RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781022|ref|YP_003065435.1| hypothetical protein CLIBASIA_04620 [Candidatus Liberibacter asiaticus str. psy62] (163 letters) >2nyy_A Botulinum neurotoxin type A; neurotoxin, FAB, protein antibody complex, toxin/immune system complex; 2.61A {Clostridium botulinum} PDB: 2nz9_A 3bta_A (A:420-873) Length = 454 Score = 33.6 bits (77), Expect = 0.015 Identities = 12/46 (26%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Query: 74 FTHSILAVILYKWLIHHFFPSELISY--QGLQDALIIGYVSHLVAD 117 T+S+ +L ++ FF S+ + + + A+ +G+V LV D Sbjct: 148 LTNSVNEALLNPSRVYTFFSSDYVKKVNKATEAAMFLGWVEQLVYD 193 >1epw_A Bontoxilysin B, botulinum neurotoxin type B; zinc, metalloprotease, transmembrane, hydrolase; 1.90A {Clostridium botulinum} (A:535-607,A:707-786) Length = 153 Score = 32.9 bits (75), Expect = 0.021 Identities = 11/51 (21%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Query: 74 FTHSILAVILYKWLIHHFFPSELISY--QGLQDALIIGYVSHLVADVLTPT 122 T S +L+ ++ FF + I + ++ L G+V +V D + Sbjct: 20 LTSSFDDALLFSNKVYSFFSMDYIKTANKVVEAGLFAGWVKQIVNDFVIEA 70 >2w2d_B Bontoxilysin-A, botulinum neurotoxin A heavy chain; metalloprotease, membrane domain, protein engineering, metal-binding, transmembrane; 2.59A {Clostridium botulinum} (B:) Length = 431 Score = 32.8 bits (75), Expect = 0.024 Identities = 15/69 (21%), Positives = 29/69 (42%), Gaps = 12/69 (17%) Query: 74 FTHSILAVILYKWLIHHFFPSELISY--QGLQDALIIGYVSHLVAD----------VLTP 121 T+S+ +L ++ FF S+ + + + A+ +G+V LV D Sbjct: 122 LTNSVNEALLNPSRVYTFFSSDYVKKVNKATEAAMFLGWVEQLVYDFTDETSEVSTTDKI 181 Query: 122 TGIPLLWPY 130 I ++ PY Sbjct: 182 ADITIIIPY 190 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 28.2 bits (63), Expect = 0.59 Identities = 6/22 (27%), Positives = 10/22 (45%), Gaps = 6/22 (27%) Query: 91 FFPSE-LIS---YQGL--QDAL 106 E L+ Y+G+ Q A+ Sbjct: 5 VMSIESLVEVVFYRGMTMQVAV 26 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.331 0.145 0.478 Gapped Lambda K H 0.267 0.0465 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,309,037 Number of extensions: 53416 Number of successful extensions: 124 Number of sequences better than 10.0: 1 Number of HSP's gapped: 124 Number of HSP's successfully gapped: 12 Length of query: 163 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 81 Effective length of database: 2,184,039 Effective search space: 176907159 Effective search space used: 176907159 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.1 bits)