HHsearch alignment for GI: 254781020 and conserved domain: TIGR01305

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase; InterPro: IPR005993 Guanosine monophosphate reductase (1.7.1.7 from EC) catalyzes the irreversible and NADPH-dependent reductive deamination of GMP into IMP. NADPH + guanosine 5-phosphate = NADP+ + inosine 5-phosphate + NH3 It converts nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and maintains intracellular balance of A and G nucleotides. A deep split separates two families of GMP reductase. This family includes both eukaryotic and some proteobacterial sequences. ; GO: 0003920 GMP reductase activity, 0009117 nucleotide metabolic process.
Probab=99.77  E-value=1.7e-17  Score=121.30  Aligned_cols=277  Identities=16%  Similarity=0.145  Sum_probs=191.8

Q ss_pred             HHHHHHHHEEECCCCCCCCHHHCCCEEEEC----CEEEC-CCEEEECHHHHHHHHCHHHHHHHHHHHHHHCCEEECCCCH
Q ss_conf             475688630324557899810174629989----89625-6868501266334300025699999999809906605202
Q gi|254781020|r   22 NKKFFDDWHLIHRALPEISFDEVDPSVEFL----GKKLS-FPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQR   96 (337)
Q Consensus        22 n~~~fd~~~l~p~~l~~~~~~~vdlst~i~----G~~l~-~Pv~iapmsgg~~~~~~~~~~~lA~aa~~~g~~~~~g~~~   96 (337)
T Consensus         6 ~kl~fkdvl~rPkrs~lksr~~v~l~r~~~f~~s~~~~~G~P~~~~nmdtvGt-------f~ma~~l~~~~~~t~~h---   75 (343)
T TIGR01305         6 LKLDFKDVLLRPKRSTLKSRADVELEREFTFRNSKQTYSGVPIIAANMDTVGT-------FEMAAALASHKILTAIH---   75 (343)
T ss_pred             CCCCCEEEEECCCCCCCCCCCCCEECCEEEEECCCCEECCCCEEEECCCCCHH-------HHHHHHHHHHHHHHHHH---
T ss_conf             25562014641661001121100001002331146600354267633542105-------78999875225664666---


Q ss_pred             HHHCCHHHHHHHHHHHHCCCHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCC-EEEECCCCHHHHHHHCCCCCHHHHHHHH
Q ss_conf             211286688899999866401232202752123679989999877650898-5762532035665206885243079999
Q gi|254781020|r   97 VMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGAD-GLFLHLNPLQEIIQPNGNTNFADLSSKI  175 (337)
Q Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~i  175 (337)
T Consensus        76 khys---~~~W~~f-~~~~~~~~l~~~~~s~G~~~~d~~k~~~~~~~~P~~~~~C--~dva--------nGyse~fv~f~  141 (343)
T TIGR01305        76 KHYS---VDEWKAF-AASASPDVLKNVAVSSGSSDNDLEKLKSILEEVPQLKFIC--LDVA--------NGYSEHFVEFV  141 (343)
T ss_pred             HHCC---HHHHHHH-HHCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCEEEE--EEEC--------CCCHHHHHHHH
T ss_conf             5303---6889998-7213345765433305885446899999997267703799--8603--------56217899999


Q ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHCCCCCCCCHHHHHCCCCHHHHHHHHHHH
Q ss_conf             99998739971785047866889999999769979994588886510012310234432324431063468899999852
Q gi|254781020|r  176 ALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPY  255 (337)
Q Consensus       176 ~~l~~~~~~pii~k~v~~~~~~~~~~~a~~aGad~i~v~~~gG~~~~~~~~~r~~~~~~~~~~~~~gi~~~~al~~~~~~  255 (337)
T Consensus       142 ~~~r~~~P~~ti~--aGnvvtGem~eelilsGadi~kvG~GPGsv----Cttr--------~k~GvGyPqlsav~eCad~  207 (343)
T TIGR01305       142 KKVREAYPKKTIM--AGNVVTGEMVEELILSGADIVKVGIGPGSV----CTTR--------KKTGVGYPQLSAVIECADA  207 (343)
T ss_pred             HHHHHHCCCCEEE--ECCCEEHHHHHHHHHCCCCEEEECCCCCCE----ECCC--------CCCCCCCHHHHHHHHHHHH
T ss_conf             9999736533043--134100467787773476379963588750----1122--------0045675136676543210


Q ss_pred             CCC--CEEEECCCCCCHHHHHHHHHHCCCEEHHHHHHHHH--------------------------------------HC
Q ss_conf             289--87997298888899999998388852334799998--------------------------------------41
Q gi|254781020|r  256 CNE--AQFIASGGLRNGVDILKSIILGASLGGLASPFLKP--------------------------------------AM  295 (337)
Q Consensus       256 ~~~--v~IiadGGIr~g~Dv~kAlalGAdaV~iGr~~l~~--------------------------------------~~  295 (337)
T Consensus       208 ahGl~G~~~sdGGC~~PGdvakaf~~gadfvm~GG~~~Gh~~~~G~~~e~nG~k~~lfyGmss~~am~~h~G~vaeyra~  287 (343)
T TIGR01305       208 AHGLKGHIVSDGGCTTPGDVAKAFGAGADFVMLGGLLAGHEESGGEVVEENGKKFKLFYGMSSDTAMKKHAGGVAEYRAS  287 (343)
T ss_pred             CCCCCCEEEECCCCCCCHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHCCCCEEEEEECCCHHHHHHHCCCCCCEEECC
T ss_conf             15755248726888981267887734777676522011532101145220686588875155267775315751001126


Q ss_pred             CCH-------HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHCCCCCCCC
Q ss_conf             466-------89999999999999999998089857896149600056
Q gi|254781020|r  296 DSS-------DAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRH  336 (337)
Q Consensus       296 ~G~-------~gv~~~l~~l~~el~~~m~~~G~~~i~el~~~~~~i~~  336 (337)
T Consensus       288 eGktv~~P~~G~v~~t~~dilGG~rs~Cty~Ga~~lkel~~r~tfirv  335 (343)
T TIGR01305       288 EGKTVKVPYRGDVENTVRDILGGLRSACTYVGAKKLKELAKRATFIRV  335 (343)
T ss_pred             CCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCEEEEEE
T ss_conf             885787214577467999873004455566547888876410014687