BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781015|ref|YP_003065428.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter asiaticus str. psy62] (78 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781015|ref|YP_003065428.1| hypothetical protein CLIBASIA_04585 [Candidatus Liberibacter asiaticus str. psy62] Length = 78 Score = 164 bits (414), Expect = 4e-43, Method: Compositional matrix adjust. Identities = 78/78 (100%), Positives = 78/78 (100%) Query: 1 MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60 MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH Sbjct: 1 MFLFFCWILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQH 60 Query: 61 NKILLKEYSSDNNNNKKL 78 NKILLKEYSSDNNNNKKL Sbjct: 61 NKILLKEYSSDNNNNKKL 78 >gi|254780466|ref|YP_003064879.1| putative modification methylase [Candidatus Liberibacter asiaticus str. psy62] Length = 375 Score = 25.8 bits (55), Expect = 0.14, Method: Compositional matrix adjust. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Query: 7 WILSNALWNQTGKHPSPIFTTRHPQSYRIFLGSGSEVSKDKGITFKVEKVGDQHNKILLK 66 WIL++ +W ++ +P P F R Q+ L S K KG TF + + + + ++ Sbjct: 124 WILNDIVWRKS--NPMPNFRGRRFQNAHETLIWASPSPKAKGYTFNYDALKAANEDVQMR 181 >gi|254780928|ref|YP_003065341.1| histidyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 496 Score = 21.6 bits (44), Expect = 2.9, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 52 KVEKVGDQHNKILLKEYSSDNNNN 75 K++K G Q K+LL E +DN+ + Sbjct: 202 KLDKFGLQGVKLLLGEGRTDNSGD 225 >gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Score = 20.8 bits (42), Expect = 4.1, Method: Composition-based stats. Identities = 8/30 (26%), Positives = 15/30 (50%) Query: 23 PIFTTRHPQSYRIFLGSGSEVSKDKGITFK 52 PI P + + +G G+ V +D ++K Sbjct: 334 PIMIEESPHAVNLPVGKGTTVFRDVFFSYK 363 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 20.4 bits (41), Expect = 6.6, Method: Compositional matrix adjust. Identities = 9/39 (23%), Positives = 19/39 (48%), Gaps = 5/39 (12%) Query: 29 HPQSYRIFLGSGSEVSKD-----KGITFKVEKVGDQHNK 62 H R+F+ + KD + I +K++++ D H + Sbjct: 360 HDIIQRLFIAQSCDHDKDNASSNQNIEYKIDEIEDIHQR 398 >gi|254781204|ref|YP_003065617.1| hypothetical protein CLIBASIA_05555 [Candidatus Liberibacter asiaticus str. psy62] Length = 707 Score = 19.6 bits (39), Expect = 8.9, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 17/36 (47%) Query: 41 SEVSKDKGITFKVEKVGDQHNKILLKEYSSDNNNNK 76 SE S D V G +H K Y++D+ +NK Sbjct: 512 SEFSDDAKNAAMVILSGMKHQKDTETRYNTDHKSNK 547 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.135 0.419 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,088 Number of Sequences: 1233 Number of extensions: 1806 Number of successful extensions: 8 Number of sequences better than 100.0: 8 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of query: 78 length of database: 328,796 effective HSP length: 48 effective length of query: 30 effective length of database: 269,612 effective search space: 8088360 effective search space used: 8088360 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (20.8 bits) S2: 31 (16.5 bits)