HHsearch alignment of GI: 254781016 and MMDB domain: 3lto_A_1-172

>3lto_A (A:1-172) Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila}
Probab=99.88  E-value=6.3e-22  Score=173.21  Aligned_cols=153  Identities=36%  Similarity=0.462  Sum_probs=129.7

Q ss_pred             CEEEECCCCEEEEECCCCCCHHHCCCCCCCEEEEECCCCEEEEEEECCC---CCCEEEECCEECCCCC-HHHHHHHHHHH
Q ss_conf             3789748842488116776701175789843468127810799997178---8857998787256652-06899999974
Q gi|254781016|r   23 KSSAFLPSNIALCKYWGKRDSKLNLPLNNSLSLSLGHLGTITHITVIDS---DADCIILNGQKISSQS-SFFKKTTQFCD   98 (355)
Q Consensus        23 ~~ta~ap~NIALIKYWGK~d~~l~lP~n~SiS~TL~~~~T~T~v~~~~~---~~d~~~lnG~~~~~~~-~~~~ri~~~l~   98 (355)
                      .+|++||.+|.|+|||||+++...+|..++|+++++...+.|..+....   ..|+++++|+.....+ .....+.+.++
T Consensus         2 ~~t~~Ap~kI~L~~~~g~~~~~~~~~~~~~i~~a~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~n~v~~~~~   81 (172)
T 3lto_A            2 HWFAQAPANIALIKYXGKKDENSNLPDNSSLSYTLSNLLSSVKLEKLPTKKDIWEPLTIPGAPEFNLSVEAQKRFIDHLV   81 (172)
T ss_dssp             EEEEEEEEEEEEECCTTCBCTTTCCBSSCEEEEEEEEEEEEEEEEECSSSSCEECCBCTTSSBCCCCCSHHHHHHHHHHH
T ss_pred             CCEEECCCEEEEEEECCCCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             83537655478984046468777789998115683698457999972577741037898981412315799999999999


Q ss_pred             HHHHHCC--CEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCC-----CCCHHHHHHHHHHCCCCCHHHHCCCCHHC
Q ss_conf             2167619--4399998502332110123224799999999998188-----99988999886521353034310562002
Q gi|254781016|r   99 LFRQFSK--VYFLIETSNNIPTKAGLASSASGFAALTLALFRIYSI-----PEKSESLSRVARLGSGSACRSFYRGFCEW  171 (355)
Q Consensus        99 ~~r~~~~--~~~~I~S~N~fPtaaGLASSASgfAALa~Al~~~~~~-----~~~~~~lS~lARlGSGSA~RSi~GG~v~W  171 (355)
                      .+++...  ..+.|..++++|+++||+||||..+|+..|+++++++     ++...++..+++.+++++|||+||||+.|
T Consensus        82 ~~~~~~~~~~~~~i~i~~~iP~~~GLGSSaa~~~a~~~al~~l~~~~l~~~~l~~~~~~~~~~~~g~d~~~~~~GG~~~~  161 (172)
T 3lto_A           82 RLKEYFGYVGGFLIQSSNNFPHSSGLASSASSFAALTKCASIALSELTQKPLPSIDEQAQLSRLGSGSSCRSFYAPWALW  161 (172)
T ss_dssp             HHHHHHTCCCCEEEEEEESSCTTTTCCCHHHHHHHHHHHHHHHHHHHHTCCCCCHHHHHHHHHTTCGGGGGGGSCSEEEE
T ss_pred             HHHHHCCCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCHHCCCEEEE
T ss_conf             99987699834999994588652343305678999999999997524015434789999998625998580220882799


Q ss_pred             CCCC
Q ss_conf             5789
Q gi|254781016|r  172 ICGT  175 (355)
Q Consensus       172 ~~g~  175 (355)
                      ..+.
T Consensus       162 ~~~~  165 (172)
T 3lto_A          162 TGDK  165 (172)
T ss_dssp             ETTE
T ss_pred             ECCC
T ss_conf             7488