>TIGR02902 spore_lonB ATP-dependent protease LonB; InterPro: IPR014251 This entry represents LonB, a paralog of the ATP-dependent protease La (LonA, IPR004815 from INTERPRO). LonB proteins are unassigned peptidases belonging to the MEROPS peptidase family S16 (lon protease family, clan SJ) and are found strictly, and almost universally, in endospore-forming bacteria. This protease was shown, in Bacillus subtilis, to be expressed specifically in the forespore during sporulation, under control of sigmaF . The lonB gene, despite being located immediately upstream of lonA, was shown to be monocistronic. LonB appears to be involved in the post-translation control of sigmaH, but lonB mutation did not produce an obvious sporulation defect under the conditions tested . Note that additional paralogs of LonA and LonB occur in the Clostridium lineage and these are excluded from this entry. .

Probab=98.51 E-value=1.1e-07 Score=59.46 Aligned_cols=65 Identities=18% Similarity=0.284 Sum_probs=52.6 Q ss_pred CCCHHHHCCEEEEEEECCCCCHHH-------HHHHHHCC-CEEEEEHHHHHHHHHHCCCCEEEECCCHHHHHHHH Q ss_conf 888577356689985035775379-------99872039-86998365504556312881075107499999997 Q gi|254781027|r 6 AISTESFSHYLAVGEINLDGSLPA-------AICAKNMN-KDFICPQSCGSEAAWASDSLRIVAPSTLLELINHL 72 (108) Q Consensus 6 qi~~~~l~~~~~iGELsLdG~Lp~-------al~a~~~~-~~~iiP~~N~~Ea~lv~~~~~v~~~~~L~evv~~l 72 (108) T Consensus 459 ~~PId--n~vAmTGEISL~G~VKPVGGV~~Ki~AA~~AGak~ViIP~eNwqe~~~~~~~I~vipVk~~~E~l~~~ 531 (532) T TIGR02902 459 KVPID--NKVAMTGEISLNGLVKPVGGVVSKIEAAKKAGAKKVIIPYENWQESFESISGIKVIPVKNIDEVLEVA 531 (532) T ss_pred CCCCC--CCEEEEEEEEEEEEEEECCCCCHHHHHHHHCCCCEEECCCCHHHHHHHHHCCEEEEECCCHHHHHHHH T ss_conf 78887--72111333864010520178612689999749726534752078999855271586326389999883

HHsearch alignment for GI: 254781027 and conserved domain: TIGR02902