BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781028|ref|YP_003065441.1| putative Mg2+ chelatase family protein [Candidatus Liberibacter asiaticus str. psy62] (87 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781028|ref|YP_003065441.1| putative Mg2+ chelatase family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 87 Score = 172 bits (436), Expect = 8e-46, Method: Compositional matrix adjust. Identities = 87/87 (100%), Positives = 87/87 (100%) Query: 1 MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60 MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL Sbjct: 1 MISRISTIAFQGIKGIPVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFL 60 Query: 61 VNELPSIYLQLIYQKKDLIMIYLSFLH 87 VNELPSIYLQLIYQKKDLIMIYLSFLH Sbjct: 61 VNELPSIYLQLIYQKKDLIMIYLSFLH 87 >gi|254780232|ref|YP_003064645.1| inorganic pyrophosphatase [Candidatus Liberibacter asiaticus str. psy62] Length = 177 Score = 23.5 bits (49), Expect = 0.66, Method: Compositional matrix adjust. Identities = 14/56 (25%), Positives = 26/56 (46%), Gaps = 10/56 (17%) Query: 17 PVEVQVMVSPGRVGVQIVGLPDKAVIESRERIQSHFIHAGLLFLVNELPSIYLQLI 72 P+ V M G + +I+ +P K + + IQS+ ++P+ YLQ + Sbjct: 91 PIGVMKMEDDGGIDEKILAVPSKNITSLYDSIQSY----------EDVPNAYLQKV 136 >gi|254780523|ref|YP_003064936.1| flagellar hook-associated protein FlgL [Candidatus Liberibacter asiaticus str. psy62] Length = 357 Score = 21.9 bits (45), Expect = 2.1, Method: Composition-based stats. Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 7/85 (8%) Query: 5 ISTIAFQGIKGIPVEVQVM-VSPGRVGVQIVGLPDK-----AVIESRERIQSHFIHAGLL 58 +ST+ QG+ GI + V+ +S + + V L +K I ++ H HA L Sbjct: 274 LSTVQ-QGLSGIIEQRAVLGISEKNINEERVFLQNKNNIIDTYISKSIGVEQHTAHAQLS 332 Query: 59 FLVNELPSIYLQLIYQKKDLIMIYL 83 L+N++ Y+ +K I+ YL Sbjct: 333 TLINKIEMSYMITTKLQKLSILNYL 357 >gi|254781170|ref|YP_003065583.1| deoxyribodipyrimidine photolyase [Candidatus Liberibacter asiaticus str. psy62] Length = 483 Score = 21.2 bits (43), Expect = 3.4, Method: Composition-based stats. Identities = 8/10 (80%), Positives = 9/10 (90%) Query: 49 QSHFIHAGLL 58 QSHFI+A LL Sbjct: 57 QSHFIYASLL 66 >gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Score = 20.8 bits (42), Expect = 4.3, Method: Composition-based stats. Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 58 LFLVNELPSIYLQLIYQKKDLIMIYL 83 F + LPS ++ ++Y L M+++ Sbjct: 17 FFCITILPSFFINILYLTNPLYMMHI 42 >gi|254780622|ref|YP_003065035.1| bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 405 Score = 20.0 bits (40), Expect = 7.5, Method: Compositional matrix adjust. Identities = 8/24 (33%), Positives = 15/24 (62%) Query: 2 ISRISTIAFQGIKGIPVEVQVMVS 25 + R + + +K +PV++ VMVS Sbjct: 255 VERAEDMLQEVLKALPVDIAVMVS 278 >gi|254780419|ref|YP_003064832.1| aspartyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 622 Score = 19.6 bits (39), Expect = 9.4, Method: Composition-based stats. Identities = 7/22 (31%), Positives = 13/22 (59%) Query: 32 QIVGLPDKAVIESRERIQSHFI 53 Q+V PD A E + ++S ++ Sbjct: 49 QVVANPDSACFEIAKSVRSEWV 70 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.145 0.407 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,652 Number of Sequences: 1233 Number of extensions: 1820 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 87 length of database: 328,796 effective HSP length: 56 effective length of query: 31 effective length of database: 259,748 effective search space: 8052188 effective search space used: 8052188 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.3 bits) S2: 31 (16.5 bits)