HHsearch alignment for GI: 254781020 and conserved domain: pfam00724

>pfam00724 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase family.
Probab=98.75  E-value=5e-06  Score=53.83  Aligned_cols=146  Identities=14%  Similarity=0.032  Sum_probs=86.1

Q ss_pred             HHHHHHHCCCEEEECCCCHHH---HHHH----CCCCC-------HHHHHHHHHHHHHHCC--CCEEEEECCC------CC
Q ss_conf             987765089857625320356---6520----68852-------4307999999998739--9717850478------66
Q gi|254781020|r  138 HQAVHVLGADGLFLHLNPLQE---IIQP----NGNTN-------FADLSSKIALLSSAMD--VPLLLKEVGC------GL  195 (337)
Q Consensus       138 ~~~~~~~~~~~~~~~~~~~~~---~~~~----~~~~~-------~~~~~~~i~~l~~~~~--~pii~k~v~~------~~  195 (337)
T Consensus       149 A~rA~~AGfDGVEIh~ahGyLl~QFLSp~~N~RtDeYGGslENR~Rf~~eIi~aIR~~vg~d~~i~vRis~~d~~~~g~~  228 (336)
T pfam00724       149 AKRAVEAGFDGVEIHGAHGYLLDQFLSPGSNKRTDEYGGSIENRARFPLEVVDAVKEAVGEDRPIGYRLSPDDVFEGGLT  228 (336)
T ss_pred             HHHHHHCCCCEEEECHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCC
T ss_conf             99999829998996142678999862876588977678898897548999999999972877664267465224689988


Q ss_pred             CHH----HHHHHHHCCCCEEEECCCCCCCCCCHHHHCCCCCCCCHHHHHCCCCHHHHHHHHHHHCCCCEEEECCCCCCHH
Q ss_conf             889----9999997699799945888865100123102344323244310634688999998522898799729888889
Q gi|254781020|r  196 SSM----DIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGV  271 (337)
Q Consensus       196 ~~~----~~~~a~~aGad~i~v~~~gG~~~~~~~~~r~~~~~~~~~~~~~gi~~~~al~~~~~~~~~v~IiadGGIr~g~  271 (337)
T Consensus       229 ~~e~~~~~~~~~~~~g~d~~~~~~~~~~~~~~~~~~---~~~~----~~~~~-~~~~~~~~k~-~~~~pvi~~G~i~~~~  299 (336)
T pfam00724       229 GAETLAQFAYAAGELGVRVLDGTRLAYIHAIEPRVT---GPFP----VETGQ-QVENNEFIKK-VWKGPVITVGRINDPE  299 (336)
T ss_pred             CHHHHHHHHHHHHHHCCCEEECCCCCEEECCCCCCC---CCCC----CCCCH-HHHHHHHHHH-HCCCEEEEECCCCCHH
T ss_conf             426899999999983877564276622320244335---7877----56312-4789999998-7698599969999899


Q ss_pred             HHHHHHHHC-CCEEHHHHHHHH
Q ss_conf             999999838-885233479999
Q gi|254781020|r  272 DILKSIILG-ASLGGLASPFLK  292 (337)
Q Consensus       272 Dv~kAlalG-AdaV~iGr~~l~  292 (337)
T Consensus       300 ~ae~~l~~g~~D~V~~gR~~ia  321 (336)
T pfam00724       300 FAAEIVEEGRADLVAMGRPFLA  321 (336)
T ss_pred             HHHHHHHCCCCEEHHHHHHHHH
T ss_conf             9999998799443686699997