BLAST/PSIBLAST alignment of GI: 254781025 and GI: 163757800 at iteration 1
>gi|163757800|ref|ZP_02164889.1| deoxyuridine 5`triphosphate nucleotidohydrolase protein [Hoeflea phototrophica DFL-43] Length = 168
>gi|162285302|gb|EDQ35584.1| deoxyuridine 5`triphosphate nucleotidohydrolase protein [Hoeflea phototrophica DFL-43] Length = 168
 Score =  169 bits (427), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 106/145 (73%), Gaps = 2/145 (1%)

Query: 8   FLQLPHAHGIPLPEYKTSGSSGMDLFAALPEDEPVELLPGMRSLIPGGYIIAIPPGYEGQ 67
            L+LPH  G+ LP Y+T G++GMDL AA+ E EP EL PG R+ IP G ++ IP G+EGQ
Sbjct: 24  ILRLPHGEGLELPAYETPGAAGMDLRAAVSEGEPFELAPGARAAIPTGLVMEIPHGFEGQ 83

Query: 68  VRSRSGLALNYGVACLNSPGTIDSDYRGEIKILLINLGQENFLIMRGMRIAQLIIANSVR 127
           VR RSGLAL  G+ CLN+PGTIDSDYRGE+K++L NLG E FL+ RGMRIAQ++IA  V+
Sbjct: 84  VRPRSGLALKSGITCLNTPGTIDSDYRGEVKVILANLGAEPFLVTRGMRIAQMVIAPVVQ 143

Query: 128 AHPSLISAMPMGKNERNEKGFGSTG 152
           A   ++ A  + +  R   GFGSTG
Sbjct: 144 AR--ILLAEAVDETARGAGGFGSTG 166