RPSBLAST alignment for GI: 254781020 and conserved domain: cd02811

>gnl|CDD|73373 cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain. Two types of IDIs have been characterized at present. The long known IDI-1 is only dependent on divalent metals for activity, whereas IDI-2 requires a metal, FMN and NADPH. IDI-2 catalyzes the interconversion of isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP) in the mevalonate pathway.. Length = 326
 Score =  393 bits (1011), Expect = e-110
 Identities = 150/326 (46%), Positives = 211/326 (64%), Gaps = 5/326 (1%)

Query: 5   RKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSM 64
           RK +H+ +  ++         FDD  L+H ALPE+  D++D S EFLGK+LS PLLIS+M
Sbjct: 1   RKDEHLELCLEENVESGGSTGFDDVRLVHNALPELDLDDIDLSTEFLGKRLSAPLLISAM 60

Query: 65  TGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFEL-RQYAPHTVLISNL 123
           TGG+ K  + INRNLA AAE+  +AM VGSQR    D    +SF + R+  P+  LI+NL
Sbjct: 61  TGGSEK-AKEINRNLAEAAEELGIAMGVGSQRAALEDPELAESFTVVREAPPNGPLIANL 119

Query: 124 GAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMD 183
           GAVQLN  +GV++A +AV ++ AD L +HLNPLQE +QP G+ +F     +I  L  A+ 
Sbjct: 120 GAVQLN-GYGVEEARRAVEMIEADALAIHLNPLQEAVQPEGDRDFRGWLERIEELVKALS 178

Query: 184 VPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHR--DLESDIGIVFQDW 241
           VP+++KEVG G+S    +    +G++  D+AG GGTSW+R+E++R  D +  +   F DW
Sbjct: 179 VPVIVKEVGFGISRETAKRLADAGVKAIDVAGAGGTSWARVENYRAKDSDQRLAEYFADW 238

Query: 242 GIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAV 301
           GIPT  SL   R    +   IASGG+RNG+DI K++ LGA L G+A PFLK A++  +AV
Sbjct: 239 GIPTAASLLEVRSALPDLPLIASGGIRNGLDIAKALALGADLVGMAGPFLKAALEGEEAV 298

Query: 302 VAAIESLRKEFIVSMFLLGTKRVQEL 327
           +  IE + +E   +MFL G K + EL
Sbjct: 299 IETIEQIIEELRTAMFLTGAKNLAEL 324