLLRTRVPLVSPEVAERLAAAKGEPVQQRNVTTFVIEREGE 115


>gi|222147979|ref|YP_002548936.1| hypothetical protein Avi_1306 [Agrobacterium vitis S4]
 gi|221734967|gb|ACM35930.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 374

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 10  SNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVS----KDKGITFKVEK 55
           +NA W Q G+HPSP   TR P  +   LG  S  S     D   TF++++
Sbjct: 55  ANAFWYQPGRHPSPFLRTRDPHDFTAMLGLNSNHSLKPDPDDVTTFRIQR 104


>gi|222085301|ref|YP_002543831.1| peptidoglycan-binding protein (cell wall degradation activity)
           [Agrobacterium radiobacter K84]
 gi|221722749|gb|ACM25905.1| peptidoglycan-binding protein (cell wall degradation activity)
           [Agrobacterium radiobacter K84]
          Length = 280

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTRHPQS-YRI-----FLGSGSEVSKDKGITFKVEK 55
           F  F ++ +NALW Q G HPSP+  TR P + Y+I     FL  G +       TF++E+
Sbjct: 74  FAVFGFVTANALWYQVGIHPSPLLRTREPGAPYQIPGRKAFL-LGQQADTGNVTTFRIER 132


>gi|322828466|gb|EFZ32254.1| trans-sialidase, putative [Trypanosoma cruzi]
          Length = 422

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 13  LWNQTGKHPSPIFTTRHPQSY-RIFLGSGSEV-SKDKGITFKVEKVGDQHNKILLKEYSS 70
           +W +T   P  IF  + PQS  R+  G GS + +KD  + F VE   ++   + L  YS 
Sbjct: 50  IWKETNDVPPTIFV-KEPQSLTRLIGGGGSGIKTKDGTLVFPVEVTKEEEKTVSLILYSK 108

Query: 71  DNNNNKKL 78
           D N N KL
Sbjct: 109 DTNTNWKL 116


>gi|304393565|ref|ZP_07375493.1| peptidoglycan-binding domain 1 protein [Ahrensia sp. R2A130]
 gi|303294572|gb|EFL88944.1| peptidoglycan-binding domain 1 protein [Ahrensia sp. R2A130]
          Length = 262

 Score = 38.9 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 13/21 (61%), Positives = 19/21 (90%)

Query: 8  ILSNALWNQTGKHPSPIFTTR 28
          I++NA+W Q GKHP+P+F+TR
Sbjct: 44 IVTNAVWYQPGKHPAPLFSTR 64


>gi|163759055|ref|ZP_02166141.1| hypothetical protein HPDFL43_04805 [Hoeflea phototrophica DFL-43]
 gi|162283459|gb|EDQ33744.1| hypothetical protein HPDFL43_04805 [Hoeflea phototrophica DFL-43]
          Length = 320

 Score = 38.5 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 14/26 (53%), Positives = 19/26 (73%)

Query: 3  LFFCWILSNALWNQTGKHPSPIFTTR 28
          + F +I +NALW+Q G HP+PI  TR
Sbjct: 35 VIFSFISANALWSQPGNHPAPILKTR 60


>gi|118593468|ref|ZP_01550848.1| hypothetical protein SIAM614_16952 [Stappia aggregata IAM 12614]
 gi|118433947|gb|EAV40605.1| hypothetical protein SIAM614_16952 [Stappia aggregata IAM 12614]
          Length = 259

 Score = 37.4 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 1  MFLFFCWILSNALWNQTGKHPSPIFTTR-HPQSYRI 35
          M L  C I++NA+  Q G+HP+P+FTTR  P S ++
Sbjct: 43 MGLTACLIVANAVGLQPGRHPAPLFTTRDRPDSMQL 78


>gi|254501042|ref|ZP_05113193.1| Putative peptidoglycan binding domain protein [Labrenzia
          alexandrii DFL-11]
 gi|222437113|gb|EEE43792.1| Putative peptidoglycan binding domain protein [Labrenzia
          alexandrii DFL-11]
          Length = 249

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 1  MFLFFCWILSNALWNQTGKHPSPIFTTR 28
          M L  C I++NAL  Q G+HP+P +TTR
Sbjct: 38 MGLTACLIVANALGLQPGRHPAPYYTTR 65


Searching..................................................done


Results from round 2




>gi|254781015|ref|YP_003065428.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040692|gb|ACT57488.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 78

 Score =  133 bits (335), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 78/78 (100%), Positives = 78/78 (100%)

Query: 1  MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60
          MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH
Sbjct: 1  MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60

Query: 61 NKILLKEYSSDNNNNKKL 78
          NKILLKEYSSDNNNNKKL
Sbjct: 61 NKILLKEYSSDNNNNKKL 78


>gi|315122514|ref|YP_004063003.1| hypothetical protein CKC_03830 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495916|gb|ADR52515.1| hypothetical protein CKC_03830 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 138

 Score =  123 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/79 (55%), Positives = 56/79 (70%), Gaps = 3/79 (3%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGS---GSEVSKDKGITFKVEKVGDQ 59
           + F WIL NALWNQ GKHPSPIFTTRH QS RI LGS     +  ++K +TFKV+++GD+
Sbjct: 40  VIFLWILFNALWNQKGKHPSPIFTTRHSQSNRIILGSNHNSKDFFQEKSMTFKVKRMGDR 99

Query: 60  HNKILLKEYSSDNNNNKKL 78
           ++ ILL + SS   N K L
Sbjct: 100 YDTILLHDSSSVEKNKKLL 118


>gi|86356893|ref|YP_468785.1| putative peptidoglycan-binding protein (cell wall degradation
           activity) [Rhizobium etli CFN 42]
 gi|86280995|gb|ABC90058.1| putative peptidoglycan-binding protein (cell wall degradation
           activity) [Rhizobium etli CFN 42]
          Length = 296

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           F+ F ++ +NALW Q G HP PIF TR PQS  + LG+     +      TF++E+  D
Sbjct: 47  FVIFSFVAANALWYQPGLHPHPIFRTRDPQSPTV-LGARRPADEQPADVTTFRIERPED 104


>gi|218674837|ref|ZP_03524506.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli GR56]
          Length = 318

 Score =  102 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           F+ F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 68  FVIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGDVTTFRIERPED 125


>gi|327193899|gb|EGE60774.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli CNPAF512]
          Length = 318

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 125


>gi|218508965|ref|ZP_03506843.1| putative peptidoglycan binding (cell wall degradation) protein
          [Rhizobium etli Brasil 5]
          Length = 272

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3  LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
          + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 23 VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 79


>gi|190890966|ref|YP_001977508.1| peptidoglycan binding (cell wall degradation) protein [Rhizobium
           etli CIAT 652]
 gi|218516730|ref|ZP_03513570.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli 8C-3]
 gi|190696245|gb|ACE90330.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli CIAT 652]
          Length = 318

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 125


>gi|209548488|ref|YP_002280405.1| peptidoglycan-binding protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534244|gb|ACI54179.1| Peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 307

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 58  VIFSFVAANALWYQPGLHPHPIFRTRDPQSSNV-LGARRPAEEQQGDVTTFRIERPED 114


>gi|116251151|ref|YP_766989.1| peptidoglycan binding transmembrane protein [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115255799|emb|CAK06880.1| putative peptidoglycan binding transmembrane protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 317

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPIFRTRDPQSPTV-LGARRPAEEQQGDVTTFRIERPQD 125


>gi|241203749|ref|YP_002974845.1| peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240857639|gb|ACS55306.1| Peptidoglycan-binding domain 1 protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 317

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PIF TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPIFRTRDPQSPTV-LGARRPAEEQQGDVTTFRIERPRD 125


>gi|218661838|ref|ZP_03517768.1| putative peptidoglycan binding (cell wall degradation) protein
           [Rhizobium etli IE4771]
          Length = 318

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           + F ++ +NALW Q G HP PI  TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 69  VIFSFVAANALWYQPGLHPHPILRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 125


>gi|218458840|ref|ZP_03498931.1| putative peptidoglycan binding (cell wall degradation) protein
          [Rhizobium etli Kim 5]
          Length = 236

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 17 TGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG--ITFKVEKVGD 58
           G HP PI  TR PQS  + LG+     + +G   TF++E+  D
Sbjct: 1  PGLHPHPILRTRDPQSSNV-LGARRPAEEQQGEVTTFRIERPED 43


>gi|325292299|ref|YP_004278163.1| peptidoglycan binding protein [Agrobacterium sp. H13-3]
 gi|325060152|gb|ADY63843.1| putative peptidoglycan binding protein [Agrobacterium sp. H13-3]
          Length = 307

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSE---VSKDKGITFKVEKVGD 58
           + F ++ +NALW Q G HPSP   TR   +     G  +     ++    TF++E+  +
Sbjct: 47  VVFGFVAANALWYQPGVHPSPFLRTRDAANPNGIAGYRAAEPLGTQGHVTTFRIERPSE 105


>gi|307304332|ref|ZP_07584084.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti
           BL225C]
 gi|307319437|ref|ZP_07598864.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti
           AK83]
 gi|306894809|gb|EFN25568.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti
           AK83]
 gi|306902800|gb|EFN33393.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium meliloti
           BL225C]
          Length = 319

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVG 57
           + F ++ +NA+W Q G HPSP+  TR P      + R+    G  V +    TF +E+ G
Sbjct: 55  VVFSFVAANAMWYQNGTHPSPLLRTRVPLVSPEVAERLAAAKGEPVEQRDVTTFVIEREG 114

Query: 58  D 58
           D
Sbjct: 115 D 115


>gi|195970188|ref|NP_385109.2| hypothetical protein SMc00060 [Sinorhizobium meliloti 1021]
 gi|187904159|emb|CAC45575.2| Hypothetical protein SMc00060 [Sinorhizobium meliloti 1021]
          Length = 319

 Score = 63.6 bits (153), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVG 57
           + F ++ +NA+W Q G HPSP+  TR P      + R+    G  V +    TF +E+ G
Sbjct: 55  VVFSFVAANAMWYQNGTHPSPLLRTRVPLVSPEVAERLAAAKGEPVEQRDVTTFVIEREG 114

Query: 58  D 58
           D
Sbjct: 115 D 115


>gi|15888260|ref|NP_353941.1| putative peptidoglycan binding protein [Agrobacterium tumefaciens
           str. C58]
 gi|15155918|gb|AAK86726.1| putative peptidoglycan binding protein [Agrobacterium tumefaciens
           str. C58]
          Length = 306

 Score = 63.6 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 3/59 (5%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSE---VSKDKGITFKVEKVGD 58
           + F ++ +NALW Q G HP+P   TR  ++     G        +     TF++E+  +
Sbjct: 50  VVFGFVAANALWYQPGVHPTPFLRTRDAENPNGIAGYRPTEPLGTHGNVTTFRIERPAE 108


>gi|150395842|ref|YP_001326309.1| peptidoglycan binding domain-containing protein [Sinorhizobium
           medicae WSM419]
 gi|150027357|gb|ABR59474.1| Peptidoglycan-binding domain 1 protein [Sinorhizobium medicae
           WSM419]
          Length = 312

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 41/79 (51%), Gaps = 9/79 (11%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVG 57
           + F ++ +NA+W Q G+HPSP+  TR P      + R+    G  V +    TF +E+ G
Sbjct: 55  VVFSFVAANAMWYQHGRHPSPLLRTRVPLVSPEVAERLAAAKGEPVQQRNVTTFVIEREG 114

Query: 58  DQHNKILLKEYSSDNNNNK 76
           +      +++ + D +N +
Sbjct: 115 ETP----VRDAAPDGSNER 129


>gi|222085301|ref|YP_002543831.1| peptidoglycan-binding protein (cell wall degradation activity)
           [Agrobacterium radiobacter K84]
 gi|221722749|gb|ACM25905.1| peptidoglycan-binding protein (cell wall degradation activity)
           [Agrobacterium radiobacter K84]
          Length = 280

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 5/59 (8%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGS-----GSEVSKDKGITFKVEK 55
           F  F ++ +NALW Q G HPSP+  TR P +     G      G +       TF++E+
Sbjct: 74  FAVFGFVTANALWYQVGIHPSPLLRTREPGAPYQIPGRKAFLLGQQADTGNVTTFRIER 132


>gi|227821338|ref|YP_002825308.1| putative peptidoglycan-binding protein [Sinorhizobium fredii
           NGR234]
 gi|227340337|gb|ACP24555.1| putative peptidoglycan-binding protein [Sinorhizobium fredii
           NGR234]
          Length = 326

 Score = 58.6 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 5/61 (8%)

Query: 3   LFFCWILSNALWNQTGKHPSPIFTTRHPQ-----SYRIFLGSGSEVSKDKGITFKVEKVG 57
           + F ++ +NA+W Q G HPSP+  TR P      + R+   +G  V   K  TF +E+ G
Sbjct: 59  VVFSFVAANAMWYQHGNHPSPLLRTRVPLVGPEVAERLAAANGEAVEPRKVTTFVIEREG 118

Query: 58  D 58
           +
Sbjct: 119 E 119


>gi|222147979|ref|YP_002548936.1| hypothetical protein Avi_1306 [Agrobacterium vitis S4]
 gi|221734967|gb|ACM35930.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 374

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 4/51 (7%)

Query: 9   LSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKG----ITFKVEK 55
            +NA W Q G+HPSP   TR P  +   LG  S  S         TF++++
Sbjct: 54  AANAFWYQPGRHPSPFLRTRDPHDFTAMLGLNSNHSLKPDPDDVTTFRIQR 104


>gi|163759055|ref|ZP_02166141.1| hypothetical protein HPDFL43_04805 [Hoeflea phototrophica DFL-43]
 gi|162283459|gb|EDQ33744.1| hypothetical protein HPDFL43_04805 [Hoeflea phototrophica DFL-43]
          Length = 320

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 9/65 (13%)

Query: 3  LFFCWILSNALWNQTGKHPSPIFTTRHPQSYR---------IFLGSGSEVSKDKGITFKV 53
          + F +I +NALW+Q G HP+PI  TR                   + ++V      TF++
Sbjct: 35 VIFSFISANALWSQPGNHPAPILKTREVGPPTAHALTPVADTAAPAVADVPARSVTTFRI 94

Query: 54 EKVGD 58
          E+  +
Sbjct: 95 ERSDE 99


>gi|304393565|ref|ZP_07375493.1| peptidoglycan-binding domain 1 protein [Ahrensia sp. R2A130]
 gi|303294572|gb|EFL88944.1| peptidoglycan-binding domain 1 protein [Ahrensia sp. R2A130]
          Length = 262

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 20/26 (76%)

Query: 3  LFFCWILSNALWNQTGKHPSPIFTTR 28
          +    I++NA+W Q GKHP+P+F+TR
Sbjct: 39 VMMAAIVTNAVWYQPGKHPAPLFSTR 64


>gi|118593468|ref|ZP_01550848.1| hypothetical protein SIAM614_16952 [Stappia aggregata IAM 12614]
 gi|118433947|gb|EAV40605.1| hypothetical protein SIAM614_16952 [Stappia aggregata IAM 12614]
          Length = 259

 Score = 40.4 bits (93), Expect = 0.092,   Method: Composition-based stats.
 Identities = 15/29 (51%), Positives = 21/29 (72%)

Query: 1  MFLFFCWILSNALWNQTGKHPSPIFTTRH 29
          M L  C I++NA+  Q G+HP+P+FTTR 
Sbjct: 43 MGLTACLIVANAVGLQPGRHPAPLFTTRD 71


>gi|13476355|ref|NP_107925.1| hypothetical protein mlr7650 [Mesorhizobium loti MAFF303099]
 gi|14027116|dbj|BAB54070.1| mlr7650 [Mesorhizobium loti MAFF303099]
          Length = 270

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%), Gaps = 6/55 (10%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKV 56
           +   ++ +NALW Q   H    F TR+ Q      G     S +   T  + + 
Sbjct: 43 LVTLFYVSANALWYQPFPHAGAFFATRNFQ------GFPHTASDEPETTINIVRP 91


>gi|254501042|ref|ZP_05113193.1| Putative peptidoglycan binding domain protein [Labrenzia
          alexandrii DFL-11]
 gi|222437113|gb|EEE43792.1| Putative peptidoglycan binding domain protein [Labrenzia
          alexandrii DFL-11]
          Length = 249

 Score = 38.9 bits (89), Expect = 0.22,   Method: Composition-based stats.
 Identities = 15/29 (51%), Positives = 20/29 (68%)

Query: 1  MFLFFCWILSNALWNQTGKHPSPIFTTRH 29
          M L  C I++NAL  Q G+HP+P +TTR 
Sbjct: 38 MGLTACLIVANALGLQPGRHPAPYYTTRD 66


>gi|319784577|ref|YP_004144053.1| peptidoglycan-binding domain 1 protein [Mesorhizobium ciceri
          biovar biserrulae WSM1271]
 gi|317170465|gb|ADV14003.1| Peptidoglycan-binding domain 1 protein [Mesorhizobium ciceri
          biovar biserrulae WSM1271]
          Length = 265

 Score = 38.1 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 12/55 (21%), Positives = 19/55 (34%), Gaps = 6/55 (10%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKV 56
           +   ++ +NALW Q   H    F TR         G       +   TF + + 
Sbjct: 43 LVTLFYVSANALWYQPFPHAGAFFATRS------IAGFPHATPDEPETTFNIVRP 91


>gi|260462409|ref|ZP_05810617.1| Peptidoglycan-binding domain 1 protein [Mesorhizobium
          opportunistum WSM2075]
 gi|259031903|gb|EEW33171.1| Peptidoglycan-binding domain 1 protein [Mesorhizobium
          opportunistum WSM2075]
          Length = 278

 Score = 38.1 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 6/55 (10%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKV 56
           +   ++ +NALW Q   H    F TR  Q      G     + +   T  + + 
Sbjct: 43 LVTLFYVSANALWYQPFPHAGAFFATRSFQ------GFPHTATDEPETTINIVRP 91


>gi|239831438|ref|ZP_04679767.1| peptidoglycan binding domain-containing protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239823705|gb|EEQ95273.1| peptidoglycan binding domain-containing protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 123

 Score = 37.0 bits (84), Expect = 0.92,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 21/54 (38%), Gaps = 5/54 (9%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTR-----HPQSYRIFLGSGSEVSKDKGIT 50
            +   ++ +NALW Q   H +  F TR     +P    +  G+ +        T
Sbjct: 47  LVVMSFVSANALWYQPEAHNAVFFRTRPDFVFNPTPRAVLPGTAAASDNAPKPT 100


>gi|163842856|ref|YP_001627260.1| peptidoglycan binding domain-containing protein [Brucella suis ATCC
           23445]
 gi|163673579|gb|ABY37690.1| Peptidoglycan-binding domain 1 protein [Brucella suis ATCC 23445]
          Length = 338

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 25/62 (40%), Gaps = 5/62 (8%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTR-----HPQSYRIFLGSGSEVSKDKGITFKVEKV 56
            +   ++ +NALW Q   H +  F TR      P       G+ +  S+DK     V + 
Sbjct: 63  LVVMGFVSANALWYQPEAHDAVFFRTRPDFVFKPTPRAALPGTAAINSEDKPAAQSVRQP 122

Query: 57  GD 58
            +
Sbjct: 123 AN 124


>gi|306842151|ref|ZP_07474820.1| peptidoglycan binding domain-containing protein [Brucella sp. BO2]
 gi|306287738|gb|EFM59169.1| peptidoglycan binding domain-containing protein [Brucella sp. BO2]
          Length = 322

 Score = 36.6 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 25/62 (40%), Gaps = 5/62 (8%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTR-----HPQSYRIFLGSGSEVSKDKGITFKVEKV 56
            +   ++ +NALW Q   H +  F TR      P    +  G+ +  S+ K     V + 
Sbjct: 47  LVVMGFVSANALWYQPEAHDAVFFRTRPDFVFKPTPRAVLPGTAAINSEGKPAAQSVRQP 106

Query: 57  GD 58
            +
Sbjct: 107 AN 108


>gi|17987639|ref|NP_540273.1| peptidoglycan binding domain-containing protein [Brucella
          melitensis bv. 1 str. 16M]
 gi|260545698|ref|ZP_05821439.1| peptidoglycan-binding domain 1 protein [Brucella abortus NCTC
          8038]
 gi|260563641|ref|ZP_05834127.1| peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1
          str. 16M]
 gi|260566833|ref|ZP_05837303.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 4 str.
          40]
 gi|261757799|ref|ZP_06001508.1| peptidoglycan-binding domain 1 protein [Brucella sp. F5/99]
 gi|265999562|ref|ZP_05466915.2| peptidoglycan binding domain-containing protein [Brucella
          melitensis bv. 2 str. 63/9]
 gi|17983350|gb|AAL52537.1| peptidoglycan binding domain containing protein [Brucella
          melitensis bv. 1 str. 16M]
 gi|260097105|gb|EEW80980.1| peptidoglycan-binding domain 1 protein [Brucella abortus NCTC
          8038]
 gi|260153657|gb|EEW88749.1| peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1
          str. 16M]
 gi|260156351|gb|EEW91431.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 4 str.
          40]
 gi|261737783|gb|EEY25779.1| peptidoglycan-binding domain 1 protein [Brucella sp. F5/99]
 gi|263094677|gb|EEZ18456.1| peptidoglycan binding domain-containing protein [Brucella
          melitensis bv. 2 str. 63/9]
 gi|326408602|gb|ADZ65667.1| Putative peptidoglycan binding domain 1 [Brucella melitensis M28]
 gi|326538323|gb|ADZ86538.1| peptidoglycan-binding domain 1 protein [Brucella melitensis
          M5-90]
          Length = 299

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTR 28
           +   ++ +NALW Q   H +  F TR
Sbjct: 24 LVVMGFVSANALWYQPEAHDAVFFRTR 50


>gi|153010008|ref|YP_001371223.1| peptidoglycan-binding domain-containing protein [Ochrobactrum
          anthropi ATCC 49188]
 gi|151561896|gb|ABS15394.1| Peptidoglycan-binding domain 1 protein [Ochrobactrum anthropi
          ATCC 49188]
          Length = 328

 Score = 36.6 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 15/27 (55%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTR 28
           +   ++ +NALW Q   H +  F+TR
Sbjct: 47 LVVMSFVSANALWYQPEAHKAVFFSTR 73


>gi|294851948|ref|ZP_06792621.1| peptidoglycan-binding protein [Brucella sp. NVSL 07-0026]
 gi|294820537|gb|EFG37536.1| peptidoglycan-binding protein [Brucella sp. NVSL 07-0026]
          Length = 338

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTR 28
           +   ++ +NALW Q   H +  F TR
Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89


>gi|306845192|ref|ZP_07477768.1| peptidoglycan binding domain-containing protein [Brucella sp. BO1]
 gi|306274351|gb|EFM56158.1| peptidoglycan binding domain-containing protein [Brucella sp. BO1]
          Length = 338

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 25/62 (40%), Gaps = 5/62 (8%)

Query: 2   FLFFCWILSNALWNQTGKHPSPIFTTR-----HPQSYRIFLGSGSEVSKDKGITFKVEKV 56
            +   ++ +NALW Q   H +  F TR      P    +  G+ +  S+ K     V + 
Sbjct: 63  LVVMGFVSANALWYQPEAHDAVFFRTRPDFVFKPTPRAVLPGTAAINSEGKPAAQSVRQP 122

Query: 57  GD 58
            +
Sbjct: 123 AN 124


>gi|62289545|ref|YP_221338.1| peptidoglycan-binding protein [Brucella abortus bv. 1 str. 9-941]
 gi|62195677|gb|AAX73977.1| hypothetical peptidoglycan-binding protein [Brucella abortus bv.
          1 str. 9-941]
          Length = 322

 Score = 36.2 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTR 28
           +   ++ +NALW Q   H +  F TR
Sbjct: 47 LVVMGFVSANALWYQPEAHDAVFFRTR 73


>gi|23501467|ref|NP_697594.1| peptidoglycan-binding protein [Brucella suis 1330]
 gi|82699474|ref|YP_414048.1| peptidoglycan binding domain-containing protein [Brucella
          melitensis biovar Abortus 2308]
 gi|148560514|ref|YP_001258575.1| putative peptidoglycan-binding protein [Brucella ovis ATCC 25840]
 gi|161618553|ref|YP_001592440.1| peptidoglycan binding domain-containing protein [Brucella canis
          ATCC 23365]
 gi|189023802|ref|YP_001934570.1| peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|225627085|ref|ZP_03785123.1| peptidoglycan-binding protein [Brucella ceti str. Cudo]
 gi|225852107|ref|YP_002732340.1| peptidoglycan-binding domain 1 protein [Brucella melitensis ATCC
          23457]
 gi|254688863|ref|ZP_05152117.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 6
          str. 870]
 gi|254696994|ref|ZP_05158822.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 2
          str. 86/8/59]
 gi|254701373|ref|ZP_05163201.1| Peptidoglycan-binding domain 1 protein [Brucella suis bv. 5 str.
          513]
 gi|254703918|ref|ZP_05165746.1| Peptidoglycan-binding domain 1 protein [Brucella suis bv. 3 str.
          686]
 gi|254707706|ref|ZP_05169534.1| Peptidoglycan-binding domain 1 protein [Brucella pinnipedialis
          M163/99/10]
 gi|254709711|ref|ZP_05171522.1| Peptidoglycan-binding domain 1 protein [Brucella pinnipedialis
          B2/94]
 gi|254712866|ref|ZP_05174677.1| Peptidoglycan-binding domain 1 protein [Brucella ceti M644/93/1]
 gi|254716780|ref|ZP_05178591.1| Peptidoglycan-binding domain 1 protein [Brucella ceti M13/05/1]
 gi|254729895|ref|ZP_05188473.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 4
          str. 292]
 gi|256031202|ref|ZP_05444816.1| Peptidoglycan-binding domain 1 protein [Brucella pinnipedialis
          M292/94/1]
 gi|256044287|ref|ZP_05447191.1| Peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1
          str. Rev.1]
 gi|256060710|ref|ZP_05450874.1| Peptidoglycan-binding domain 1 protein [Brucella neotomae 5K33]
 gi|256113120|ref|ZP_05453997.1| Peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 3
          str. Ether]
 gi|256159300|ref|ZP_05457095.1| Peptidoglycan-binding domain 1 protein [Brucella ceti M490/95/1]
 gi|256254610|ref|ZP_05460146.1| Peptidoglycan-binding domain 1 protein [Brucella ceti B1/94]
 gi|256257111|ref|ZP_05462647.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 9
          str. C68]
 gi|256369017|ref|YP_003106525.1| peptidoglycan-binding protein, putative [Brucella microti CCM
          4915]
 gi|260168338|ref|ZP_05755149.1| peptidoglycan-binding protein, putative [Brucella sp. F5/99]
 gi|260754347|ref|ZP_05866695.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 6
          str. 870]
 gi|260757566|ref|ZP_05869914.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 4
          str. 292]
 gi|260761391|ref|ZP_05873734.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 2
          str. 86/8/59]
 gi|260883372|ref|ZP_05894986.1| peptidoglycan binding domain-containing protein [Brucella abortus
          bv. 9 str. C68]
 gi|261218577|ref|ZP_05932858.1| peptidoglycan-binding domain 1 protein [Brucella ceti M13/05/1]
 gi|261221785|ref|ZP_05936066.1| peptidoglycan binding domain-containing protein [Brucella ceti
          B1/94]
 gi|261315200|ref|ZP_05954397.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis
          M163/99/10]
 gi|261317243|ref|ZP_05956440.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis
          B2/94]
 gi|261320574|ref|ZP_05959771.1| peptidoglycan-binding domain 1 protein [Brucella ceti M644/93/1]
 gi|261324701|ref|ZP_05963898.1| peptidoglycan binding domain-containing protein [Brucella
          neotomae 5K33]
 gi|261751911|ref|ZP_05995620.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 5 str.
          513]
 gi|261754569|ref|ZP_05998278.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 3 str.
          686]
 gi|265988282|ref|ZP_06100839.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis
          M292/94/1]
 gi|265990698|ref|ZP_06103255.1| peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1
          str. Rev.1]
 gi|265994530|ref|ZP_06107087.1| peptidoglycan binding domain-containing protein [Brucella
          melitensis bv. 3 str. Ether]
 gi|265997749|ref|ZP_06110306.1| peptidoglycan binding domain-containing protein [Brucella ceti
          M490/95/1]
 gi|297247958|ref|ZP_06931676.1| peptidoglycan-binding protein [Brucella abortus bv. 5 str. B3196]
 gi|23347371|gb|AAN29509.1| peptidoglycan-binding protein, putative [Brucella suis 1330]
 gi|82615575|emb|CAJ10558.1| Putative peptidoglycan binding domain 1 [Brucella melitensis
          biovar Abortus 2308]
 gi|148371771|gb|ABQ61750.1| putative peptidoglycan-binding protein [Brucella ovis ATCC 25840]
 gi|161335364|gb|ABX61669.1| Peptidoglycan-binding domain 1 protein [Brucella canis ATCC
          23365]
 gi|189019374|gb|ACD72096.1| Putative peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|225617920|gb|EEH14964.1| peptidoglycan-binding protein [Brucella ceti str. Cudo]
 gi|225640472|gb|ACO00386.1| Peptidoglycan-binding domain 1 protein [Brucella melitensis ATCC
          23457]
 gi|255999177|gb|ACU47576.1| peptidoglycan-binding protein, putative [Brucella microti CCM
          4915]
 gi|260667884|gb|EEX54824.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 4
          str. 292]
 gi|260671823|gb|EEX58644.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 2
          str. 86/8/59]
 gi|260674455|gb|EEX61276.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 6
          str. 870]
 gi|260872900|gb|EEX79969.1| peptidoglycan binding domain-containing protein [Brucella abortus
          bv. 9 str. C68]
 gi|260920369|gb|EEX87022.1| peptidoglycan binding domain-containing protein [Brucella ceti
          B1/94]
 gi|260923666|gb|EEX90234.1| peptidoglycan-binding domain 1 protein [Brucella ceti M13/05/1]
 gi|261293264|gb|EEX96760.1| peptidoglycan-binding domain 1 protein [Brucella ceti M644/93/1]
 gi|261296466|gb|EEX99962.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis
          B2/94]
 gi|261300681|gb|EEY04178.1| peptidoglycan binding domain-containing protein [Brucella
          neotomae 5K33]
 gi|261304226|gb|EEY07723.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis
          M163/99/10]
 gi|261741664|gb|EEY29590.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 5 str.
          513]
 gi|261744322|gb|EEY32248.1| peptidoglycan-binding domain 1 protein [Brucella suis bv. 3 str.
          686]
 gi|262552217|gb|EEZ08207.1| peptidoglycan binding domain-containing protein [Brucella ceti
          M490/95/1]
 gi|262765643|gb|EEZ11432.1| peptidoglycan binding domain-containing protein [Brucella
          melitensis bv. 3 str. Ether]
 gi|263001482|gb|EEZ14057.1| peptidoglycan-binding domain 1 protein [Brucella melitensis bv. 1
          str. Rev.1]
 gi|264660479|gb|EEZ30740.1| peptidoglycan-binding domain 1 protein [Brucella pinnipedialis
          M292/94/1]
 gi|297175127|gb|EFH34474.1| peptidoglycan-binding protein [Brucella abortus bv. 5 str. B3196]
          Length = 338

 Score = 36.2 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTR 28
           +   ++ +NALW Q   H +  F TR
Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89


>gi|254693344|ref|ZP_05155172.1| Peptidoglycan-binding domain 1 protein [Brucella abortus bv. 3
          str. Tulya]
 gi|261213593|ref|ZP_05927874.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 3
          str. Tulya]
 gi|260915200|gb|EEX82061.1| peptidoglycan-binding domain 1 protein [Brucella abortus bv. 3
          str. Tulya]
          Length = 338

 Score = 36.2 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTR 28
           +   ++ +NALW Q   H +  F TR
Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89


>gi|254718729|ref|ZP_05180540.1| Peptidoglycan-binding domain 1 protein [Brucella sp. 83/13]
 gi|265983705|ref|ZP_06096440.1| peptidoglycan-binding domain 1 protein [Brucella sp. 83/13]
 gi|306838707|ref|ZP_07471542.1| peptidoglycan binding domain-containing protein [Brucella sp. NF
          2653]
 gi|264662297|gb|EEZ32558.1| peptidoglycan-binding domain 1 protein [Brucella sp. 83/13]
 gi|306406194|gb|EFM62438.1| peptidoglycan binding domain-containing protein [Brucella sp. NF
          2653]
          Length = 338

 Score = 35.8 bits (81), Expect = 1.8,   Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 2  FLFFCWILSNALWNQTGKHPSPIFTTR 28
           +   ++ +NALW Q   H +  F TR
Sbjct: 63 LVVMGFVSANALWYQPEAHDAVFFRTR 89


>gi|73978545|ref|XP_849583.1| PREDICTED: similar to sal-like 4 [Canis familiaris]
          Length = 322

 Score = 35.4 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 11/43 (25%), Positives = 17/43 (39%)

Query: 17  TGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQ 59
            G  P     TR     R   G G + S ++    +V+  GD+
Sbjct: 236 PGLSPPLAARTRRQAKPRGRTGCGKDFSSERSSNSRVDSPGDR 278


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.310    0.132    0.380 

Lambda     K      H
   0.267   0.0407    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,374,134,638
Number of Sequences: 14124377
Number of extensions: 43272005
Number of successful extensions: 118609
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 57
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 118526
Number of HSP's gapped (non-prelim): 61
length of query: 78
length of database: 4,842,793,630
effective HSP length: 49
effective length of query: 29
effective length of database: 4,150,699,157
effective search space: 120370275553
effective search space used: 120370275553
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.2 bits)
S2: 75 (33.5 bits)