RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781026|ref|YP_003065439.1| hypothetical protein CLIBASIA_04640 [Candidatus Liberibacter asiaticus str. psy62] (186 letters) >gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI. Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX. This is the first unique step in the synthesis of (bacterio)chlorophyll. Due to this, it is thought that Mg-chelatase has an important role in channelling inter- mediates into the (bacterio)chlorophyll branch in response to conditions suitable for photosynthetic growth. ChlI and BchD have molecular weight between 38-42 kDa. Length = 207 Score = 278 bits (714), Expect = 6e-76 Identities = 97/175 (55%), Positives = 126/175 (72%), Gaps = 1/175 (0%) Query: 1 MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSV 60 MIGPPG+ K+MLA LP IL PL+ +E+LEV+ I+S++G I+ RPFR+PHHS Sbjct: 27 MIGPPGSGKTMLAKRLPGILPPLTEQEALEVTAIHSVAGLGGDG-GLIRRRPFRAPHHSA 85 Query: 61 TIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKIS 120 + AAL+GGG PGE SLAHNGVLFLDE+PEFS + L +LRQPLE GE I+RA K++ Sbjct: 86 SAAALVGGGSIPRPGEISLAHNGVLFLDELPEFSRRVLESLRQPLEDGEITISRARAKVT 145 Query: 121 YPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVP 175 +P+R QL+AAMNPC CG + C PR Y +R+SGPL+DRID+++ VP Sbjct: 146 FPARFQLVAAMNPCPCGYLGDPDKRCRCTPRQIRRYLSRLSGPLLDRIDLQVEVP 200 >gnl|CDD|30951 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]. Length = 490 Score = 245 bits (628), Expect = 4e-66 Identities = 94/176 (53%), Positives = 121/176 (68%) Query: 1 MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSV 60 ++GPPG K+MLAS LP +L PLS+ E+LEVS I+S++G +RPFR+PHHS Sbjct: 203 LVGPPGTGKTMLASRLPGLLPPLSIPEALEVSAIHSLAGDLHEGCPLKIHRPFRAPHHSA 262 Query: 61 TIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKIS 120 ++AAL+GGG PGE SLAHNGVLFLDE+PEF L ALR+PLE G+ II+RA K++ Sbjct: 263 SLAALVGGGGVPRPGEISLAHNGVLFLDELPEFKRSILEALREPLENGKIIISRAGSKVT 322 Query: 121 YPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPS 176 YP+R QL+AAMNPC CG C PR Y ++SGP +DRID+ + VP Sbjct: 323 YPARFQLVAAMNPCPCGNLGAPLRRCPCSPRQIKRYLNKLSGPFLDRIDLMVEVPR 378 >gnl|CDD|31432 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme metabolism]. Length = 423 Score = 50.7 bits (121), Expect = 2e-07 Identities = 25/117 (21%), Positives = 43/117 (36%), Gaps = 23/117 (19%) Query: 59 SVTIAALIGGGLQVL-PGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANR 117 S+ I + G + PG + A+ G+L++DE+ ++AL G + R Sbjct: 121 SLDIEKALEEGPKAFQPGLLARANRGILYVDEVNLLDDHLVDALLDVAAEGVNDVEREGI 180 Query: 118 KISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAV 174 I +P+R LI MNP + L+DR + + Sbjct: 181 SIRHPARFLLIGTMNPEE----------------------GELRPQLLDRFGLEVDT 215 >gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only]. Length = 329 Score = 39.3 bits (91), Expect = 7e-04 Identities = 43/180 (23%), Positives = 62/180 (34%), Gaps = 45/180 (25%) Query: 1 MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHH-- 58 + GPPG K++LA +L +L + + IQ P P Sbjct: 48 LEGPPGVGKTLLAR---------ALARALGLPFVR------------IQCTPDLLPSDLL 86 Query: 59 ---SVTIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARA 115 + L G + +PG A +L LDEI P+ NAL + LE + + Sbjct: 87 GTYAYAALLLEPGEFRFVPGPLFAAVRVILLLDEINRAPPEVQNALLEALEERQVTVPG- 145 Query: 116 NRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVP 175 I P +IA NP G T + L+DR +RI V Sbjct: 146 LTTIRLPPPFIVIATQNP---------------GEYEGTY---PLPEALLDRFLLRIYVD 187 >gnl|CDD|33622 COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]. Length = 560 Score = 39.1 bits (91), Expect = 7e-04 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Query: 74 PGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMN 132 PG LA+ G LFLDEI E L + L+ E I R P +++IAA N Sbjct: 333 PGLFELANGGTLFLDEIGEMPLPLQAKLLRVLQEKE--IERVGGTKPIPVDVRIIAATN 389 >gnl|CDD|35701 KOG0480, KOG0480, KOG0480, DNA replication licensing factor, MCM6 component [Replication, recombination and repair]. Length = 764 Score = 37.2 bits (86), Expect = 0.003 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 10/92 (10%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGM 138 LA NG+ +DE + + A+ + +E IA+A + +R ++AA NP G Sbjct: 440 LADNGICCIDEFDKMDVKDQVAIHEAMEQQTISIAKAGVVATLNARTSILAAANP-VGGH 498 Query: 139 SNKDENVCIRGPRCATEYQARISGPLMDRIDI 170 ++ + + +S P+M R D+ Sbjct: 499 YDRKKTL---------RENINMSAPIMSRFDL 521 >gnl|CDD|31434 COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]. Length = 682 Score = 36.5 bits (84), Expect = 0.004 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 10/92 (10%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGM 138 LA GV +DE + + + A+ + +E IA+A + +R ++AA NP + G Sbjct: 381 LADGGVCCIDEFDKMNEEDRVAIHEAMEQQTISIAKAGITATLNARCSVLAAANP-KFGR 439 Query: 139 SNKDENVCIRGPRCATEYQARISGPLMDRIDI 170 + + V + PL+ R D+ Sbjct: 440 YDPKKTV---------AENINLPAPLLSRFDL 462 >gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]. Length = 464 Score = 35.7 bits (82), Expect = 0.008 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Query: 68 GGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQL 127 G + G A+ G LFLDEI E + L + L+ E N+ I +++ Sbjct: 222 GAITRRIGRFEQANGGTLFLDEIGEMPLELQVKLLRVLQEREFERVGGNKPI--KVDVRI 279 Query: 128 IAAMN 132 IAA N Sbjct: 280 IAATN 284 >gnl|CDD|31414 COG1221, PspF, Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]. Length = 403 Score = 34.6 bits (79), Expect = 0.016 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 2/54 (3%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMN 132 A+ G LFLDEI P+ L + LE GE R P ++LI A Sbjct: 171 QANGGTLFLDEIHRLPPEGQEKLLRVLEEGEY--RRVGGSQPRPVDVRLICATT 222 >gnl|CDD|143926 pfam00158, Sigma54_activat, Sigma-54 interaction domain. Length = 168 Score = 34.7 bits (81), Expect = 0.017 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIAR--ANRKISYPSRIQLIAAMN 132 LA G LFLDEI E + L + L+ GE R + I +++IAA N Sbjct: 91 LADGGTLFLDEIGELPLELQAKLLRVLQEGE--FERVGGTKPI--KVDVRIIAATN 142 >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.. Length = 151 Score = 34.4 bits (79), Expect = 0.018 Identities = 41/182 (22%), Positives = 57/182 (31%), Gaps = 60/182 (32%) Query: 1 MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSV 60 + GPPG K+ LA + F PF + S Sbjct: 24 LYGPPGTGKTTLARAI--------------------------ANELFRPGAPFLYLNASD 57 Query: 61 TIAALIGGGLQVLPGEDSL------AHNGVLFLDEIPEFSPQTLNALRQPLETGECIIAR 114 + L+ L L A GVLF+DEI S NAL + LET Sbjct: 58 LLEGLVVAELFGHFLVRLLFELAEKAKPGVLFIDEIDSLSRGAQNALLRVLETL------ 111 Query: 115 ANRKISYPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAV 174 N +++I A +N+ + L DR+DIRI + Sbjct: 112 -NDLRIDRENVRVIGA--------TNRPL-------------LGDLDRALYDRLDIRIVI 149 Query: 175 PS 176 P Sbjct: 150 PL 151 >gnl|CDD|176899 cd08890, SRPBCC_PITPNC1_like, Lipid-binding SRPBCC domain of mammalian PITPNC1,and related proteins (Class IIB PITPs). This subgroup includes the N-terminal SRPBCC (START/RHO_alpha_C /PITP /Bet_v1/CoxG/CalC) domain of mammalian Class IIB phosphatidylinositol transfer protein (PITP), PITPNC1/RdgBbeta, and related proteins. These are metazoan proteins belonging to the PITP family of lipid transfer proteins, and to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. Mammalian PITPNC1 contains an amino-terminal SRPBCC PITP-like domain and a short carboxyl-terminal domain. It is a cytoplasmic protein, and is ubiquitously expressed. It can transfer phosphatidylinositol (PtdIns) in vitro with a similar ability to other PITPs. Length = 250 Score = 34.4 bits (79), Expect = 0.019 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 9/47 (19%) Query: 19 ILLPLSLEESLEVSMIYSISGHSSHEYS-------FIQNRPFRSPHH 58 I +PL++EE + +Y IS HS HE S +QN P P H Sbjct: 7 ICMPLTVEE-YRIGQLYMISRHS-HEQSERGEGVEVVQNEPCEDPEH 51 >gnl|CDD|35699 KOG0478, KOG0478, KOG0478, DNA replication licensing factor, MCM4 component [Replication, recombination and repair]. Length = 804 Score = 34.2 bits (78), Expect = 0.022 Identities = 19/57 (33%), Positives = 30/57 (52%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCR 135 L+ NG+ +DE + S T + L + +E IA+A S +R ++AA NP R Sbjct: 524 LSDNGICCIDEFDKMSDSTRSVLHEVMEQQTLSIAKAGIIASLNARCSVLAAANPIR 580 >gnl|CDD|33404 COG3604, FhlA, Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]. Length = 550 Score = 33.4 bits (76), Expect = 0.037 Identities = 22/59 (37%), Positives = 26/59 (44%), Gaps = 2/59 (3%) Query: 74 PGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMN 132 G LA G LFLDEI E L + L+ GE +R I R+ IAA N Sbjct: 310 RGRFELADGGTLFLDEIGELPLALQAKLLRVLQEGEIERVGGDRTIKVDVRV--IAATN 366 >gnl|CDD|35700 KOG0479, KOG0479, KOG0479, DNA replication licensing factor, MCM3 component [Replication, recombination and repair]. Length = 818 Score = 33.0 bits (75), Expect = 0.055 Identities = 18/55 (32%), Positives = 28/55 (50%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNP 133 LA GV+ +DE + S A+ + +E IA+A S +R ++AA NP Sbjct: 396 LADRGVVCIDEFDKMSDIDRVAIHEVMEQQTVTIAKAGIHASLNARCSVLAAANP 450 >gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also called the HGF receptor. HGF/Met signaling plays a role in growth, transformation, cell motility, invasion, metastasis, angiogenesis, wound healing, and tissue regeneration. Aberrant expression of Met through mutations or gene amplification is associated with many human cancers including hereditary papillary renal and gastric carcinomas. The ligand for Ron is macrophage stimulating protein (MSP). Ron signaling is important in regulating cell motility, adhesion, proliferation, and apoptosis. Aberrant Ron expression is implicated in tumorigenesis and metastasis. Length = 262 Score = 32.1 bits (73), Expect = 0.092 Identities = 27/71 (38%), Positives = 33/71 (46%), Gaps = 15/71 (21%) Query: 10 SMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGG 69 S+L CLPS PL V + Y G + FI RS H+ T+ LIG G Sbjct: 60 SLLGICLPSEGSPL-------VVLPYMKHGDLRN---FI-----RSETHNPTVKDLIGFG 104 Query: 70 LQVLPGEDSLA 80 LQV G + LA Sbjct: 105 LQVAKGMEYLA 115 >gnl|CDD|144183 pfam00493, MCM, MCM2/3/5 family. Length = 327 Score = 31.4 bits (72), Expect = 0.17 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 10/92 (10%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGM 138 LA GV +DE + + + A+ + +E IA+A + +R ++AA NP G Sbjct: 119 LADGGVCCIDEFDKMNEEDRVAIHEAMEQQTISIAKAGIVATLNARCSVLAAANP-IFGR 177 Query: 139 SNKDENVCIRGPRCATEYQARISGPLMDRIDI 170 + ++V + PL+ R D+ Sbjct: 178 YDPKKSV---------AENINLPPPLLSRFDL 200 >gnl|CDD|33094 COG3284, AcoR, Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription]. Length = 606 Score = 31.0 bits (70), Expect = 0.19 Identities = 16/54 (29%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMN 132 A G LFLDEI + + L + L+ G R I++IAA + Sbjct: 405 QADGGTLFLDEIGDMPLALQSRLLRVLQEGVVTPLGGTRI---KVDIRVIAATH 455 >gnl|CDD|31266 COG1067, LonB, Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones]. Length = 647 Score = 29.9 bits (67), Expect = 0.44 Identities = 21/72 (29%), Positives = 28/72 (38%), Gaps = 8/72 (11%) Query: 71 QVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECII--------ARANRKISYP 122 +V PG A+ GVL +DEI + L + L E I R S P Sbjct: 215 RVKPGAVHKANGGVLIIDEIGLLAQPLQWKLLKALLDKEQPIWGSSEPSSGAPVRPESVP 274 Query: 123 SRIQLIAAMNPC 134 ++LI A N Sbjct: 275 LDLKLILAGNRE 286 >gnl|CDD|35703 KOG0482, KOG0482, KOG0482, DNA replication licensing factor, MCM7 component [Replication, recombination and repair]. Length = 721 Score = 29.2 bits (65), Expect = 0.65 Identities = 23/92 (25%), Positives = 38/92 (41%), Gaps = 10/92 (10%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNPCRCGM 138 LA G+ +DE + A+ + +E IA+A + +R ++AA NP G Sbjct: 437 LADGGICCIDEFDKMDESDRTAIHEVMEQQTISIAKAGINTTLNARTSILAAANPAY-GR 495 Query: 139 SNKDENVCIRGPRCATEYQARISGPLMDRIDI 170 N PR + E + L+ R D+ Sbjct: 496 YN---------PRRSPEQNINLPAALLSRFDL 518 >gnl|CDD|35702 KOG0481, KOG0481, KOG0481, DNA replication licensing factor, MCM5 component [Replication, recombination and repair]. Length = 729 Score = 28.8 bits (64), Expect = 0.83 Identities = 17/55 (30%), Positives = 27/55 (49%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNP 133 LA GV+ +DE + A+ + +E IA+A + SR ++AA NP Sbjct: 426 LADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRTSVLAAANP 480 >gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA). AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. Length = 131 Score = 27.6 bits (62), Expect = 2.0 Identities = 19/95 (20%), Positives = 34/95 (35%), Gaps = 27/95 (28%) Query: 84 VLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRI--QLIAAMNPCRCGMSNK 141 V+F+DEI + +R + S R+ QL+ ++ G ++ Sbjct: 60 VIFIDEIDALAG-----------------SRGSGGDSESRRVVNQLLTELD----GFTSS 98 Query: 142 DENVCIRGPRCATEYQARISGPLM-DRIDIRIAVP 175 V + AT ++ L+ R D I P Sbjct: 99 LSKVIVIA---ATNRPDKLDPALLRGRFDRIIEFP 130 >gnl|CDD|176857 cd07815, SRPBCC_PITP, Lipid-binding SRPBCC domain of Class I and Class II Phosphatidylinositol Transfer Proteins. This family includes the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of the phosphatidylinositol transfer protein (PITP) family of lipid transfer proteins. This family of proteins includes Class 1 PITPs (PITPNA/PITPalpha and PITPNB/PITPbeta, Drosophila vibrator and related proteins), Class IIA PITPs (PITPNM1/PITPalphaI/Nir2, PITPNM2/PITPalphaII/Nir3, Drosophila RdgB, and related proteins), and Class IIB PITPs (PITPNC1/RdgBbeta and related proteins). The PITP family belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. In vitro, PITPs bind phosphatidylinositol (PtdIns), as well as phosphatidylcholine (PtdCho) but with a lower affinity. They transfer these lipids from one membrane compartment to another. The cellular roles of PITPs include inositol lipid signaling, PtdIns metabolism, and membrane trafficking. Class III PITPs, exemplified by the Sec14p family, are found in yeast and plants but are unrelated in sequence and structure to Class I and II PITPs and belong to a different superfamily. Length = 251 Score = 27.3 bits (61), Expect = 2.5 Identities = 11/46 (23%), Positives = 23/46 (50%), Gaps = 7/46 (15%) Query: 19 ILLPLSLEESLEVSMIYSISGHSSHEYS------FIQNRPFRSPHH 58 I+LPL++EE ++ +Y ++ S E ++N P+ + Sbjct: 7 IVLPLTVEE-YQIGQLYMVAKASKEETGSGEGVEVLKNEPYEDENG 51 >gnl|CDD|36491 KOG1277, KOG1277, KOG1277, Endosomal membrane proteins, EMP70 [Intracellular trafficking, secretion, and vesicular transport]. Length = 593 Score = 26.8 bits (59), Expect = 3.4 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 53 FRSPHHSVTIAALIGGGLQVL 73 FR P H + +A++G G Q+ Sbjct: 286 FRFPSHPLLFSAVLGSGAQLF 306 >gnl|CDD|33093 COG3283, TyrR, Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism]. Length = 511 Score = 26.8 bits (59), Expect = 4.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 74 PGEDSLAHNGVLFLDEIPEFSPQ 96 G A+ G + LDEI E SP+ Sbjct: 286 KGFFEQANGGTVLLDEIGEMSPR 308 >gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family. This group is a member of the medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, but lacks the zinc-binding sites of the zinc-dependent alcohol dehydrogenases. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P)-binding Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. ADH-like proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and generally have 2 tightly bound zinc atoms per subunit. The active site zinc is coordinated by a histidine, two cysteines, and a water molecule. The second zinc seems to play a structural role, affects subunit interactions, and is typically coordinated by 4 cysteines. Length = 305 Score = 26.6 bits (59), Expect = 4.2 Identities = 7/42 (16%), Positives = 10/42 (23%), Gaps = 7/42 (16%) Query: 39 GHSSHEYSFIQNRPFRSPHHSVTIAAL-------IGGGLQVL 73 G SS E + F + + L L Sbjct: 222 GSSSGEPAVFNPAAFVGGGGGRRLYTFFLYDGEPLAADLARL 263 >gnl|CDD|35698 KOG0477, KOG0477, KOG0477, DNA replication licensing factor, MCM2 component [Replication, recombination and repair]. Length = 854 Score = 26.1 bits (57), Expect = 5.3 Identities = 17/55 (30%), Positives = 28/55 (50%) Query: 79 LAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQLIAAMNP 133 LA GV +DE + + Q ++ + +E I++A S +R +IAA NP Sbjct: 544 LADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANP 598 >gnl|CDD|36057 KOG0839, KOG0839, KOG0839, RNA Methylase, SpoU family [RNA processing and modification]. Length = 1477 Score = 26.1 bits (57), Expect = 6.1 Identities = 20/100 (20%), Positives = 32/100 (32%), Gaps = 15/100 (15%) Query: 15 CLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLP 74 CL S+ +V M Y ++ S + N F + + + Sbjct: 95 CLRSVWH------KFQVWMSYRLNDLISENLKHLLNDNFGKKIAQPFVESFAAEQNANIK 148 Query: 75 GED------SLAHN--GVLFLDE-IPEFSPQTLNALRQPL 105 E+ SL H V DE S + L+ + PL Sbjct: 149 HENLHLLILSLLHYLEVVYLFDECKNGASSKCLDFIIVPL 188 >gnl|CDD|35957 KOG0738, KOG0738, KOG0738, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]. Length = 491 Score = 25.7 bits (56), Expect = 7.5 Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 1 MIGPPGARKSMLASCLPS 18 M+GPPG K++LA + + Sbjct: 250 MVGPPGTGKTLLAKAVAT 267 >gnl|CDD|34868 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 4600 Score = 25.4 bits (55), Expect = 8.8 Identities = 18/53 (33%), Positives = 21/53 (39%), Gaps = 4/53 (7%) Query: 85 LFLDEIPEFSPQTLNALRQPLETGECIIARANRKISYPSRIQ----LIAAMNP 133 L LDEI S +TL + L E I + P RI L MNP Sbjct: 639 LLLDEINLASEETLELIDGLLGKKESGILLSESGDLRPIRIHPGFRLFGCMNP 691 >gnl|CDD|37741 KOG2530, KOG2530, KOG2530, Members of tubulin/FtsZ family [Cytoskeleton]. Length = 483 Score = 25.4 bits (55), Expect = 9.6 Identities = 26/124 (20%), Positives = 40/124 (32%), Gaps = 4/124 (3%) Query: 2 IGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVT 61 +G + LA SI LP L S + ++S S + PF Sbjct: 288 LGDLWETSAKLARAFDSITLPTRLISSSNLRQRDTLSYLGSKVITLGYALPFPLVTGQSL 347 Query: 62 IAALIGGGLQVLPGEDSLAHNGVL--FLDEIPEFSPQTLNALRQPLETGECIIARANRKI 119 L+ G VLP + S N L I + + +P + + I + Sbjct: 348 EDTLVSSGSAVLPTQLSHKPNNCQSGVLRSIDDRGNLLHDHHYEPASSSKMIELYQHL-- 405 Query: 120 SYPS 123 PS Sbjct: 406 YLPS 409 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.137 0.410 Gapped Lambda K H 0.267 0.0728 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,249,353 Number of extensions: 110168 Number of successful extensions: 339 Number of sequences better than 10.0: 1 Number of HSP's gapped: 335 Number of HSP's successfully gapped: 43 Length of query: 186 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 98 Effective length of database: 4,362,145 Effective search space: 427490210 Effective search space used: 427490210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.6 bits)