BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781026|ref|YP_003065439.1| hypothetical protein CLIBASIA_04640 [Candidatus Liberibacter asiaticus str. psy62] (186 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781026|ref|YP_003065439.1| hypothetical protein CLIBASIA_04640 [Candidatus Liberibacter asiaticus str. psy62] Length = 186 Score = 378 bits (971), Expect = e-107, Method: Compositional matrix adjust. Identities = 186/186 (100%), Positives = 186/186 (100%) Query: 1 MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSV 60 MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSV Sbjct: 1 MIGPPGARKSMLASCLPSILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSV 60 Query: 61 TIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKIS 120 TIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKIS Sbjct: 61 TIAALIGGGLQVLPGEDSLAHNGVLFLDEIPEFSPQTLNALRQPLETGECIIARANRKIS 120 Query: 121 YPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHI 180 YPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHI Sbjct: 121 YPSRIQLIAAMNPCRCGMSNKDENVCIRGPRCATEYQARISGPLMDRIDIRIAVPSRTHI 180 Query: 181 RSFCNE 186 RSFCNE Sbjct: 181 RSFCNE 186 >gi|254781125|ref|YP_003065538.1| hypothetical protein CLIBASIA_05135 [Candidatus Liberibacter asiaticus str. psy62] Length = 59 Score = 26.6 bits (57), Expect = 0.30, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 81 HNGVLFLDEIPEFSPQTLN 99 H V+F DE+P F +TLN Sbjct: 25 HYNVIFRDEVPSFIYETLN 43 >gi|254780882|ref|YP_003065295.1| site-specific tyrosine recombinase XerC [Candidatus Liberibacter asiaticus str. psy62] Length = 328 Score = 26.6 bits (57), Expect = 0.30, Method: Compositional matrix adjust. Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 6/52 (11%) Query: 21 LPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQV 72 LP +L E ++++ ++ H+SHE +I R +S + L G GL++ Sbjct: 125 LPRALNEKQALTLVDNVLLHTSHETKWIDAR------NSAILYLLYGCGLRI 170 >gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC [Candidatus Liberibacter asiaticus str. psy62] Length = 581 Score = 24.6 bits (52), Expect = 1.1, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Query: 18 SILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLP 74 S+ +P S E S Y GH+ ++ F N P S+T + G + P Sbjct: 261 SVFIP-SKETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFP 316 >gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Score = 23.9 bits (50), Expect = 1.8, Method: Compositional matrix adjust. Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 11/71 (15%) Query: 19 ILLPLSLEESLEVSMIYSISGHSSHEYSFIQNRPFRSPHHSVTIAALIGGGLQVLPGEDS 78 +L+P+S E L V IY+ HSS +Y I+ + G + L + S Sbjct: 29 LLVPISRREMLSVDNIYNEDYHSS-KYKKIEE----------PVVQFKGSSQENLVRDFS 77 Query: 79 LAHNGVLFLDE 89 + NG F D+ Sbjct: 78 VQENGDRFSDQ 88 >gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 23.1 bits (48), Expect = 2.8, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 90 IPEFSPQTLNALRQPLETGECIIARANRKI 119 + E + A Q +E G+ IIAR R + Sbjct: 517 VSELWNELHQAFEQTIENGKAIIARKRRDV 546 >gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62] Length = 647 Score = 22.7 bits (47), Expect = 4.3, Method: Composition-based stats. Identities = 7/13 (53%), Positives = 11/13 (84%) Query: 1 MIGPPGARKSMLA 13 ++GPPG K++LA Sbjct: 186 LVGPPGTGKTLLA 198 >gi|254780390|ref|YP_003064803.1| nucleoside diphosphate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 140 Score = 22.3 bits (46), Expect = 4.8, Method: Compositional matrix adjust. Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 6/50 (12%) Query: 45 YSFIQNRPFRSPHHSVTIAALIGG--GLQVLPGEDSLAHNGVLFLDEIPE 92 Y ++RPF + A+I G LQVL GE++++ N + D P+ Sbjct: 51 YLIHKDRPFFPE----LVQAMISGPVFLQVLKGEEAISKNREVMGDTDPK 96 >gi|254780973|ref|YP_003065386.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 255 Score = 22.3 bits (46), Expect = 5.1, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 10/14 (71%) Query: 141 KDENVCIRGPRCAT 154 KD+N+ PRCAT Sbjct: 29 KDDNLLENNPRCAT 42 >gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Score = 22.3 bits (46), Expect = 5.8, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 1 MIGPPGARKSMLASCLPSILLP 22 +IGP G+ KS +A + I+ P Sbjct: 41 LIGPNGSGKSTIAKLITGIIKP 62 >gi|254780462|ref|YP_003064875.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 267 Score = 22.3 bits (46), Expect = 5.9, Method: Compositional matrix adjust. Identities = 8/25 (32%), Positives = 14/25 (56%) Query: 56 PHHSVTIAALIGGGLQVLPGEDSLA 80 PH I GG ++V+P +++A Sbjct: 136 PHGGAMITLTYGGSMRVVPNYNAMA 160 >gi|254780277|ref|YP_003064690.1| DNA polymerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 976 Score = 21.9 bits (45), Expect = 7.9, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 16/23 (69%) Query: 10 SMLASCLPSILLPLSLEESLEVS 32 SM +CLP I L + L+ +++VS Sbjct: 947 SMEKACLPKINLRVPLKVNIKVS 969 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.137 0.410 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 111,758 Number of Sequences: 1233 Number of extensions: 4107 Number of successful extensions: 25 Number of sequences better than 100.0: 14 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 13 Number of HSP's gapped (non-prelim): 14 length of query: 186 length of database: 328,796 effective HSP length: 69 effective length of query: 117 effective length of database: 243,719 effective search space: 28515123 effective search space used: 28515123 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)