>TIGR02734 crtI_fam phytoene desaturase; InterPro: IPR014105 Phytoene is converted to lycopene by desaturation at four (two symmetrical pairs of) sites. This is achieved by two enzymes (crtP and crtQ) in cyanobacteria (Gloeobacter being an exception) and plants, but by a single enzyme in most other bacteria and in fungi. This single enzyme is called the bacterial-type phytoene desaturase, or CrtI. Most members of this family are CrtI and are part of flavin containing amine oxidoreductase family. It is likely that all members act on either phytoene or on related compounds such as dehydrosqualene, for carotenoid biosynthesis..

Probab=98.55 E-value=1.5e-07 Score=71.44 Aligned_cols=52 Identities=37% Similarity=0.574 Sum_probs=43.7 Q ss_pred EEEECCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCC----CC-C--------CEECHHHHHHHC Q ss_conf 799989768999999999808997399997867789864----02-7--------403336788867 Q gi|254781024|r 17 VVIIGAGPAGLAAAIRCKQINPHLSVVILEKSAEVGAHI----LS-G--------AIIDPIGIDSLL 70 (554) Q Consensus 17 VvIVGaGPAG~saA~~La~~g~~l~VlvlEK~~~pG~~i----~s-G--------~vl~p~aL~eL~ 70 (554) T Consensus 1 a~VIGAG~gGLA~A~rL~~~G--~~vtv~E~~d~pGGRA~~~~~~fGf~fD~GPTv~t~P~~~~elF 65 (526) T TIGR02734 1 AVVIGAGFGGLALAIRLQAAG--IRVTVVEKRDKPGGRAGVLEDDFGFRFDTGPTVITMPEALEELF 65 (526) T ss_pred CEEECCCHHHHHHHHHHHHCC--CEEEEEEECCCCCCEEEEEECCCCEEEECCCCEEECHHHHHHHH T ss_conf 968577768999999997379--52899860689875055688157546605882454467899999

HHsearch alignment for GI: 254781024 and conserved domain: TIGR02734