>TIGR01220 Pmev_kin_Gr_pos phosphomevalonate kinase; InterPro: IPR005917 Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. The enzymes fall into two broad classes, characterised with respect to substrate specificity: serine/threonine specific and tyrosine specific . Protein kinase function has been evolutionarily conserved from Escherichia coli to Homo sapiens. Protein kinases play a role in a mulititude of cellular processes, including division, proliferation, apoptosis, and differentiation . Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved , leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases . Phosphomevalonate kinase (2.7.4.2 from EC)catalyzes the phosphorylation of 5-phosphomevalonate into 5-diphosphomevalonate, an essential step in isoprenoid biosynthesis via the mevalonate pathway. This pathway starts with three molecules of acetyl-CoA, which, in a series of six different enzyme reactions, are converted to isopentanyl pyrophosphate (IPP), the basic C5 isoprene unit and a common intermediate for a number of pathways including isoprenoid and cholesterol biosynthesis. There are two unrelated types of PMK. The first type belongs to the GHMP kinase and includes a eukaryotic group which is typified by Saccharomyces cerevisiae ERG8 and a bacterial group typified by by Streptococcus pneumoniae PMK (MvaK2) . The second type includes animal PMKs, typified by human PMK . PMKs of the first type are present in eubacteria, fungi, and plants, while the second type is found only in animals, indicative of a nonorthologous gene displacement early in animal evolution . PMKs of the GHMP kinase type are closely related to mevalonate kinases. The two types of PMK have different consensus ATP-binding motifs: a protein kinase motif in the ERG8 orthologs versus a P-loop or Walker A motif in the animal orthologs. The fact that ERG8 orthologs are found in pathogenic eubacteria and fungi but not in humans makes them attractive targets for the development of antibacterial and/or antifungal drugs . This group of enzymes belongs to the GHMP kinase domain superfamily. GHMP kinases are a unique class of ATP-dependent enzymes (the abbreviation of which refers to the original members: galactokinase, homoserine kinase, mevalonate kinase, and phosphomevalonate kinase) . Enzymes belonging to this superfamily contain three well-conserved motifs, the second of which has the typical sequence Pro-X-X-X-Gly-Leu-X-Ser-Ser-Ala and is involved in ATP binding . The phosphate binding loop in GHMP kinases is distinct from the classical P-loops found in many ATP/GTP binding proteins. The bound ADP molecule adopts a rare syn conformation and is in the opposite orientation from those bound to the P-loop-containing proteins . GHMP kinases display a distinctly bilobal appearance with their N-terminal subdomains dominated by a mixed beta-sheet flanked on one side by alpha-helices and their C-terminal subdomains containing a four stranded anti-parallel beta-sheet , , , ..

Probab=100.00 E-value=3.1e-43 Score=291.18 Aligned_cols=293 Identities=20% Similarity=0.204 Sum_probs=227.4 Q ss_pred EEECCCEEEEECCCEEEC-CCEEEEEEECCCEEEEEEECC---CCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC Q ss_conf 998581799974454407-954899876672799999848---9829999557666753210012333343321111122 Q gi|254781018|r 12 HSIAPAKVILSGEYSSLY-GASALAVAITFYLRALLTTIE---PSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKK 87 (337) Q Consensus 12 ~~~APGKi~L~GEh~v~~-G~~ai~~aI~~~~~v~i~~~~---~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 87 (337) T Consensus 2 ~v~aPGKLfvAGEYAVvePG~pailvAVDrfvtvtve~~~adt~~~~~i~S~~l~~~pv-~w~r~~g~lv~~d~~d---G 77 (367) T TIGR01220 2 EVKAPGKLFVAGEYAVVEPGYPAILVAVDRFVTVTVEDADADTDAADVIQSSDLSSEPV-RWRRRDGKLVVDDADD---G 77 (367) T ss_pred EEECCCCEEEEEEEEEECCCCCEEEEEECCEEEEEEECCCCCCCCCCCEEECCCCCCCC-EEEEECCEEEEECCCC---C T ss_conf 02089630662013443777955999975658999863567543445145211477760-3464268578723774---3 Q ss_pred CCHHHHHHHHHHHH--HHHHHHCCCCCCCCEEEEEECCCCC----CCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHH Q ss_conf 10334777888999--9987511566788769999805541----03898530378999999999818775402589999 Q gi|254781018|r 88 IPITSVLTHPNDLI--LYIFNRHLPHISCGISLDLHSTIPI----GSGFGSSSAIISALSLALSSITHQPFCNKEKLIAE 161 (337) Q Consensus 88 ~~~~~~~~~~~~~~--~~~~~~~~~~~~~g~~i~i~s~iP~----~~GLGSSaA~~va~~~al~~~~~~~~~~~~~~~~~ 161 (337) T Consensus 78 qqA~s~l~yVv~AIe~~e~ya~e~n~kl~~~hL~v~S~Ld~~~GrKyGLGSSgAVtV~tVkAln~Fydl~Ls-n~eifkL 156 (367) T TIGR01220 78 QQAESALKYVVAAIEVVEKYARERNKKLKAYHLEVSSELDEADGRKYGLGSSGAVTVATVKALNAFYDLELS-NEEIFKL 156 (367) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEEEECCCCCEECCCCHHHHHHHHHHHHHHHCCCCCC-HHHHHHH T ss_conf 556645787667899999997650971102676687641057884504662078999999999986287757-5678899 Q ss_pred HHHHHHCCCCCCCCHHHHHHHHCCCEEEECCCC-------------------------CCCCCCCCCEEEEECCCCCCCH Q ss_conf 998641157787734578765326302402785-------------------------2001478843999749714537 Q gi|254781018|r 162 TGYIERLQHGKTGIIDSTTIVMGGIIYINPPQI-------------------------IKNETLVGEWWAINTGMPESST 216 (337) Q Consensus 162 a~~~e~~~~~~~sg~D~~~~~~gg~~~~~~~~~-------------------------~~~~~~~~~~~~i~~~~~~~st 216 (337) T Consensus 157 a~la~~~lq~~gScGDiAaS~ygGWiAystfDhdwV~q~~~~~~v~~~L~~~WPgl~i~pL~aPk~l~lliGWTGsPASt 236 (367) T TIGR01220 157 AVLATLELQSKGSCGDIAASVYGGWIAYSTFDHDWVKQKVEEVSVDEVLKKDWPGLSIEPLKAPKNLELLIGWTGSPAST 236 (367) T ss_pred HHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHCHHHHHHCCCCCCEEECCCCCCCCEEEEEECCCCCCC T ss_conf 89864220689975411110111033305766688875541303588861477885022067998677988631788777 Q ss_pred HHHHHHHHHHHCCC-----HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHC------CCCCHHHHHHHHHHHH Q ss_conf 99999999764120-----689998765489999998387216899999959999971------8997799999999985 Q gi|254781018|r 217 GECVSFVEQHFSQS-----SIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESI------GVVPETVGKFIRCIEN 285 (337) Q Consensus 217 ~~~~~~~~~~~~~~-----~~~~~~~~i~~~~~~al~~~d~~~l~~~~~~~~~ll~~l------~vs~~~l~~l~~~~~~ 285 (337) T Consensus 237 ~~LVs~vhr~k~~~~a~y~rFl~~s~~CVe~~i~af~tg~i~~~~k~Ir~nR~~la~ld~e~gv~IeTe~Lk~LCD~aE~ 316 (367) T TIGR01220 237 ADLVSEVHRRKEEKSAAYERFLEKSRDCVESLITAFETGDIKSVQKEIRKNRQLLARLDDEVGVDIETEKLKALCDLAEA 316 (367) T ss_pred HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEECHHHHHHHHHHHH T ss_conf 67888887404676236888887678999999864315773257888899999998510114202344436655426431 Q ss_pred CCCEEEECCCCCCCCCEEEEEEEECCC Q ss_conf 798089507886788508999985799 Q gi|254781018|r 286 NGGSAKIAGAGSIRGEKAGLVLVGGYN 312 (337) Q Consensus 286 ~g~~ak~sGAG~~~Gg~~~~~l~~~~~ 312 (337) T Consensus 317 yggAAK~SGAG---GGDCGIai~d~~~ 340 (367) T TIGR01220 317 YGGAAKSSGAG---GGDCGIAILDAKA 340 (367) T ss_pred CCCCCCCCCCC---CCCHHHHEEHHHH T ss_conf 11223778888---7441121220023

HHsearch alignment for GI: 254781018 and conserved domain: TIGR01220