HHsearch alignment for GI: 254781020 and conserved domain: pfam00218

>pfam00218 IGPS Indole-3-glycerol phosphate synthase.
Probab=98.35  E-value=1.4e-05  Score=51.24  Aligned_cols=124  Identities=16%  Similarity=0.230  Sum_probs=77.8

Q ss_pred             HHHHHHHHHHHCCCEEEECCCCHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCCCCEEEE
Q ss_conf             89999877650898576253203566520688524307999999998739971785047866889999999769979994
Q gi|254781020|r  134 VQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDI  213 (337)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~~~~pii~k~v~~~~~~~~~~~a~~aGad~i~v  213 (337)
T Consensus       121 ~yQI~ea-r~~GADaiLLI~~~L~~-----------~~l~~l~~~a~~lgl~~LvE----vh~~~El~~al~~~a~iIGI  184 (254)
T pfam00218       121 EYQIYEA-RAYGADTVLLIVAVLSD-----------ELLEELYEYARSLGMEPLVE----VHNEEELERALALGAKLIGV  184 (254)
T ss_pred             HHHHHHH-HHCCCCEEEHHHHCCCH-----------HHHHHHHHHHHHHCCEEEEE----ECCHHHHHHHHHCCCCEEEE
T ss_conf             9999999-98088863144711999-----------99999999999848867988----68999999998489978963


Q ss_pred             CCCCCCCCCCHHHHCCCCCCCCHHHHHCCCCHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCEEHHHHHHHHH
Q ss_conf             58888651001231023443232443106346889999985228987997298888899999998388852334799998
Q gi|254781020|r  214 AGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKP  293 (337)
Q Consensus       214 ~~~gG~~~~~~~~~r~~~~~~~~~~~~~gi~~~~al~~~~~~~~~v~IiadGGIr~g~Dv~kAlalGAdaV~iGr~~l~~  293 (337)
T Consensus       185 NNRnL~tf~v------------------d~~~t~~L~--~~ip~~~~~VsESGI~~~~di~~l~~~G~~~~LIGe~lm~~  244 (254)
T pfam00218       185 NNRNLKTFEV------------------DLNTTRRLA--PMVPEDVLLVAESGISTPEDVEKLAKHGANAFLVGESLMRA  244 (254)
T ss_pred             CCCCHHHHHC------------------CHHHHHHHH--HHCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEECHHHHCC
T ss_conf             2788465100------------------579999999--55898987998389999999999998799999989687579