Query gi|254781022|ref|YP_003065435.1| hypothetical protein CLIBASIA_04620 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 163 No_of_seqs 116 out of 671 Neff 6.7 Searched_HMMs 39220 Date Mon May 30 05:32:57 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781022.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK11648 hypothetical protein; 100.0 0 0 282.1 15.0 163 1-163 1-164 (195) 2 COG1988 Predicted membrane-bou 99.9 8.9E-25 2.3E-29 152.2 13.9 140 1-147 1-143 (190) 3 pfam04307 DUF457 Predicted mem 99.8 2.4E-21 6.2E-26 133.7 5.9 81 40-129 1-81 (81) 4 pfam09988 DUF2227 Uncharacteri 98.2 9E-06 2.3E-10 50.1 7.8 118 2-121 3-160 (174) 5 COG2389 Uncharacterized metal- 97.7 9.1E-05 2.3E-09 44.7 5.9 75 2-79 3-84 (179) 6 pfam07155 DUF1393 Protein of u 38.6 21 0.00054 15.8 2.0 27 103-131 52-78 (169) 7 pfam06939 DUF1286 Protein of u 36.4 30 0.00077 15.0 3.1 19 1-19 1-19 (112) 8 PRK13661 hypothetical protein; 34.7 32 0.00083 14.8 2.7 23 103-126 55-77 (183) 9 pfam00882 Zn_dep_PLPC Zinc dep 34.6 30 0.00077 15.0 2.2 22 103-124 108-129 (223) 10 smart00770 Zn_dep_PLPC Zinc de 33.2 30 0.00075 15.0 2.0 21 104-124 133-153 (241) 11 COG2035 Predicted membrane pro 29.3 40 0.001 14.3 5.4 52 69-120 216-271 (276) 12 TIGR02327 int_mem_ywzB conserv 28.4 42 0.0011 14.2 2.8 20 102-121 43-63 (71) 13 PRK12377 putative replication 27.4 44 0.0011 14.1 2.1 17 2-18 112-128 (248) 14 PRK11770 hypothetical protein; 27.2 44 0.0011 14.1 3.5 30 105-134 86-126 (135) 15 KOG2896 consensus 21.3 58 0.0015 13.4 4.2 49 101-149 229-294 (377) 16 pfam12221 HflK_N Bacterial mem 21.3 40 0.001 14.3 0.9 15 44-58 24-38 (46) 17 TIGR00075 hypD hydrogenase exp 21.0 45 0.0011 14.1 1.1 40 119-158 210-249 (384) No 1 >PRK11648 hypothetical protein; Provisional Probab=100.00 E-value=0 Score=282.15 Aligned_cols=163 Identities=40% Similarity=0.784 Sum_probs=154.7 Q ss_pred CCCHHHHHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCHHHHHHHCCCCCHHHHHHH Q ss_conf 97522899999999999641132000442208999999999833600455367888850101689974165441477999 Q gi|254781022|r 1 MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILA 80 (163) Q Consensus 1 M~~~tH~~~g~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~gsllPDiD~~~s~~~~~~~~~~~~~~~~~~HRg~THSl~~ 80 (163) ||++.|++|++|+...+.++..+|....++||.+++|+.+||++||||||+|++||+++++|+++++.+||||+|||+++ T Consensus 1 MTaeGHllFsva~~i~akk~eltp~la~gdW~hii~~~~lgaLLPDIDhp~S~lGrr~~~lS~~i~~~fGHRg~THSLLa 80 (195) T PRK11648 1 MTAEGHLLFSIACAVFAKKAELTPVLAQGDWWHIIPGAILTCLLPDIDHPKSFLGQRLKWISKPIARAFGHRGFTHSLLA 80 (195) T ss_pred CCCCCEEEHHHHHHHHHHHHHCCHHHHCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHH T ss_conf 98651341689999999986068776458469886899983538888798866655507868999998387615789999 Q ss_pred HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEEE-CCCHHHHHHHHHHHHHHHH Q ss_conf 999999999997103578689999999999999999851338880314178646877873-4871889999999999999 Q gi|254781022|r 81 VILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYHWRFCLPILH-PNSPIGEIFFCVLFLIYAI 159 (163) Q Consensus 81 ~~~~~~l~~~~~~~~~~~~~~~~~~~~lG~~sHll~D~lT~~Gv~ll~Pfs~r~~~~~~~-t~~~~~~~~~~~~~~~~~~ 159 (163) ++...+++...+...+.....+..++.+||+||+++|++|+.|||+|||+++||++|+.+ +.|...|+++|+.++++++ T Consensus 81 v~~~~~l~~~~~~~~~~ip~~~~~a~i~GYLSHLlaD~LTPaGVPLLWP~k~Rf~~Pil~~~~~~~~Er~~c~ll~~~av 160 (195) T PRK11648 81 VFALLALFYLKVPETWIIPADALQGMVLGYLSHILADMLTPAGVPLLWPCRWRFRLPILAPQKGNQLERFLCMALFVWSV 160 (195) T ss_pred HHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHH T ss_conf 99999999976243465738899999999999999976185688651566403776433487662267889999999999 Q ss_pred HHHC Q ss_conf 7609 Q gi|254781022|r 160 ISVH 163 (163) Q Consensus 160 ~~v~ 163 (163) +++| T Consensus 161 ~~p~ 164 (195) T PRK11648 161 WMPQ 164 (195) T ss_pred HCCC T ss_conf 8588 No 2 >COG1988 Predicted membrane-bound metal-dependent hydrolases [General function prediction only] Probab=99.93 E-value=8.9e-25 Score=152.17 Aligned_cols=140 Identities=29% Similarity=0.424 Sum_probs=106.5 Q ss_pred CCCHHHHHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCHHHHHHHCCCCCHHHHHHH Q ss_conf 97522899999999999641132000442208999999999833600455367888850101689974165441477999 Q gi|254781022|r 1 MTYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALLSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILA 80 (163) Q Consensus 1 M~~~tH~~~g~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~gsllPDiD~~~s~~~~~~~~~~~~~~~~~~HRg~THSl~~ 80 (163) |+++||+..|++++..+.+ ......+. .+.....+++++||+|++.|..+++++..+..+.. +|||+|||+++ T Consensus 1 M~~~tH~~~g~~~~~~~~~--~~~~l~~~---~~~p~~~l~~li~~i~~~~~~~~~~l~~~~~~i~~--gHRGfTHSl~~ 73 (190) T COG1988 1 MTGKTHVLLGLALGALAVK--LALALSPV---VILPDLLLASLILDILPDLSVLGLKLPDISLYIRL--GHRGFTHSLLF 73 (190) T ss_pred CCCCCHHHHHHHHHHHHHH--HHHCCCCH---HHHHHHHHHHHHHHHCCCCHHHHHHCCHHHHHHHH--CCCCCCCHHHH T ss_conf 9863177899999876454--33014715---55378999989988714622877615257887774--65551021189 Q ss_pred HHHHHHHHHHHHHC--CCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC-CCEEEEEEECCCHHHH Q ss_conf 99999999999710--3578689999999999999999851338880314178-6468778734871889 Q gi|254781022|r 81 VILYKWLIHHFFPS--ELISYQGLQDALIIGYVSHLVADVLTPTGIPLLWPYH-WRFCLPILHPNSPIGE 147 (163) Q Consensus 81 ~~~~~~l~~~~~~~--~~~~~~~~~~~~~lG~~sHll~D~lT~~Gv~ll~Pfs-~r~~~~~~~t~~~~~~ 147 (163) +.++..++...... ....+...+.+.++|+.+|+++|++|.+|+|++||++ +|+..+.....+.... T Consensus 74 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~v~~Hil~D~~t~~g~~~l~p~~~~~~~~~~~~~~~~~~~ 143 (190) T COG1988 74 AAVALLLLGLLLFLFFLPLIFKDLLLGLFLGVFSHILLDALTTAGVPLLWPFSDTRWSALLLIITFDPVA 143 (190) T ss_pred HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCCCEEEEEEECCCCHHH T ss_conf 9999999999999952664236789999999999999999986787746413487056766304776147 No 3 >pfam04307 DUF457 Predicted membrane-bound metal-dependent hydrolase (DUF457). Family of predicted membrane-bound metal-dependent hydrolases, based on a sequence from Clostridium acetobutylicum. Probab=99.84 E-value=2.4e-21 Score=133.71 Aligned_cols=81 Identities=52% Similarity=0.895 Sum_probs=67.2 Q ss_pred HHHHCCCCCCCHHHHHHHHHCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHH Q ss_conf 99833600455367888850101689974165441477999999999999997103578689999999999999999851 Q gi|254781022|r 40 LSCLLPDIDHPRSFISKRFKTLSLLTSCISSHRGFTHSILAVILYKWLIHHFFPSELISYQGLQDALIIGYVSHLVADVL 119 (163) Q Consensus 40 ~gsllPDiD~~~s~~~~~~~~~~~~~~~~~~HRg~THSl~~~~~~~~l~~~~~~~~~~~~~~~~~~~~lG~~sHll~D~l 119 (163) +||++||+|++.+++++. ..+..+|||+|||++++++++.+........ ....+..++++||++|+++|++ T Consensus 1 ~ga~lPDiD~~~~~~~~~-------~~~~~~HRg~tHSl~~~~~~~~~~~~~~~~~--~~~~~~~~~~~g~~sHl~lD~~ 71 (81) T pfam04307 1 LGALLPDLDHPLSFIDAL-------TLSIIGHRGFTHSLLFALLLALLLLLLFLRT--GRRNLGLALLLGYLSHLLLDAL 71 (81) T ss_pred CCCCCCCCCCCCCCCCCH-------HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHC--CHHHHHHHHHHHHHHHHHHHHC T ss_conf 976587654656545318-------8898675508899999999999999999860--3689999999999999999972 Q ss_pred CCCCCCCCCC Q ss_conf 3388803141 Q gi|254781022|r 120 TPTGIPLLWP 129 (163) Q Consensus 120 T~~Gv~ll~P 129 (163) |++|+|+||| T Consensus 72 T~~Gv~lf~P 81 (81) T pfam04307 72 TPYGVPLLWP 81 (81) T ss_pred CCCCCCCCCC T ss_conf 1248806788 No 4 >pfam09988 DUF2227 Uncharacterized metal-binding protein (DUF2227). Members of this family of hypothetical bacterial proteins possess metal binding properties; however, their exact function has not, as yet, been determined. Probab=98.19 E-value=9e-06 Score=50.05 Aligned_cols=118 Identities=19% Similarity=0.154 Sum_probs=57.7 Q ss_pred CCHHHHHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHHH-HHH--HCCCCCCCHHHHHHHHH---CCHHHHHHHCCCCC-H Q ss_conf 75228999999999996411320004422089999999-998--33600455367888850---10168997416544-1 Q gi|254781022|r 2 TYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGAL-LSC--LLPDIDHPRSFISKRFK---TLSLLTSCISSHRG-F 74 (163) Q Consensus 2 ~~~tH~~~g~a~~~~~~~~~~~~~~~~~~~~~~l~~~~-~gs--llPDiD~~~s~~~~~~~---~~~~~~~~~~~HRg-~ 74 (163) .++||-..-+.+............ .+.+......++. +|. +=||+|.. |..-||=. ++=.+..+.+.||+ + T Consensus 3 sGrtHD~itl~~~~~~~~~~~~~~-~~~~~~l~~~~~~l~ggl~lsPDLD~~-S~~~~RWG~l~~iW~PY~~~~~HRs~~ 80 (174) T pfam09988 3 SGRTHDRITLLSLPPVALLAYVLT-LSLAAALLFAGAFLFGGLMLSPDLDIH-SRAYRRWGPLRWIWWPYRRLIPHRSFL 80 (174) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHH-CCHHHHHHHHHHHHHHHHEECCCCCCC-CCHHHHHHHHEEHHHHHHCCCCCCCCC T ss_conf 987015899999999999999970-578899999999986301157875534-365652321411063302024776744 Q ss_pred HHHHHHHH------------HHHHHHHHHHHCC---C------------------CCHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 47799999------------9999999997103---5------------------7868999999999999999985133 Q gi|254781022|r 75 THSILAVI------------LYKWLIHHFFPSE---L------------------ISYQGLQDALIIGYVSHLVADVLTP 121 (163) Q Consensus 75 THSl~~~~------------~~~~l~~~~~~~~---~------------------~~~~~~~~~~~lG~~sHll~D~lT~ 121 (163) +|+++.-. ++..++..+.... . .....+..|+.+|..+|++.|.... T Consensus 81 SH~piiGt~~Rl~YL~~~~~ll~~l~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~la~~~GLelsa~lH~isD~~~s 160 (174) T pfam09988 81 SHGPIIGTLLRLLYLLLWVLLLLFLLAWLGLLLGGVPWSPSELLAWLFQLLKQHPAELLAFLIGLELGSWLHLIADGDPS 160 (174) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHCCCC T ss_conf 34451515999999999999999999999996556787889999999999997989999999999999999999946876 No 5 >COG2389 Uncharacterized metal-binding protein [General function prediction only] Probab=97.71 E-value=9.1e-05 Score=44.65 Aligned_cols=75 Identities=25% Similarity=0.186 Sum_probs=40.3 Q ss_pred CCHHHHHHHHHHHHHHHHHCCCHHHCCCCCHHHHHHHHH--HH--HCCCCCCCHHHHHHHH---HCCHHHHHHHCCCCCH Q ss_conf 752289999999999964113200044220899999999--98--3360045536788885---0101689974165441 Q gi|254781022|r 2 TYEGHCIFALASVILAKKVNFLSSFTDAEWGTVVLGALL--SC--LLPDIDHPRSFISKRF---KTLSLLTSCISSHRGF 74 (163) Q Consensus 2 ~~~tH~~~g~a~~~~~~~~~~~~~~~~~~~~~~l~~~~~--gs--llPDiD~~~s~~~~~~---~~~~~~~~~~~~HRg~ 74 (163) .+|||-..-+ +.......+.+.++.....+++.+-.+ |. +=||+|.. |.--+|= +++=-+..++++|||+ T Consensus 3 sGrtHdrInl--~~~~~v~~~~~~~t~s~~~~l~fa~aflfGt~~lsPDLDl~-S~~~qRWG~Lk~lW~PY~~~~~HRg~ 79 (179) T COG2389 3 SGRTHDRINL--GTLPAVLWPTPTMTLSQDYTLLFAIAFLFGTFMLSPDLDLH-SKPYQRWGFLKFLWLPYQKFFRHRGI 79 (179) T ss_pred CCCCCCEEEH--HHHHHHHCCCCCEECCCCEEHHHHHHHHHCCEEECCCCCCC-CCHHHHCCEEEEEEEECHHHHCCCCC T ss_conf 8752542325--67688865760044375454167799874543238875645-47054201435666520333055675 Q ss_pred HHHHH Q ss_conf 47799 Q gi|254781022|r 75 THSIL 79 (163) Q Consensus 75 THSl~ 79 (163) +|.++ T Consensus 80 lhhpl 84 (179) T COG2389 80 LHHPL 84 (179) T ss_pred CCCCC T ss_conf 45631 No 6 >pfam07155 DUF1393 Protein of unknown function (DUF1393). This family consists of several bacterial proteins of around 180 residues in length. The function of this family is unknown. Probab=38.63 E-value=21 Score=15.80 Aligned_cols=27 Identities=22% Similarity=0.548 Sum_probs=18.3 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCCCCCCCC Q ss_conf 99999999999999851338880314178 Q gi|254781022|r 103 QDALIIGYVSHLVADVLTPTGIPLLWPYH 131 (163) Q Consensus 103 ~~~~~lG~~sHll~D~lT~~Gv~ll~Pfs 131 (163) ..++..|.+.|.+.|.++.++ ..||++ T Consensus 52 ~~G~~~g~iG~~l~Dl~~gy~--~w~~~t 78 (169) T pfam07155 52 KVGFLVGGIGHALKDLLSGYG--IWAPWT 78 (169) T ss_pred HHHHHHHHHHHHHHHHHCCCC--CHHHHH T ss_conf 689999999999999966885--217899 No 7 >pfam06939 DUF1286 Protein of unknown function (DUF1286). This family consists of several hypothetical archaeal proteins of around 120 residues in length. All members of this family seem to be Sulfolobus species specific. The function of this family is unknown. Probab=36.44 E-value=30 Score=14.96 Aligned_cols=19 Identities=21% Similarity=0.382 Sum_probs=13.4 Q ss_pred CCCHHHHHHHHHHHHHHHH Q ss_conf 9752289999999999964 Q gi|254781022|r 1 MTYEGHCIFALASVILAKK 19 (163) Q Consensus 1 M~~~tH~~~g~a~~~~~~~ 19 (163) |+-+||-+|++..-.+... T Consensus 1 MkL~THyVFS~GlLtli~s 19 (112) T pfam06939 1 MKLRTHYVFTAGLLTLISS 19 (112) T ss_pred CCEEEEEEEEHHHHHHHHH T ss_conf 9417888654459999999 No 8 >PRK13661 hypothetical protein; Provisional Probab=34.73 E-value=32 Score=14.81 Aligned_cols=23 Identities=22% Similarity=0.629 Sum_probs=14.9 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCCC Q ss_conf 999999999999998513388803 Q gi|254781022|r 103 QDALIIGYVSHLVADVLTPTGIPL 126 (163) Q Consensus 103 ~~~~~lG~~sHll~D~lT~~Gv~l 126 (163) ..++.+|.+-|.+-|+++ +|-++ T Consensus 55 vvGflvGfIGH~l~D~~~-~G~~W 77 (183) T PRK13661 55 VVGFLVGFIGHALKDFIA-YGSPW 77 (183) T ss_pred HHHHHHHHHHHHHHHHHH-CCCCH T ss_conf 899999999999999871-58812 No 9 >pfam00882 Zn_dep_PLPC Zinc dependent phospholipase C. Probab=34.63 E-value=30 Score=14.97 Aligned_cols=22 Identities=18% Similarity=0.323 Sum_probs=18.1 Q ss_pred HHHHHHHHHHHHHHHHHCCCCC Q ss_conf 9999999999999985133888 Q gi|254781022|r 103 QDALIIGYVSHLVADVLTPTGI 124 (163) Q Consensus 103 ~~~~~lG~~sHll~D~lT~~Gv 124 (163) -..+.+|...|++.|+.+|+=. T Consensus 108 ka~fyLG~a~Hy~~D~~~P~HA 129 (223) T pfam00882 108 KAFFYLGAACHYFGDLNVPYHA 129 (223) T ss_pred HHHHHHHHHHHHHHHCCCCCCH T ss_conf 9999997898988744874301 No 10 >smart00770 Zn_dep_PLPC Zinc dependent phospholipase C (alpha toxin). This domain conveys a zinc dependent phospholipase C activity (EC 3.1.4.3). It is found in a monomeric phospholipase C of Bacillus cereus as well as in the alpha toxin of Clostridium perfringens and Clostridium bifermentans, which is involved in haemolysis and cell rupture. It is also found in a lecithinase of Listeria monocytogenes, which is involved in breaking the 2-membrane vacuoles that surround the bacterium. Structure information: PDB 1ca1. Probab=33.23 E-value=30 Score=15.02 Aligned_cols=21 Identities=24% Similarity=0.401 Sum_probs=17.3 Q ss_pred HHHHHHHHHHHHHHHHCCCCC Q ss_conf 999999999999985133888 Q gi|254781022|r 104 DALIIGYVSHLVADVLTPTGI 124 (163) Q Consensus 104 ~~~~lG~~sHll~D~lT~~Gv 124 (163) ..+.+|...|++.|+.+|+=. T Consensus 133 A~fyLG~a~Hy~~D~t~P~Ha 153 (241) T smart00770 133 AFFYLGRACHYLGDLSTPYHA 153 (241) T ss_pred HHHHHHHHHHHHHHCCCCCCH T ss_conf 999987888886206875201 No 11 >COG2035 Predicted membrane protein [Function unknown] Probab=29.28 E-value=40 Score=14.29 Aligned_cols=52 Identities=21% Similarity=0.229 Sum_probs=25.9 Q ss_pred CCCCCHHHHHHHHHHHHHHHHHHHHCC----CCCHHHHHHHHHHHHHHHHHHHHHC Q ss_conf 165441477999999999999997103----5786899999999999999998513 Q gi|254781022|r 69 SSHRGFTHSILAVILYKWLIHHFFPSE----LISYQGLQDALIIGYVSHLVADVLT 120 (163) Q Consensus 69 ~~HRg~THSl~~~~~~~~l~~~~~~~~----~~~~~~~~~~~~lG~~sHll~D~lT 120 (163) ..||..|+++..-....-+...+.... ..++......+.+|+..++.++..+ T Consensus 216 ~~h~~~t~~fi~Gl~lgSl~~i~p~~~~~~~~~~~~~~~~~f~lG~al~~~~~~~~ 271 (276) T COG2035 216 RNHREITYAFIIGLILGSLRAIWPGLAAAINFFSLFMLVVAFILGFALVLILKKLA 271 (276) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 98699999999999998799981697112203559999999999999999999988 No 12 >TIGR02327 int_mem_ywzB conserved hypothetical integral membrane protein; InterPro: IPR009526 Members of this protein family are small, typically about 80 residues in length, and are highly hydrophobic. The gene is found so far only in a subset of the firmicutes in association with genes of the ATP synthase F1 complex or NADH-quinone oxidoreductase. This family includes YwzB from Bacillus subtilis. . Probab=28.43 E-value=42 Score=14.21 Aligned_cols=20 Identities=30% Similarity=0.592 Sum_probs=15.4 Q ss_pred HHHHHHHHH-HHHHHHHHHCC Q ss_conf 999999999-99999985133 Q gi|254781022|r 102 LQDALIIGY-VSHLVADVLTP 121 (163) Q Consensus 102 ~~~~~~lG~-~sHll~D~lT~ 121 (163) +..+.++|| +||-++|.+-- T Consensus 43 ~li~Ia~GY~VS~F~Le~i~~ 63 (71) T TIGR02327 43 VLIAIALGYTVSHFFLELIQL 63 (71) T ss_pred HHHHHHHHHHHHHHHHHHHHH T ss_conf 999999999999999999998 No 13 >PRK12377 putative replication protein; Provisional Probab=27.42 E-value=44 Score=14.11 Aligned_cols=17 Identities=35% Similarity=0.364 Sum_probs=12.7 Q ss_pred CCHHHHHHHHHHHHHHH Q ss_conf 75228999999999996 Q gi|254781022|r 2 TYEGHCIFALASVILAK 18 (163) Q Consensus 2 ~~~tH~~~g~a~~~~~~ 18 (163) +||||++++++.-+... T Consensus 112 tGKTHLA~AIg~~a~~~ 128 (248) T PRK12377 112 TGKNHLAAAIGNRLLAK 128 (248) T ss_pred CCHHHHHHHHHHHHHHC T ss_conf 87889999999999987 No 14 >PRK11770 hypothetical protein; Provisional Probab=27.17 E-value=44 Score=14.08 Aligned_cols=30 Identities=37% Similarity=0.674 Sum_probs=20.7 Q ss_pred HHHHHHHHHHHHHHHCCCCCCC-----------CCCCCCCE Q ss_conf 9999999999998513388803-----------14178646 Q gi|254781022|r 105 ALIIGYVSHLVADVLTPTGIPL-----------LWPYHWRF 134 (163) Q Consensus 105 ~~~lG~~sHll~D~lT~~Gv~l-----------l~Pfs~r~ 134 (163) ..+++++.--++-..|.-|+|. |+||.++. T Consensus 86 ~lal~hl~~g~l~~iTIIGIPfg~q~~Kla~lal~PfGk~i 126 (135) T PRK11770 86 WLALGHLASGIALCITIIGIPFGIQHFKLAAIALWPFGKRI 126 (135) T ss_pred HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCEE T ss_conf 99999999999998985441779999998778305788877 No 15 >KOG2896 consensus Probab=21.32 E-value=58 Score=13.45 Aligned_cols=49 Identities=22% Similarity=0.359 Sum_probs=34.1 Q ss_pred HHHHHHHHHHHHHHHHHHHCCCCCCCCCCC----C---------CCEE----EEEEECCCHHHHHH Q ss_conf 999999999999999985133888031417----8---------6468----77873487188999 Q gi|254781022|r 101 GLQDALIIGYVSHLVADVLTPTGIPLLWPY----H---------WRFC----LPILHPNSPIGEIF 149 (163) Q Consensus 101 ~~~~~~~lG~~sHll~D~lT~~Gv~ll~Pf----s---------~r~~----~~~~~t~~~~~~~~ 149 (163) ..-.+.++||+.|++-=..-..-+|+=||. | .++. +|++..++..+... T Consensus 229 ~~~~aaALGylaHLv~~Is~~L~~pLRYPIl~~~Sks~I~D~i~~~~~ttr~fply~k~~~~e~f~ 294 (377) T KOG2896 229 EQETAAALGYLAHLVSMISKYLEVPLRYPILLAGSKSYIRDYIPDIETTTREFPLYTKSQEIEQFE 294 (377) T ss_pred HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCHHHHHH T ss_conf 278999999999999999999643655531116541410266774454434366755633398999 No 16 >pfam12221 HflK_N Bacterial membrane protein N terminal. This domain is found in bacteria. This domain is typically between 65 to 81 amino acids in length. This domain is found associated with pfam01145. This domain is the N terminal of the bacterial membrane protein HflK. HflK complexes with HflC to form a membrane protease which is modulated by the GTPase HflX. The N terminal domain of HflK is the membrane spanning region which anchors the protein in the bacterial membrane. Probab=21.30 E-value=40 Score=14.33 Aligned_cols=15 Identities=20% Similarity=0.374 Sum_probs=8.7 Q ss_pred CCCCCCCHHHHHHHH Q ss_conf 360045536788885 Q gi|254781022|r 44 LPDIDHPRSFISKRF 58 (163) Q Consensus 44 lPDiD~~~s~~~~~~ 58 (163) =||+|+.-..+.+++ T Consensus 24 PPDLDe~~r~~~~kl 38 (46) T pfam12221 24 PPDLDEIFRKLQDKL 38 (46) T ss_pred CCCHHHHHHHHHHHH T ss_conf 978999999999999 No 17 >TIGR00075 hypD hydrogenase expression/formation protein HypD; InterPro: IPR002780 HypD is involved in the hyp operon which is needed for the activity of the three hydrogenase isoenzymes in Escherichia coli. HypD is one of the genes needed for formation of these enzymes . This protein has been found in Gram-negative and Gram-positive bacteria and Archaea. HypD contains many possible metal binding residues, which may bind to nickel. Transposon Tn5 insertions into HypD resulted in Rhizobium leguminosarum mutants that lacked any hydrogenase activity in symbiosis with peas .; GO: 0046872 metal ion binding. Probab=21.01 E-value=45 Score=14.07 Aligned_cols=40 Identities=20% Similarity=0.238 Sum_probs=34.2 Q ss_pred HCCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHH Q ss_conf 1338880314178646877873487188999999999999 Q gi|254781022|r 119 LTPTGIPLLWPYHWRFCLPILHPNSPIGEIFFCVLFLIYA 158 (163) Q Consensus 119 lT~~Gv~ll~Pfs~r~~~~~~~t~~~~~~~~~~~~~~~~~ 158 (163) .|..|.+...|+.+||..|+..+|=-..+++.++.+++=. T Consensus 210 Sti~G~~~Y~~i~~~y~~P~VvaGFEP~DiL~av~mll~Q 249 (384) T TIGR00075 210 STIIGVKPYEPIAEKYKIPIVVAGFEPVDILQAVYMLLKQ 249 (384) T ss_pred EEEECHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHHHHH T ss_conf 6851524348899856898799688867999999999999 Done!