BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer
[Candidatus Liberibacter asiaticus str. psy62]
         (1828 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781029|ref|YP_003065442.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str.
            psy62]
 gi|254040706|gb|ACT57502.1| chemotaxis sensory transducer [Candidatus Liberibacter asiaticus str.
            psy62]
          Length = 1828

 Score = 3667 bits (9508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1828/1828 (100%), Positives = 1828/1828 (100%)

Query: 1    MSNKKENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSK 60
            MSNKKENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSK
Sbjct: 1    MSNKKENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSK 60

Query: 61   NFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLI 120
            NFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLI
Sbjct: 61   NFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLI 120

Query: 121  KFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIAL 180
            KFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIAL
Sbjct: 121  KFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIAL 180

Query: 181  RLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSE 240
            RLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSE
Sbjct: 181  RLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSE 240

Query: 241  MRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSI 300
            MRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSI
Sbjct: 241  MRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSI 300

Query: 301  VDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSG 360
            VDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSG
Sbjct: 301  VDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSG 360

Query: 361  RSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLND 420
            RSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLND
Sbjct: 361  RSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLND 420

Query: 421  VLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDF 480
            VLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDF
Sbjct: 421  VLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDF 480

Query: 481  SSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILS 540
            SSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILS
Sbjct: 481  SSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILS 540

Query: 541  KKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQK 600
            KKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQK
Sbjct: 541  KKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQK 600

Query: 601  VSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQ 660
            VSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQ
Sbjct: 601  VSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQ 660

Query: 661  KSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFND 720
            KSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFND
Sbjct: 661  KSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFND 720

Query: 721  TFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDV 780
            TFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDV
Sbjct: 721  TFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDV 780

Query: 781  ETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFEN 840
            ETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFEN
Sbjct: 781  ETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFEN 840

Query: 841  NLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISAS 900
            NLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISAS
Sbjct: 841  NLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISAS 900

Query: 901  NTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIR 960
            NTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIR
Sbjct: 901  NTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIR 960

Query: 961  DILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST 1020
            DILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST
Sbjct: 961  DILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST 1020

Query: 1021 QTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLE 1080
            QTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLE
Sbjct: 1021 QTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLE 1080

Query: 1081 ISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQ 1140
            ISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQ
Sbjct: 1081 ISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQ 1140

Query: 1141 IIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTN 1200
            IIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTN
Sbjct: 1141 IIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTN 1200

Query: 1201 ESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSM 1260
            ESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSM
Sbjct: 1201 ESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSM 1260

Query: 1261 LLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLI 1320
            LLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLI
Sbjct: 1261 LLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLI 1320

Query: 1321 SDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLF 1380
            SDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLF
Sbjct: 1321 SDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLF 1380

Query: 1381 EKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDL 1440
            EKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDL
Sbjct: 1381 EKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDL 1440

Query: 1441 TSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
            TSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET
Sbjct: 1441 TSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
            RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL
Sbjct: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK
Sbjct: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKK 1680
            EAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKK
Sbjct: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKK 1680

Query: 1681 TKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLW 1740
            TKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLW
Sbjct: 1681 TKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLW 1740

Query: 1741 KSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSND 1800
            KSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSND
Sbjct: 1741 KSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSND 1800

Query: 1801 DSPLVQEHIMSNYGKVYTMLVHASGRTL 1828
            DSPLVQEHIMSNYGKVYTMLVHASGRTL
Sbjct: 1801 DSPLVQEHIMSNYGKVYTMLVHASGRTL 1828


>gi|315122601|ref|YP_004063090.1| chemotaxis sensory transducer [Candidatus Liberibacter solanacearum
            CLso-ZC1]
 gi|313496003|gb|ADR52602.1| chemotaxis sensory transducer [Candidatus Liberibacter solanacearum
            CLso-ZC1]
          Length = 1670

 Score = 2197 bits (5692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1117/1673 (66%), Positives = 1417/1673 (84%), Gaps = 8/1673 (0%)

Query: 161  MISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASE 220
            MISRARDMHDASQSIA IALRL+DPEEYSSEK+ SISSAVR+EI+ +TEEI+RA+SRAS+
Sbjct: 1    MISRARDMHDASQSIAKIALRLVDPEEYSSEKILSISSAVRREIMTITEEIERAVSRASD 60

Query: 221  LEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELS 280
            LEK VRSEI+VLE+NY K+E+R  NIT  L++EREAI++HG QL TSIAEVHE+LKEELS
Sbjct: 61   LEKIVRSEIDVLEDNYNKNEVRAHNITHKLREEREAIVDHGMQLRTSIAEVHEALKEELS 120

Query: 281  LTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIV 340
            LTSEEIS+HLSRA DSFQSIVD+RIAK+T+KT R+VQESA+TISSKIDQLLEVL S+S++
Sbjct: 121  LTSEEISIHLSRATDSFQSIVDMRIAKLTDKTNRVVQESAETISSKIDQLLEVLDSSSMI 180

Query: 341  ITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHI 400
            IT+DFDNRIE+LSN L+NSGRSLAN +  +  MLGNNTDK+S+ LKEQS QF ++FTSHI
Sbjct: 181  ITEDFDNRIETLSNALDNSGRSLANHLSIHASMLGNNTDKISLTLKEQSHQFTESFTSHI 240

Query: 401  CEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLEN 460
            CEMS FFSEKQ SIT TLND++Q+LR+S QEKE+ F +NL+STTDNTL EVDNRT+ +EN
Sbjct: 241  CEMSKFFSEKQSSITSTLNDMIQNLRVSFQEKEELFRNNLQSTTDNTLSEVDNRTSIIEN 300

Query: 461  RITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSN 520
             I  FL +  ETFN  I +F  F++ N +EFE+ L+ NI+KL GCF +SH NMEDLF+SN
Sbjct: 301  TINKFLTDTAETFNKRIAEFGHFFERNFNEFETTLKDNINKLNGCFENSHTNMEDLFISN 360

Query: 521  IQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRID 580
            I+TI SNLDKKTL+ E  LS KQNNI+ +T  N E+LEN LTNSI++LK +L+E+RQ+ID
Sbjct: 361  IKTIDSNLDKKTLILEGTLSTKQNNITHLTEANAEKLENILTNSIDNLKGVLDERRQKID 420

Query: 581  SDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISN 640
            +D+GKKSEELC+SF+SSYQKVSNVIS+REK FSNSL R Q  FEE +AG PQSI+DSISN
Sbjct: 421  TDLGKKSEELCTSFDSSYQKVSNVISEREKSFSNSLIRAQLQFEEALAGRPQSIIDSISN 480

Query: 641  S----TNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNI 696
            +    T+ +YDK MVLAAALSE+QKSLDNSLK HA+DVV+KIT AE+QLVNRF ESS+ I
Sbjct: 481  NIKKLTDTIYDKTMVLAAALSENQKSLDNSLKKHASDVVNKITIAESQLVNRFTESSEQI 540

Query: 697  ICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLH 756
            + SY+++NNKLE I ++HL S  DTF+NKS HV+ +L++S ++I  + S N KRMEE+L 
Sbjct: 541  VFSYSNNNNKLEKILKQHLASLTDTFSNKSSHVNNMLESSAENIKSMLSTNTKRMEEVLS 600

Query: 757  SGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELL 816
            +GS NI  ELS +S  ++ SIDDV+ IST L++RCQ LG+DL+++++K+L SL++AQELL
Sbjct: 601  NGSENIGLELSTVSNTISHSIDDVKAISTELEQRCQGLGNDLISNANKILFSLEEAQELL 660

Query: 817  CTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLT 876
              TFA+RN++FV+ L++NQSKFE+NLV++S L++  LS DI+ +T+IAY+KA+D+ANSLT
Sbjct: 661  NNTFAKRNENFVDTLSENQSKFEHNLVSKSQLIIGSLSQDIKNMTEIAYAKAMDMANSLT 720

Query: 877  EIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDV 936
            +IQGN+GVTL+NHSQ +L+KIS ++T VA+ F+E M +I L+Y++N Q LDKKLSDHI++
Sbjct: 721  KIQGNIGVTLDNHSQIILKKISDADTNVAQAFKERMDSICLAYNDNHQILDKKLSDHINI 780

Query: 937  LRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLL 996
            L+  LAG+E+K+DG+I SASQFI+ ILDENS+RIE+LL+  N+SVNSTLL SHQKFDRLL
Sbjct: 781  LQDVLAGNESKMDGSIESASQFIKKILDENSARIEALLNYGNDSVNSTLLCSHQKFDRLL 840

Query: 997  QEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQT 1056
            +EKSDELIQ+LDN AS LSTAVS +TINL+NNLKE+E SLS+ V+ S+SSFK LS++I  
Sbjct: 841  KEKSDELIQVLDNSASSLSTAVSKETINLQNNLKEREVSLSQTVNDSSSSFKDLSENIND 900

Query: 1057 LAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISE 1116
            L Q+LVSV+G+MSQST D+SG+LE S+DSVN+K+QKCREFFG+ I  FM+EISK+ME+SE
Sbjct: 901  LTQKLVSVVGNMSQSTIDVSGQLEASMDSVNEKVQKCREFFGEKIAIFMNEISKIMEVSE 960

Query: 1117 KRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSA 1176
            +RISQRTQEISQQLLQNNDV+T+QIID+TSR+ GEI +I+ KF+ET ++LE++E KF S 
Sbjct: 961  QRISQRTQEISQQLLQNNDVVTDQIIDNTSRISGEIDNITKKFVETGQLLEEKEGKFRST 1020

Query: 1177 LDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFK 1236
            L+ F++N+S +  +VD  + SHTNE+RS+IE+RI EVK+++SN+D AL  + ST+  +FK
Sbjct: 1021 LNHFNNNLSEVFHEVDQVVLSHTNEARSVIEKRISEVKEIVSNVDNALNVHESTMLNKFK 1080

Query: 1237 EYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNA 1296
            EYV+ FE+NME  +SL DKNN+SM LSF ERS ILD++LSQRS+EIS+SIS AFHKEG+A
Sbjct: 1081 EYVKSFESNMEEWKSLLDKNNNSMQLSFDERSTILDSLLSQRSVEISNSISDAFHKEGDA 1140

Query: 1297 VVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLH 1356
            V N+ID+QIY+AANALKKLE LLI+DVEKIT+RI+DSS DVTTI++ AT+SLNKVD+ L 
Sbjct: 1141 VANIIDKQIYDAANALKKLEELLINDVEKITHRISDSSLDVTTILNAATNSLNKVDKSLF 1200

Query: 1357 QTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSH 1416
            QTTNRI +TTG I TVL+ESSKLF+ KIKDL EIS+  L +MSEIV+KFDKNSQIL+KSH
Sbjct: 1201 QTTNRIIDTTGQISTVLSESSKLFDNKIKDLNEISKDVLFRMSEIVNKFDKNSQILLKSH 1260

Query: 1417 DSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTV 1476
            D L+K QSET L+LDK ANNL  LT++L+SKSSEAQKFV+S+LVD+KK+VEQ +FLSD V
Sbjct: 1261 DLLVKTQSETGLALDKGANNLASLTNKLISKSSEAQKFVISLLVDIKKVVEQTNFLSDKV 1320

Query: 1477 VKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSY 1536
            VK+MT  +Q+SF+ I+GTLSNIE RSRDT++LIDH+L +IGNKTVKTID +F  ++EKS 
Sbjct: 1321 VKSMTHGLQASFLDIEGTLSNIEMRSRDTIKLIDHDLTNIGNKTVKTIDKSFGEIEEKSR 1380

Query: 1537 DLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALT 1596
            +LSNH+ QKI S+IPN+EN FSTLE+KSDQSM+ FLDSLNNKV++FT+KLSKTS++I+LT
Sbjct: 1381 NLSNHIAQKIHSSIPNVENAFSTLEKKSDQSMKEFLDSLNNKVNTFTEKLSKTSEEISLT 1440

Query: 1597 SRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAA 1656
            S +I E+LN+SR++LKRDS+SLA+EAKESADTIR+AIEEQINTL+DFQKL+TDSV++N  
Sbjct: 1441 SHKITEELNDSRNVLKRDSISLAQEAKESADTIRNAIEEQINTLRDFQKLVTDSVQSNPT 1500

Query: 1657 SYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDS 1716
             Y+K L SD  N  Q+DK  S K+   N +IK+WFN I+ S+T +KGK SS     D + 
Sbjct: 1501 FYDKKLSSDNSNPPQLDKPESNKEITKNKSIKKWFNDIVHSATLNKGKISSS---KDGNL 1557

Query: 1717 LSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSA 1776
            L SIDSLV +IS+FID DAFV LWK YT GEDD+FS++LYT++GQK+F N+QE+Y  +  
Sbjct: 1558 LYSIDSLVSDISQFIDCDAFVDLWKRYTQGEDDLFSQQLYTLRGQKLFRNIQEKYVNNLE 1617

Query: 1777 LRNAIDRYISNFEEMLSEIAQSNDDSPLV-QEHIMSNYGKVYTMLVHASGRTL 1828
             R+ +D YI+NFEEMLSE   S+ DS  V QEHIMSNYGKVYTMLVHASGRTL
Sbjct: 1618 FRSDVDSYITNFEEMLSESVHSSSDSNSVTQEHIMSNYGKVYTMLVHASGRTL 1670


>gi|150396748|ref|YP_001327215.1| chemotaxis sensory transducer [Sinorhizobium medicae WSM419]
 gi|150028263|gb|ABR60380.1| chemotaxis sensory transducer [Sinorhizobium medicae WSM419]
          Length = 2052

 Score =  541 bits (1395), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 468/1978 (23%), Positives = 913/1978 (46%), Gaps = 244/1978 (12%)

Query: 74   FYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSP----MD 129
              PAND         L+++   S   A+R A + SLIW A  LG     Y  +P    + 
Sbjct: 92   LAPANDDTRKSPAATLRSLEVRSSRAAIRVAALVSLIWTAAALGVAHLLY--APEIWQIR 149

Query: 130  SFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYS 189
            S  D A  P VI + L +++ P++LFFSF IMI+RA+++  A++S+A +A+RL +PE  +
Sbjct: 150  SLGDLAAMPGVIGVLLGIAL-PVMLFFSFAIMIARAQELRSAARSMAEVAMRLAEPETNA 208

Query: 190  SEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQN 249
            ++++ ++  AVR+E+  M E I+R I+RA+ELE  V SE+  LE +Y+ +E+R+  + Q 
Sbjct: 209  ADRVMTVGQAVRREVSAMNEGIERTIARATELEALVHSEVSALERSYSDNELRVRTLVQE 268

Query: 250  LKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVT 309
            L  EREAII H  ++ T+IA  H  LK++L   SE+I+  ++ + ++F S++D R A +T
Sbjct: 269  LGLEREAIIGHSERIRTAIAGAHTKLKDDLETASEDIASRIAVSGEAFASLIDTRAAALT 328

Query: 310  EKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGN 369
            +K+   ++  +  +S++ D LL  L +  + ++ +FD+R+++LS  L   G  L +Q   
Sbjct: 329  DKSDHALENLSTMLSTRTDALLSGLTTAGVALSSEFDSRLDALSENLTQRGEQLLSQFET 388

Query: 370  YTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISL 429
                L  NT+K++ AL E+++Q  +   +   +++      Q++I+  L+DVL SL  +L
Sbjct: 389  RASTLDANTEKLNAALNERARQLNETLIARTRDLNESIRIGQQAISGGLDDVLSSLNTAL 448

Query: 430  QEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLS 489
             EK  SF  +LKS+ D+ + ++D R    E ++   +  +   F+    +F+S +    S
Sbjct: 449  DEKGASFRQSLKSSADDAIMDLDLRGGFFEEKLQTTVGHLATAFDERFHEFASAFDKRAS 508

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTL-----------LFEDI 538
            + ++ L  ++ ++    +     +     S+++ I S L  ++L             E+ 
Sbjct: 509  QLDTKLMESLHRINETVSGGSEAIGGALDSSVEKINSALSDQSLTLATALGATQDFIEET 568

Query: 539  LSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSY 598
            +  + N +S +      R+E+ L++   SL   L E + RI++  GK+++ L  +  +S 
Sbjct: 569  IGSRTNELSSLIGNAHNRIESVLSDKTGSLMGALTEAQDRIENGFGKRADALAEALTTSE 628

Query: 599  QKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSE 658
            Q++++ +  R   F + L    +  E+T+ G    I  +I+ S + L +        LSE
Sbjct: 629  QRLTDGLDSRTSAFIDGLQSAHARIEQTLTGSTDEITSAIAASQHRLDNT-------LSE 681

Query: 659  SQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF 718
               +L  +L + A+ + + +    ++L     E  + I    ++    L+ +  +     
Sbjct: 682  RTAALSGALASGASVIENAVGGTADRLERVLSERGRTITDVLSTQTTALDEVLAERATQI 741

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELS-AISKAMNKSI 777
            N T + ++  ++  L    + + D  +  A  + E +      IE++LS ++S+      
Sbjct: 742  NSTMSARASEMADSLSRHAEDVADSLTFRAMAVAETMTDRVGEIENKLSQSVSEVAENLG 801

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
              V  I+  L +    +  DL +   ++  +L      +      R      +LA   ++
Sbjct: 802  GRVSLIAGTLTDTSARIAEDLSSRVGRISETLAGTSAEIAEALTARTSEATASLAGKAAE 861

Query: 838  FENNLVNQSHLLLDKLSS---DIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAML 894
             E  L  ++  L D L++    I+   D    +AI+V  S+ + +  +   L + S AM 
Sbjct: 862  IEQTLTGRAEHLRDTLTTTHDQIRSTLDDRI-RAINV--SVGQGREQLEELLSDQSMAMA 918

Query: 895  EKISASNTLVAKTFEECMSNILLSYDENRQTL-------DKKLSDHIDVLRQNLAGSENK 947
              ++ S +++  + EE  + I  + +   + L          L+   + + Q L+G   +
Sbjct: 919  TTLATSASMLEMSIEERQAAIAGAIERGTEALAARASEATAALAGKANEIDQTLSGKTAQ 978

Query: 948  IDGAIGSASQFIRDILDENSS-----------RIESLLSCSNNSVNSTLLRSHQKFDRLL 996
            +  A+ S  + +R  LD+  S           R+E +LS  + ++ +TL  S    +  L
Sbjct: 979  LRDALASTHEQLRTTLDDRISAIDLSVGQGRERLEEILSDQSVAMATTLATSASMLEMSL 1038

Query: 997  QEKSDELIQLLDNKASCLSTAVSTQTINLENNLKE-------QEKSLSRVVDTSASSF-- 1047
            +E+   +   +D  A  L + + + T  +   L E          SL+  VD S S    
Sbjct: 1039 EERQASIAGAIDRSAEALDSRMRSTTGEIAERLAETADQISLAADSLTNRVDISISGVNS 1098

Query: 1048 ------KYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI----------- 1090
                    +  S+ +L + + S +G +     D   ++E SL S+ ++I           
Sbjct: 1099 RLDETGARIETSLGSLEERIRSSVGDVDAVLGDTGARIETSLGSLEERIRDSVGSVNAIV 1158

Query: 1091 ----QKCREFFGDNIVAFMDEISK--------VMEISEKRISQRTQEISQQL---LQN-N 1134
                Q+  E  G+     +D IS+         +E    RI +R   + + L   L+N N
Sbjct: 1159 DNAGQRIAESLGER-AGEIDRISETAATRISTAIEAGAGRIEERLGTMDRALNIGLENVN 1217

Query: 1135 DVITNQIIDSTSRVRGEIVDISNKF-IETSR---VLEQREEKFHSALDS----FSDNISR 1186
              I  +     + +RG + D + +   E +R   +L +    F  AL +    F+ +I +
Sbjct: 1218 RTIEGKAAALVTSLRGAVSDATQEIDAEAARSAGLLSKAGADFAGALAASNAEFASSIEQ 1277

Query: 1187 ILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNM 1246
                   T + H   +RS+ E         L++ +  + S+  ++ +   E  +  +   
Sbjct: 1278 T---ASVTAARHAEIARSVTEA-AETATARLASTNSQIASHAKSIQQSLTEAEKSLDARG 1333

Query: 1247 ENMESLFDKNN---DSMLLSFK-ERSNILDN----ILSQ----------RSMEISDSISG 1288
            +++ S  D++    +SML     E S +LD     ++ Q          R   ++   + 
Sbjct: 1334 QSIRSTLDESTRELNSMLAGRSIELSRLLDEQARPVIEQYAATGKEAAERIATLTQESAD 1393

Query: 1289 AFHKEGNAVVNVIDQQIY-----------NAANALKKLEALLISDVEKITNRITDSSQDV 1337
                E  A++N I ++               A A+K +E  L S    + +++  S+  +
Sbjct: 1394 RLRAENAALINAITERTGETLDAISMRAEETAKAMKMVENRLQSTAMGLIDQLASSNSAI 1453

Query: 1338 TTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQ 1397
             ++I  A+ +L  +D+RL  T  +++ET      +L+ S++L E K+  L +IS  +L Q
Sbjct: 1454 ASVIDQASGNLGDMDQRLEATAAKVSETARQASDMLSTSTRLIEGKVDKLSDISSSTLSQ 1513

Query: 1398 MSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMS 1457
            +  IV +F+ +S++L ++ D L  AQS    +L++  + L  L+  LV +S E ++ + +
Sbjct: 1514 IGGIVGRFEDHSKVLGQASDLLAAAQSNLVSTLEERQDALRTLSVGLVQRSEEIERTMRA 1573

Query: 1458 ILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRS-------RDTV---- 1506
            +   V    ++A+  S  V  N+   IQSSF  +   LSN E R+       RDT+    
Sbjct: 1574 LEGFVDGAFQRAEERSGQVAGNLRSGIQSSFADVGRLLSNTEQRATEAAEALRDTLVKAS 1633

Query: 1507 -----------------------RL---IDHNLAD------------------------- 1515
                                   RL   ++ + AD                         
Sbjct: 1634 DEAAASVEGVFTQAEERSRQIADRLRSGVETSFADANKTLSQVEGRALSASEALRQVVAK 1693

Query: 1516 IGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSL 1575
             G +  + ++  F T++E++ D ++ +R  I +++ ++E + +   +KSD       +++
Sbjct: 1694 TGEEAGQALEGAFATVEERAKDAASRLRGSIGASVSDVERMLTESGKKSDGVAVQLREAV 1753

Query: 1576 NNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEE 1635
               ++    + +  +DDI  ++  I ++L+ +R+ LKR +  L +EAKE+A  +R A+ E
Sbjct: 1754 RQAIEDAIGRFNGATDDIRRSAGEIRKELDMTREELKRGAFDLPEEAKENAALMRRAVGE 1813

Query: 1636 QINTLKDFQKLITDS---------VKNNAASYNKGLHS--------------------DE 1666
            QI  L++  ++I  S         V+   A       +                      
Sbjct: 1814 QIKALQELSEIIGKSSSQLEIAQPVRQQEAPVAPVRPAPQAAAPQPPAAQPAPNAALRGS 1873

Query: 1667 YNISQVDK-----RPSGKKTKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDSLS--- 1718
              I Q  +     RP   + +       W   +L +++  +  +++    +D   ++   
Sbjct: 1874 LGIEQATRPLQPARPPATEERAEEG-GGWMRDLLRAASREEEPAAARPRATDGQPVAKAG 1932

Query: 1719 ----------SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQ 1768
                      S++SL  +I++ ID+DA V LW+ Y  GE D+F++RLYT+KGQ+ F  ++
Sbjct: 1933 DSRNPRHVVESLNSLSVDIARAIDHDASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIK 1992

Query: 1769 EQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             +Y  +   R A+DRYI++FE++L+++A+++ D  + Q ++ S+ GKVYTML HA+GR
Sbjct: 1993 RKYDREPEFRTAVDRYIADFEKLLADVARNDPDKRITQTYLTSDTGKVYTMLAHAAGR 2050


>gi|227822215|ref|YP_002826186.1| kinesin-like protein [Sinorhizobium fredii NGR234]
 gi|227341215|gb|ACP25433.1| kinesin-like protein [Sinorhizobium fredii NGR234]
          Length = 2109

 Score =  536 bits (1382), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 483/2110 (22%), Positives = 935/2110 (44%), Gaps = 325/2110 (15%)

Query: 13   DSLK-EFEEQSTSDSHENKKRHHSRK---KHKYSRRDDSIESKDRQQTTLSKNFKQASNK 68
            D LK    ++S+ D  E K    S+K   +HK + ++     K R   T      + + K
Sbjct: 27   DDLKSALNDKSSLDDPEEKVSEPSKKAASEHKRAVKEQPEAQKARTIETPRNLAPEPAPK 86

Query: 69   QTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSP- 127
            Q      PAND      T +L+++   S   A+R A + SL+W     G  I     +P 
Sbjct: 87   QPA--LSPANDDTRRSPTAMLRSLEVRSSRAAIRVAALISLVWALA--GVAIGHLLYAPQ 142

Query: 128  ---MDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLID 184
               + S  D A  P  I + + +++ P++LFFSF IMI+RA+++ +A++S+A +ALRL +
Sbjct: 143  IWQIRSLGDLAATPGAIGILIGIAL-PVMLFFSFAIMIARAQELRNAARSMAEVALRLAE 201

Query: 185  PEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRID 244
            PE  +++++ ++  AVR+E+  M E I+R I+RA+ELE  V SE+  LE +Y+++E+R+ 
Sbjct: 202  PETAAADRVMAVGQAVRREVSAMNEGIERTIARATELEALVHSEVSALERSYSENELRVR 261

Query: 245  NITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVR 304
             + Q L  EREAI+ H  ++ ++IA  H  LK++L L SE+I+  ++ + ++F S++D R
Sbjct: 262  TLVQELGLEREAIVGHSERIRSAIAGAHGKLKDDLELASEDIASRIAVSGEAFASLIDTR 321

Query: 305  IAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLA 364
             A ++E++   +Q     + ++ D LL  L +  + + K+FD R+++LS  L   G  L 
Sbjct: 322  AAALSERSDHALQTLGTMLDTRTDALLSGLTNAGVTLNKEFDVRLDALSENLTKRGEHLL 381

Query: 365  NQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQS 424
            +Q       L  NT+K++ AL E+++Q  +   +   +++   S  Q++I   L D+L S
Sbjct: 382  SQFETRASTLDTNTEKLNTALNERARQLNETLIARTRDLNESLSVGQQAIAGGLEDMLSS 441

Query: 425  LRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFY 484
            L ++L EK  SF  +LK++ D+ + ++D R    E ++   +  +   F+    +F+S +
Sbjct: 442  LNVALDEKGASFRQSLKTSADDAIMDLDLRGGFFEEKLQTTVGHLATAFDARFHEFASAF 501

Query: 485  KDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQN 544
                S  ++ L  ++ ++    +     +     S+++ IGS L  ++L     L   Q+
Sbjct: 502  DKRASLLDTKLMESLHRINETVSGGSDAIGTALDSSVEKIGSALSDQSLTLATALGTTQD 561

Query: 545  NISQITSMNT-----------ERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSS 593
             I +     T            R+E  L++   SL   L E ++RI+   G++++ L  +
Sbjct: 562  FIEETIGSRTLELSNLIGNAHSRIEGVLSDKTTSLMSALTEAQERIEGGFGQRADALAHA 621

Query: 594  FNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNST----NNLYDKI 649
              +S Q ++  +  R   F + L    S  E+T+ G    I  +I+ S     N L ++ 
Sbjct: 622  LTTSEQSLTEGMDSRTSAFIDGLQTAHSRIEQTLTGSTDEITSAIAASQHRLDNTLSERT 681

Query: 650  MVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLET 709
              L+AAL+    +L++++    TD + ++            E  + I  +      +LE 
Sbjct: 682  AALSAALTSGATALEDAV-GGTTDRLERV----------LSERGETISAALTGQTTRLEG 730

Query: 710  IFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELS-- 767
            +  +   +  DT  +++  + G+L   +  I+   S  A  M + L   + ++   L+  
Sbjct: 731  VLSERSQAITDTLASQTAALDGVLTERSAQINSTMSARASEMADSLSRHAEDVADSLTFR 790

Query: 768  --AISKAMNKSIDDVE-TISTALKERCQELGS------------------DLVNHSDKVL 806
              A+++ M   + ++E  +S ++ E  + LG                   DL +   K+ 
Sbjct: 791  AMAVAETMTDRVGEIENKLSQSVSEVAENLGGRVSQIADTLTDTSARIAEDLSSRVGKIS 850

Query: 807  SSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYS 866
             SL      +      R      +LA   ++ E  L  ++  L D L++  +++     +
Sbjct: 851  DSLAGTSAEIAEALTARTSEATASLAGKAAEIEQTLSGKADQLRDTLTTTHEQIRSTLDN 910

Query: 867  --KAIDVANSLTEIQGNVGVT--LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDEN 922
              KAID+A      QG   +   L + S A+   ++ S +++  + EE  ++I  + + +
Sbjct: 911  RIKAIDLAVG----QGREQLEELLSDQSMAIATTLATSASMLEMSLEERQASIAGAIERS 966

Query: 923  RQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDE-----------NSSRIE 971
             ++L  + S+ +     +LAG   +ID  +   +  +R  LDE              R+E
Sbjct: 967  TESLTTRTSEAV----ASLAGKAAEIDQTLSGKAAQLRSTLDEQVNTINLAVGQGRERLE 1022

Query: 972  SLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKE 1031
             LLS  + ++ +TL  S    +  L+E+   +   +D     L   + + T N+   L E
Sbjct: 1023 ELLSDQSMAMATTLATSASMLEMSLEERQASIAGAIDRGTEALDARMRSTTGNIAERLAE 1082

Query: 1032 QEKSLSRVVDTSA----------------------SSFKYLSDSIQT-----------LA 1058
                +S   DT                        SSF  L D ++              
Sbjct: 1083 TADQISLAADTLTNRVDISLNGIDNRLDETGARIESSFASLEDRVRGGVSNVSAIVDDTG 1142

Query: 1059 QELVSVIGSMSQS-----------TTDISGKLEISLDSVNQKIQ---------------- 1091
              L + +GS+                D  G++E +L S+  +I+                
Sbjct: 1143 GRLETTLGSLEDRIRDSVSNVRAIVDDTGGRIETTLGSLEDRIRDSVGSVNAIVDTAGQR 1202

Query: 1092 -------------KCREFFGDNIVAFMDE----ISKVMEISEKRISQRTQEISQQL---L 1131
                         +  E     I + MD+    I+  ME    RI +R   + + L   L
Sbjct: 1203 ITESLAERAGEIDRISETAAARITSAMDDGTGRIASAMEAGAGRIEERLGTMDRALTIGL 1262

Query: 1132 QN-NDVITNQIIDSTSRVRGEIVDISNKF-IETSR---VLEQREEKFHSALDS----FSD 1182
            +N N  I  +     + +RG + D + +   E +R   +L +    F SAL +    F++
Sbjct: 1263 ENVNRTIEGKAAALVTSLRGAVSDAAQEIDAEAARSTELLSKAGADFASALAARNAEFAN 1322

Query: 1183 NI--------------SRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYG 1228
            +I              +RI+ +   + S+    +R  I      ++  L+  ++AL++ G
Sbjct: 1323 SIESTASATATRHADLARIVTEAADSASARLASTRDQIASHTASIQQSLTEAEKALDARG 1382

Query: 1229 ----STVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISD 1284
                ST+    +E           +  L D+    ++  +          ++  + E +D
Sbjct: 1383 QSIRSTLDDSTRELNSMLAGRSLELTRLLDEQARPVIEQYAATGKEAAGRIAALTQESAD 1442

Query: 1285 SISGAFHKEGNAVVNVIDQQIY-----------NAANALKKLEALLISDVEKITNRITDS 1333
             +      E  A+VN I ++               A A+K +E  L S    + ++++ +
Sbjct: 1443 RL----RAENAALVNAITERTSETLDAISLRAEETAKAMKMVENRLQSTAMGLIDQLSTN 1498

Query: 1334 SQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRV 1393
            +  + ++I  AT SL  +D+RL     +++E+T H   +L+ S++L E ++  L +I+  
Sbjct: 1499 NSAIASVIEQATGSLGDMDQRLEAAAAKVSESTRHASDMLSSSTRLIEGRVDKLSDIASS 1558

Query: 1394 SLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQK 1453
            +L Q+  IV +F+ +S++L ++ + L  AQS    +L++  + L  L+  LV +S E ++
Sbjct: 1559 TLSQIGGIVGRFEDHSKVLGQASNLLAAAQSNLVSTLEERQDALRTLSVGLVQRSEEIER 1618

Query: 1454 FVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNL 1513
             + ++   V    ++A+  S  V  N+ + IQSSF  +   LSN E R+ +    + + L
Sbjct: 1619 TMRALEGFVDGAFQRAEERSGQVAGNLRNGIQSSFADVGRLLSNTEQRAAEAAEAMRNTL 1678

Query: 1514 ADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN--------------------- 1552
            A+ G +   +++  F   +E+S  ++  +R  + ++I                       
Sbjct: 1679 AEAGGEAAASVEGVFAHAEERSRQIAETLRSGVETSIAGANETLSEIEGRAVSASEALRQ 1738

Query: 1553 ------------IENIFSTLEEK-----------------------------SDQSMQVF 1571
                        +E  FS+ E++                             SD      
Sbjct: 1739 AVAKAGDEASQALEGAFSSAEQRAKDAASRLRGSIGASVSDVERMLAESGKKSDGVATQL 1798

Query: 1572 LDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRS 1631
             +++   +D    + S  +DDI  ++  I ++L+ +R+ LKR +  L +EAKE+A  +R 
Sbjct: 1799 REAVRQAIDEAISRFSGATDDIRRSAGEIRKELDMTREELKRGAFDLPEEAKENASVMRR 1858

Query: 1632 AIEEQINTLKDFQKLITDSV---------------------------------------- 1651
            A+ EQI  L++  ++I  S                                         
Sbjct: 1859 AVAEQIKALQELSEIIGKSSTQLEVAQPVRQQPALAAPTPAAQAPVVPPQPVVKQQPAVE 1918

Query: 1652 --KNNAASYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKSSSHI 1709
                 A +    L  ++        RPS  + +       W   +L +++  +   ++  
Sbjct: 1919 QQPAPAPALRGSLGLEQATRPLQPARPSAAEERVEEG-GGWMRDLLRAASREEEPQAARP 1977

Query: 1710 DISDKDSLS-------------SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLY 1756
              ++   ++             S++SL  +I++ ID+DA V+LW+ Y  GE D+F++RLY
Sbjct: 1978 RPAESQPVARPGDSRNPRHVVESLNSLSVDIARAIDHDASVELWRRYQRGERDVFTRRLY 2037

Query: 1757 TIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKV 1816
            T+KGQ+ F  ++ +Y  +   R A+DRYI++FE++L+++A+++ D  + Q ++ S+ GKV
Sbjct: 2038 TLKGQQTFDEIKRKYDREPEFRTAVDRYIADFEKLLADVARNDPDKRITQTYLTSDTGKV 2097

Query: 1817 YTMLVHASGR 1826
            YTML HA+GR
Sbjct: 2098 YTMLAHAAGR 2107


>gi|222086181|ref|YP_002544713.1| hypothetical protein Arad_2643 [Agrobacterium radiobacter K84]
 gi|221723629|gb|ACM26785.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 2225

 Score =  413 bits (1062), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 399/1727 (23%), Positives = 770/1727 (44%), Gaps = 297/1727 (17%)

Query: 74   FYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNS--PMDSF 131
            F PAND +      IL+ +   S + A+RNA + SL W+    G     Y +    + + 
Sbjct: 87   FAPANDANRASPASILKALDGGSQSNAVRNATIVSLFWIIGGAGLAFLLYGDQIRNIRTI 146

Query: 132  YDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSE 191
             D A  P VI   + + VVP+LLF++F +MISRA+DM +A++S+A +ALRL++PE  +SE
Sbjct: 147  ADLAALPGVIACIIGI-VVPVLLFYAFGMMISRAQDMRNAARSMAEVALRLVEPETVASE 205

Query: 192  KMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLK 251
            ++ ++  AVR+E+  M E I+R I+RA+ELE  V +E+  LE +Y  +E+R+  +   L 
Sbjct: 206  RIMTVGQAVRREVSAMNEGIERTIARATELETLVHTEVNALERSYADNELRVRGLVHELG 265

Query: 252  QEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEK 311
             ER+AI+NH  ++ +SI  VHE ++E+LSL +EEI+V LS + ++F S++D R A + E 
Sbjct: 266  SERDAIVNHAERIRSSIVGVHEQIREDLSLATEEIAVRLSTSGEAFASMIDTRAATLMET 325

Query: 312  TTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYT 371
            +   V+     +S+K D LL+ L+++   ++++FD+R+ESLS+TL   G+ L  Q     
Sbjct: 326  SDAAVEALGTLLSAKTDSLLQNLNASGFALSQEFDSRLESLSSTLAERGKELVGQFETRA 385

Query: 372  LMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQE 431
              L  NT+K++ AL E+++Q  +   +   E+S   +  ++SIT TL+ VL  L  SL E
Sbjct: 386  STLDANTEKLNTALNERARQLNETLVARTREISESLTGSERSITGTLDAVLSKLNSSLDE 445

Query: 432  KEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEF 491
            K  SF  +L+ST D+T+ ++D R+   E R  + +  +  TF+  +++F+S +       
Sbjct: 446  KGASFRQSLQSTADDTIMDIDLRSGFFEERFQSTVAHLSTTFDERVSEFTSAFDKRAGSL 505

Query: 492  ESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQ-------- 543
            +S L  ++ ++          ++ +  S+I+ +GS+L+ ++       +  Q        
Sbjct: 506  DSKLSESLARINETLGSGSDAIDGILTSSIERLGSSLNDQSFALATTFATGQEVLESAIG 565

Query: 544  --------------NNISQITSMNTERLENTLTNSINSLKDML-----------EEKRQR 578
                           ++S +    T+ L +        L D L           +     
Sbjct: 566  DRAGAFTSAVQGVARDVSTVLKTGTDELTSAFAGRSAELTDTLATHSSEFTKTVQTATTD 625

Query: 579  IDSDIGKKSEELCSSF----------------------NSSYQKVSNVISDREKLFSNSL 616
            I S + K + EL ++F                       S+++ V  V+++R      +L
Sbjct: 626  ISSALNKGTSELTNTFLGRANEINNTLSARTSEITQALGSAHEHVDAVMAERSSALFGAL 685

Query: 617  ARVQSHFEETIAGHPQSIVDSISNSTNNLY----DKIMVLAAALSESQKSLDNSLKAHAT 672
            +  Q+ FE+++A     I++++S +  NL     ++   L ++L+ESQ  L+N+L + A 
Sbjct: 686  SDHQTRFEQSLADRSAGIINAVSGTHENLTSALDERTSKLTSSLAESQVRLENTLASRAD 745

Query: 673  DVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGI 732
               + + +  ++L +  D+ +  +  + +   +++E           DT NN+++ ++  
Sbjct: 746  TFANTVADTHSKLADTLDDKAMALAIALSDGQSRIE-----------DTLNNRAELLTST 794

Query: 733  LKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVET---------- 782
            L ++   I D   + A  +   L  G + IE  L++ ++++  ++ D  +          
Sbjct: 795  LADTHAKIADTLDDKAMSLAIALSDGQSRIEDTLNSRTESLTSTLADTHSKIADTLDDKA 854

Query: 783  --ISTALKERCQELGSDLVNHSDKV-----------LSSLKQAQELLCTTFAQRNDSFVN 829
              ++ AL E    L   +  H++ V            ++L   Q  L  T A R ++  N
Sbjct: 855  MALAIALSESQARLDDTVAGHAEAVANTLDGKTKALAAALTHGQSRLEETLAHRAEAITN 914

Query: 830  A----------------------LADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSK 867
            A                      LAD Q++ EN+L ++   L + ++    K+      K
Sbjct: 915  AFSGNHNAVADTLDQKAVALAASLADTQARLENSLSSRMDALANTVAGTHDKIVGSLDDK 974

Query: 868  AIDVANSLTEIQGNVGVTLENHSQAM---------------------------------- 893
             + +A +L++ Q  +  TL N ++A+                                  
Sbjct: 975  TLALAIALSDNQARIEETLANSAEAITQSINHGHAALTDTLDDKSMAFAISLAENQSRFE 1034

Query: 894  ----------LEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAG 943
                      L+ +S + + VA  F +    I  +Y EN++ LD+ LS H D L   L  
Sbjct: 1035 STLEARANALLDSVSGAESRVAGAFGDKADAIRAAYTENQERLDRSLSAHTDALSGLLGS 1094

Query: 944  SENKIDGAIGSASQFIRDIL-------DENSS----RIESLLSCSNNSVNSTLLRSHQKF 992
            S ++++  +G +++ +   L       DEN +    R+ S L   +N+++ TL  +H + 
Sbjct: 1095 SSDRLETVVGGSAERVEKALGAGLSQMDENLASAYERMRSTLDDRSNAISVTLRDAHAQI 1154

Query: 993  DRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSF-KYLS 1051
            D  L E           +A+ + T+++T    LE +L+++E SL + +D SA +  + L 
Sbjct: 1155 DNTLME-----------QATAIGTSIATSASMLEMSLEDREASLRQTIDASAKTLEERLH 1203

Query: 1052 DSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKV 1111
                 +A  +    G + +S    S  L  S+D +  +  +     G  + A +  +   
Sbjct: 1204 SGAGDIAGRIQQAAGDIERSAASFSTNLNQSVDGMTSRFAET----GSRVEASLSAL--- 1256

Query: 1112 MEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREE 1171
                E RI +    ++ Q+    + +++ +    +R+     D + +    +  L++R  
Sbjct: 1257 ----ENRIHEGVGGVAAQVDAAGNRLSDTLASGAARIDSSGGDAATRL---TSALDERLA 1309

Query: 1172 KFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRA----LESY 1227
                ALDS                ++H N++   +E     +++ LS +DRA    LE+ 
Sbjct: 1310 TLAEALDSR---------------TTHLNQA---LESGSARIEERLSTMDRALNVGLEAV 1351

Query: 1228 GSTVFKQFKEYVQCFETNM----ENMESLFDKNNDSMLLSFKERSNILDN-------ILS 1276
              T+  +         T +    + M+S   +  D +  + ++ ++ L N       ++S
Sbjct: 1352 NRTIEGKATNLATTLRTAVADAAQGMDSEATRTADLLARTGQQFADDLGNHSDAFTRVMS 1411

Query: 1277 QRSMEI--------------SDSISGAFHKEGNAVVN-------VIDQQIYNAANALKKL 1315
            +RS EI              + +++  F + GNA+VN       ++  Q+   + AL   
Sbjct: 1412 ERSEEIVGRVSETHNRLASQAAAVAQTFSEAGNAIVNKVAEAETLVGNQVNAISQALSSA 1471

Query: 1316 EALLISDVEKITNRITDSSQDVTTIISDATDSL----NKVDERLHQTTNRITETTGHIDT 1371
            E  L +    I N +   S+ + + ++    +L    N +   L +  N I  T   +D 
Sbjct: 1472 EQSLEARGSAIRNTLAGGSEQIASTMAQVERALDERSNAIRSNLEERANEINATLADVDK 1531

Query: 1372 VL-AESSKL---FEKKIKDLG--------EISRVSLLQMSEIVSKFDKNSQ-----ILIK 1414
             L A  + +    +++ ++L         E+SR+   +   IV ++    Q     I   
Sbjct: 1532 ALEARGTSIRTSLDERTRELNSMLAGRSTELSRLIDEKARPIVDRYAATGQEAAALISQA 1591

Query: 1415 SHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMS----ILVDVKKIVEQAD 1470
            + +S  + ++E    +D  A+   D  + + +++  A   V S    +L  V  I+E+  
Sbjct: 1592 AQESTDRLRAENAALIDAIASRTNDTLAAISARTEHAANTVSSLENNLLASVNGIIERLA 1651

Query: 1471 FLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTV-----------RLIDH---NLADI 1516
              + T+V  + ++ Q  F  +D  LS    +  D+            RL++     LAD+
Sbjct: 1652 DNNSTIVGMLNNATQ-EFAAVDDRLSATSAQFADSASKAGEMVSASTRLLEGKVDKLADV 1710

Query: 1517 GNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEK 1563
              KT+  +        E S  L+    Q + +      N+ STLEE+
Sbjct: 1711 SGKTLSQVGGIIGRFDEHSKVLT-QASQLLGAAQS---NLVSTLEER 1753



 Score =  282 bits (721), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 307/1449 (21%), Positives = 654/1449 (45%), Gaps = 132/1449 (9%)

Query: 283  SEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVIT 342
            + ++S  L    D   S    R A++T+       E  +T+ +    +   L+  +  +T
Sbjct: 579  ARDVSTVLKTGTDELTSAFAGRSAELTDTLATHSSEFTKTVQTATTDISSALNKGTSELT 638

Query: 343  KDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICE 402
              F  R    +N +NN+   L+ +    T  LG+  + V   + E+S     A + H   
Sbjct: 639  NTFLGR----ANEINNT---LSARTSEITQALGSAHEHVDAVMAERSSALFGALSDHQTR 691

Query: 403  MSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTT---DNTLREVDNRTNTLE 459
                 +++   I   ++   ++L  +L E+     S+L  +    +NTL    +R +T  
Sbjct: 692  FEQSLADRSAGIINAVSGTHENLTSALDERTSKLTSSLAESQVRLENTLA---SRADTFA 748

Query: 460  NRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMED---- 515
            N +     ++ +T ++     +    D  S  E  L    + L    AD+H  + D    
Sbjct: 749  NTVADTHSKLADTLDDKAMALAIALSDGQSRIEDTLNNRAELLTSTLADTHAKIADTLDD 808

Query: 516  ------LFLSNIQT-----------------------IGSNLDKKTLLFEDILSKKQNNI 546
                  + LS+ Q+                       I   LD K +     LS+ Q  +
Sbjct: 809  KAMSLAIALSDGQSRIEDTLNSRTESLTSTLADTHSKIADTLDDKAMALAIALSESQARL 868

Query: 547  SQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVIS 606
                + + E + NTL     +L   L   + R++  +  ++E + ++F+ ++  V++ + 
Sbjct: 869  DDTVAGHAEAVANTLDGKTKALAAALTHGQSRLEETLAHRAEAITNAFSGNHNAVADTLD 928

Query: 607  DREKLFSNSLARVQSHFEETIAGHPQSIVDSISNS----TNNLYDKIMVLAAALSESQKS 662
             +    + SLA  Q+  E +++    ++ ++++ +      +L DK + LA ALS++Q  
Sbjct: 929  QKAVALAASLADTQARLENSLSSRMDALANTVAGTHDKIVGSLDDKTLALAIALSDNQAR 988

Query: 663  LDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTF 722
            ++ +L   A  +   I +    L +  D+ S     S   + ++ E+  +   ++  D+ 
Sbjct: 989  IEETLANSAEAITQSINHGHAALTDTLDDKSMAFAISLAENQSRFESTLEARANALLDSV 1048

Query: 723  NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVET 782
            +     V+G   +    I   ++ N +R++  L   SA+ +    A+S  +  S D +ET
Sbjct: 1049 SGAESRVAGAFGDKADAIRAAYTENQERLDRSL---SAHTD----ALSGLLGSSSDRLET 1101

Query: 783  ISTALKERCQE-LGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENN 841
            +     ER ++ LG+ L +  D+ L+S   A E + +T   R+++    L D  ++ +N 
Sbjct: 1102 VVGGSAERVEKALGAGL-SQMDENLAS---AYERMRSTLDDRSNAISVTLRDAHAQIDNT 1157

Query: 842  LVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASN 901
            L+ Q+  +           T IA S ++ +  SL + + ++  T++  ++ + E++ +  
Sbjct: 1158 LMEQATAIG----------TSIATSASM-LEMSLEDREASLRQTIDASAKTLEERLHSGA 1206

Query: 902  TLVAKTFEECMSNI---LLSYDEN-RQTLDKKLSDHIDV---LRQNLAGSENKI-DGAIG 953
              +A   ++   +I     S+  N  Q++D   S   +    +  +L+  EN+I +G  G
Sbjct: 1207 GDIAGRIQQAAGDIERSAASFSTNLNQSVDGMTSRFAETGSRVEASLSALENRIHEGVGG 1266

Query: 954  SASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASC 1013
             A+Q     +D   +R+   L+     ++S+   +  +    L E+   L + LD++ + 
Sbjct: 1267 VAAQ-----VDAAGNRLSDTLASGAARIDSSGGDAATRLTSALDERLATLAEALDSRTTH 1321

Query: 1014 LSTAVSTQTINLENNLKEQEKSLS-------RVVDTSASSFKYLSDSIQTLAQELVSVIG 1066
            L+ A+ + +  +E  L   +++L+       R ++  A++   L+ +++T   +    + 
Sbjct: 1322 LNQALESGSARIEERLSTMDRALNVGLEAVNRTIEGKATN---LATTLRTAVADAAQGMD 1378

Query: 1067 SMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVM-EISEK-------- 1117
            S +  T D+              + +  + F D++    D  ++VM E SE+        
Sbjct: 1379 SEATRTADL--------------LARTGQQFADDLGNHSDAFTRVMSERSEEIVGRVSET 1424

Query: 1118 --RISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHS 1175
              R++ +   ++Q   +  + I N++ ++ + V  ++  IS       + LE R     +
Sbjct: 1425 HNRLASQAAAVAQTFSEAGNAIVNKVAEAETLVGNQVNAISQALSSAEQSLEARGSAIRN 1484

Query: 1176 ALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQF 1235
             L   S+ I+  +  V+  +   +N  RS +E+R +E+   L+++D+ALE+ G+++    
Sbjct: 1485 TLAGGSEQIASTMAQVERALDERSNAIRSNLEERANEINATLADVDKALEARGTSIRTSL 1544

Query: 1236 KEYVQCFETNMEN----MESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISG--- 1288
             E  +   + +      +  L D+    ++  +         ++SQ + E +D +     
Sbjct: 1545 DERTRELNSMLAGRSTELSRLIDEKARPIVDRYAATGQEAAALISQAAQESTDRLRAENA 1604

Query: 1289 ----AFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDA 1344
                A     N  +  I  +  +AAN +  LE  L++ V  I  R+ D++  +  ++++A
Sbjct: 1605 ALIDAIASRTNDTLAAISARTEHAANTVSSLENNLLASVNGIIERLADNNSTIVGMLNNA 1664

Query: 1345 TDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSK 1404
            T     VD+RL  T+ +  ++      +++ S++L E K+  L ++S  +L Q+  I+ +
Sbjct: 1665 TQEFAAVDDRLSATSAQFADSASKAGEMVSASTRLLEGKVDKLADVSGKTLSQVGGIIGR 1724

Query: 1405 FDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKK 1464
            FD++S++L ++   L  AQS    +L++    L +L+  LV +S E +  + ++   V+ 
Sbjct: 1725 FDEHSKVLTQASQLLGAAQSNLVSTLEERETALQNLSIGLVQRSEEIENTMRALGSMVET 1784

Query: 1465 IVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTI 1524
              ++A+  S+ V  N+   +QSSF  I   LS  E R+ +    +   L   G +  ++I
Sbjct: 1785 AFDRAEQRSNQVTGNLRQGVQSSFADIGRVLSEAEKRAEEAAETMRGTLQKAGEEANQSI 1844

Query: 1525 DSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQ 1584
            +S F   + +S DL+N +R  + ++I ++E + S   + SD + Q   ++L   VD    
Sbjct: 1845 ESTFANAERRSGDLTNRLRGGLSASIADVEQMLSEAGKSSDGAAQQLRETLRVAVDDAVG 1904

Query: 1585 KLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQ 1644
            + S  +D+I  ++  I  +L+ +R  LKR +  L +EAKESA  +R A+ EQI  L+D  
Sbjct: 1905 RFSGATDEIRRSAGDIRRELDLTRSELKRGAFDLPEEAKESAAAMRRAVAEQIKALQDIS 1964

Query: 1645 KLITDSVKN 1653
            +++  S ++
Sbjct: 1965 QIVGRSTQH 1973



 Score =  125 bits (313), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 81/108 (75%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +   R
Sbjct: 2116 SLNSLSVDIARAIDHDASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFR 2175

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI++FE++L+++A+++ D  + Q ++ S+ GKVYTML HA+GR
Sbjct: 2176 TAVDRYIADFEKLLADVARTDRDRTVTQSYLTSDTGKVYTMLAHAAGR 2223


>gi|307302689|ref|ZP_07582445.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
 gi|306903053|gb|EFN33644.1| conserved hypothetical protein [Sinorhizobium meliloti BL225C]
          Length = 2089

 Score =  407 bits (1045), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 411/1837 (22%), Positives = 804/1837 (43%), Gaps = 331/1837 (18%)

Query: 74   FYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNS--PMDSF 131
              PAND        +L+++   S   A+R A + SL+W    LG     Y      + S 
Sbjct: 93   LAPANDDTRKSPAAMLRSLEVRSSRAAIRVAAIISLVWTVGGLGVAHLLYAPGIWQIRSL 152

Query: 132  YDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSE 191
             D A  P  I + L +++ P++LFFSF IMI+RA+++  A++S+A +A+RL +PE  +++
Sbjct: 153  GDLAAMPGAIGILLGIAL-PVMLFFSFAIMIARAQELRSAARSMAEVAMRLAEPETNAAD 211

Query: 192  KMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLK 251
            ++ ++  AVR+E+  M E I+R I+RA+ELE  V SE+  LE +Y+++E+R+  + Q L 
Sbjct: 212  RVMTVGQAVRREVSAMNEGIERTIARATELEALVHSEVSALERSYSENELRVRTLVQELG 271

Query: 252  QEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEK 311
             EREAII H  ++ T+IA  H  LK++L   SE+I+  ++ + ++F S++D R A +T+K
Sbjct: 272  LEREAIIGHSDRIRTAIAGAHTKLKDDLETASEDIASRIAVSGEAFASLIDTRAAALTDK 331

Query: 312  TTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYT 371
            +   ++  +  ++++ D LL  L +  + ++ +FD R+++LS+ L   G  L +Q     
Sbjct: 332  SDHALENLSTMLTTRTDALLSGLTTAGVALSNEFDARLDALSDNLTQRGEQLLSQFETRA 391

Query: 372  LMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQE 431
              L  NT+K++ AL E+++Q  +   +   +++      Q++I+  L+DVL SL  +L E
Sbjct: 392  STLDANTEKLNAALNERARQLNETLIARTRDLNESLRIGQQAISGGLDDVLSSLNSALDE 451

Query: 432  KEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEF 491
            K  SF  +LKS+ D+ + ++D R    E ++   + ++   F+    +F+S +    S+ 
Sbjct: 452  KGASFRQSLKSSADDAIMDLDLRGGFFEEKLQTTVGQLASAFDERFHEFASAFDKRASQL 511

Query: 492  ESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQ-IT 550
            ++ L  ++ ++    +     +     S++  I S L +++L     L   Q+ I + I 
Sbjct: 512  DTKLMESLHRINETVSGGSEAIGGALDSSVDKINSALSEQSLTLATALGATQDFIEETIG 571

Query: 551  SMNTE----------RLENTLTNSINSLKDMLEEKRQRIDSDIGKKSE------------ 588
            S  +E          R+E+ L++   SL   L E ++RI++  G++++            
Sbjct: 572  SRTSELSSLIGNAHNRIESVLSDKTGSLMGALTEAQERIENGFGQRADALANALTTSERS 631

Query: 589  --------------------------------ELCSSFNSSYQKVSNVISDREKLFSNSL 616
                                            E+ S+  +S  ++ N +S+R    S +L
Sbjct: 632  LTDGLDSRTSAFIEGLQSAHARIEQTLTGSTDEITSAIAASQHRLDNTLSERTAALSTAL 691

Query: 617  ARVQSHFEETIAG-----------HPQSIVDSISNSTNNLYDKIMVLAAA-----LSESQ 660
                S  E  + G             Q+I D++S  T  L D ++   A      +S   
Sbjct: 692  TSGASVIESAVGGTADRLERVLSERGQTITDALSTQTAAL-DGVLAERATQINSTMSARA 750

Query: 661  KSLDNSLKAHATDVVHKIT---------------NAENQLVNRFDESSKN-------IIC 698
              + +SL  HA DV   +T                 EN+L     E ++N       I  
Sbjct: 751  SEMADSLSRHAEDVADSLTFRAMAVAETMTDRVGEIENKLSQSVSEVAENLGGRVSLIAD 810

Query: 699  SYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSG 758
            +   ++ ++       +   ++T    S  ++  L   T       +  A  +E+ L   
Sbjct: 811  TLTDTSARIAEDLSSRVGKISETLAGTSAEIAEALTARTSEATASLAGKAAEIEQTLTGR 870

Query: 759  SANIESELSAISKAMNKSIDD-VETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLC 817
            ++++   L+     +  ++DD +  I+ A+ +  ++L   L + S  + ++L  +  +L 
Sbjct: 871  ASHLRDTLTTTHDQIRSTLDDRITAINLAVGQGREQLEELLSDQSMAMATTLATSASMLE 930

Query: 818  TTFAQRNDSFVNA------------------LADNQSKFENNLVNQSHLLLDKLSSDIQK 859
             +  +R  S   A                  LAD  ++ +  L  ++  L D L++  ++
Sbjct: 931  MSLEERQASIAGAIERSTEALAARTSEATASLADKATEIDRTLFGKAAQLRDTLATTHEQ 990

Query: 860  L--------------------------TDIAYSKAIDVANS-------LTEIQGNVGVTL 886
            L                          +D + + A  +A S       L E Q ++   +
Sbjct: 991  LRTTLDDRINTINLSVGQGRERLEELLSDQSIAMATTLATSASMLEMSLEERQASIAGAI 1050

Query: 887  ENHSQAMLEKISASNTLVAKTFEECMSNILLSYDE--NR---------QTLDK---KLSD 932
            +  ++A+  ++ ++   +A+   E    I L+ D   NR           LD+   ++  
Sbjct: 1051 DRSAEALDSRMRSTTGEIAERLAETADQISLAADTLTNRVDISISGVNSRLDETGARIET 1110

Query: 933  HIDVLRQNLAGSENKIDG-----------AIGSASQFIRD-------ILDENSSRIESLL 974
             +  L + + GS   +D            ++GS  + IR        IL +  +RIE+ L
Sbjct: 1111 SLGSLEERIRGSVGDVDAILGETGSRIETSLGSLEERIRGSVGDVDAILGDTGARIETSL 1170

Query: 975  SC-------SNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLEN 1027
                     S  SVN+ +  + Q+    L E++ E+ ++ +  A+ +STA+ T T  +E 
Sbjct: 1171 GSLEERIRDSVGSVNAIVDNAGQRIADSLGERAGEIDRISEAAATRISTAIETGTGRIEE 1230

Query: 1028 NLKEQEKSLS-------RVVDTSASSF-----KYLSDSIQTLAQELVSVIGSMSQSTTDI 1075
             L   +++L+       R ++  A++        +SD+ Q +  E     G +S++  D 
Sbjct: 1231 RLGTMDRALNIGLENVNRTIEGKAAALVTSLRGAVSDATQEIDAEAARSAGLLSKAGADF 1290

Query: 1076 SGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNND 1135
            +G L                       A   E +  +E +    + R  ++++ + +  D
Sbjct: 1291 AGAL----------------------AASNAEFASSIEQTASATAARHADLARSVAEAAD 1328

Query: 1136 VITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTI 1195
              T ++  + S++      I     E  + L+ R +   S LD                 
Sbjct: 1329 TATARLASTNSQIATHAKSIQQSLTEAEKALDARGQSIRSTLDE---------------- 1372

Query: 1196 SSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDK 1255
               T E  S++  R  E       L R L+     V +Q   Y    +   E + SL  +
Sbjct: 1373 --STRELNSMLAGRSME-------LSRLLDEQARPVIEQ---YAATGKEAAERIASLTQE 1420

Query: 1256 NNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKL 1315
            + D +    +  +  L N +++R+ E  D+IS     E               A A+K +
Sbjct: 1421 SADRL----RAENAALINAITERTGETLDAIS--LRAE-------------ETAKAMKMV 1461

Query: 1316 EALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAE 1375
            E  L S    + +++  S+  + T+I  A+ +L  +D+RL  T  +++ET      +L+ 
Sbjct: 1462 ENRLQSTAMGLIDQLASSNSAIATVIDQASGNLGDMDQRLEATAAKVSETARQASDMLST 1521

Query: 1376 SSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDAN 1435
            S++L E K+  L +IS  +L Q+  IV +F+ +S++L ++ D L  AQS    +L++  +
Sbjct: 1522 STRLIEGKVDKLSDISSSTLSQIGGIVGRFEDHSKVLGQASDLLAAAQSNLVSTLEERQD 1581

Query: 1436 NLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTL 1495
             L  L+  LV +S E ++ + ++   V    ++A+  S  V  N+   IQSSF  +   L
Sbjct: 1582 ALRTLSVGLVQRSEEIERTMRALEGFVDGAFQRAEERSGQVAGNLRSGIQSSFSDVGRLL 1641

Query: 1496 SNIETRS-------RDTV---------------------------RL---IDHNLAD--- 1515
            SN E R+       RDT+                           RL   ++ + AD   
Sbjct: 1642 SNTEQRATEAAEALRDTLVKASDEAAASVEGVFSQAEERSRQIADRLRSGVETSFADANK 1701

Query: 1516 ----------------------IGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNI 1553
                                   G +  + ++  F +++E++ D ++ +R  I +++ ++
Sbjct: 1702 TLSQVEGRALSASEALRQVMAKTGEEAGQALEGAFASVEERAKDAASRLRGTIGASVSDV 1761

Query: 1554 ENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKR 1613
            E + +   +KSD       +++   ++    + +  +DDI  ++  I ++L+ +R+ LKR
Sbjct: 1762 ERMLAESGKKSDGVAAQLREAVRQAIEDAIGRFNGATDDIRRSAGEIRKELDMTREELKR 1821

Query: 1614 DSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS 1650
             +  L +EAKE+A  +R A+ EQI  L++  ++I  S
Sbjct: 1822 GAFDLPEEAKENAALMRRAVGEQIKALQELSEIIGKS 1858



 Score =  126 bits (316), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 82/108 (75%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V+LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +   R
Sbjct: 1980 SLNSLSVDIARAIDHDASVELWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFR 2039

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI++FE++L+++A+++ D  + Q ++ S+ GKVYTML HA+GR
Sbjct: 2040 TAVDRYIADFEKLLADVARNDPDKRITQTYLTSDTGKVYTMLAHAAGR 2087


>gi|15965569|ref|NP_385922.1| hypothetical protein SMc00190 [Sinorhizobium meliloti 1021]
 gi|15074750|emb|CAC46395.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
          Length = 2089

 Score =  404 bits (1039), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 417/1840 (22%), Positives = 804/1840 (43%), Gaps = 337/1840 (18%)

Query: 74   FYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNS--PMDSF 131
              PAND        +L+++   S   A+R A + SL+W    LG     Y      + S 
Sbjct: 93   LAPANDDTRKSPAAMLRSLEVRSSRAAIRVAAIISLVWTVAGLGVAHLLYAPGIWQIRSL 152

Query: 132  YDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSE 191
             D A  P  I + L +++ P++LFFSF IMI+RA+++  A++S+A +A+RL +PE  +++
Sbjct: 153  GDLAAMPGAIGILLGIAL-PVMLFFSFAIMIARAQELRSAARSMAEVAMRLAEPETNAAD 211

Query: 192  KMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLK 251
            ++ ++  AVR+E+  M E I+R I+RA+ELE  V SE+  LE +Y+++E+R+  + Q L 
Sbjct: 212  RVMTVGQAVRREVSAMNEGIERTIARATELEALVHSEVSALERSYSENELRVRTLVQELG 271

Query: 252  QEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEK 311
             EREAII H  ++ T+IA  H  LK++L   SE+I+  ++ + ++F S++D R A +T+K
Sbjct: 272  LEREAIIGHSDRIRTAIAGAHTKLKDDLETASEDIASRIAVSGEAFASLIDTRAAALTDK 331

Query: 312  TTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYT 371
            +   ++  +  ++++ D LL  L +  + ++ +FD R+++LS+ L   G  L +Q     
Sbjct: 332  SDHALENLSTMLTTRTDALLSGLTTAGVALSNEFDARLDALSDNLTQRGEQLLSQFETRA 391

Query: 372  LMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQE 431
              L  NT+K++ AL E+++Q  +   +   +++      Q++I+  L+DVL SL  +L E
Sbjct: 392  STLDANTEKLNAALNERARQLNETLIARTRDLNESLRIGQQAISGGLDDVLSSLNSALDE 451

Query: 432  KEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEF 491
            K  SF  +LKS+ D+ + ++D R    E ++   + ++   F+    +F+S +    S+ 
Sbjct: 452  KGASFRQSLKSSADDAIMDLDLRGGFFEEKLQTTVGQLASAFDERFHEFASAFDKRASQL 511

Query: 492  ESNLQ-----------GNIDKLQGCF------------------ADSHGNMEDLFLSNIQ 522
            ++ L            G  + + G                    A + G  +D F+   +
Sbjct: 512  DTKLMESLHRINETVSGGSEAIGGALDSSVDKINSALSEQSLTLATALGATQD-FIE--E 568

Query: 523  TIGSNLDKKTLLF-------EDILSKKQNNISQITSMNTERLEN-----------TLTNS 564
            TIGS   + + L        E +LS K  ++    +   ER+EN            LT S
Sbjct: 569  TIGSRTSELSSLIGNAHNRIESVLSDKTGSLMGALTEAQERIENGFGQRADALANALTTS 628

Query: 565  INSLKDMLEEK-----------RQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFS 613
              SL D L+ +             RI+  +   ++E+ S+  +S  ++ N +S+R    S
Sbjct: 629  ERSLTDGLDSRTSAFIEGLQSAHARIEQTLTGSTDEITSAIAASQHRLDNTLSERTAALS 688

Query: 614  NSLARVQSHFEETIAG-----------HPQSIVDSISNSTNNLYDKIMVLAAA-----LS 657
             +L    S  E  + G             Q+I D++S  T  L D ++   A      +S
Sbjct: 689  TALTSGASVIESAVGGTADRLERVLSERGQTITDALSTQTAAL-DGVLAERATQINSTMS 747

Query: 658  ESQKSLDNSLKAHATDVVH---------------KITNAENQLVNRFDESSKN------- 695
                 + +SL  HA DV                 ++   EN+L     E ++N       
Sbjct: 748  ARASEMADSLSRHAEDVADSLTFRAMAVAETMTDRVGEIENKLSQSVSEVAENLGGRVSL 807

Query: 696  IICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELL 755
            I  +   ++ ++       +   ++T    S  ++  L   T       +  A  +E+ L
Sbjct: 808  IADTLTDTSARIAEDLSSRVGKISETLAGTSAEIAEALTARTSEATASLAGKAAEIEQTL 867

Query: 756  HSGSANIESELSAISKAMNKSIDD-VETISTALKERCQELGSDLVNHSDKVLSSLKQAQE 814
               ++++   L+     +  ++DD +  I+ A+ +  ++L   L + S  + ++L  +  
Sbjct: 868  TGRASHLRDTLTTTHDQIRSTLDDRITAINLAVGQGREQLEELLSDQSMAMATTLATSAS 927

Query: 815  LLCTTFAQRNDSFVNA------------------LADNQSKFENNLVNQSHLLLDKLSSD 856
            +L  +  +R  S   A                  LAD  ++ +  L  ++  L D L++ 
Sbjct: 928  MLEMSLEERQASIAGAIERSTEALAARTSEATASLADKATEIDRTLSGKAAQLRDTLATT 987

Query: 857  IQKL--------------------------TDIAYSKAIDVANS-------LTEIQGNVG 883
             ++L                          +D + + A  +A S       L E Q ++ 
Sbjct: 988  HEQLRTTLDDRINTINLSVGQGRERLEELLSDQSIAMATTLATSASMLEMSLEERQASIA 1047

Query: 884  VTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDE--NR---------QTLDK---K 929
              ++  ++A+  ++ ++   +A+   E    I L+ D   NR           LD+   +
Sbjct: 1048 GAIDRSAEALDSRMRSTTGEIAERLAETADQISLAADTLTNRVDISISGVNSRLDETGAR 1107

Query: 930  LSDHIDVLRQNLAGSENKIDG-----------AIGSASQFIRD-------ILDENSSRIE 971
            +   +  L + + GS   +D            ++GS  + IR        IL +  +RIE
Sbjct: 1108 IETSLGSLEERIRGSVGDVDAILGETGSRIETSLGSLEERIRGSVGDVDAILGDTGARIE 1167

Query: 972  SLLSC-------SNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTIN 1024
            + L         S  SVN+ +  + Q+    L E++ E+ ++ +  A+ +STA+ T T  
Sbjct: 1168 TSLGSLEERIRDSVGSVNAIVDNAGQRIADSLGERAGEIDRISEAAATRISTAIETGTGR 1227

Query: 1025 LENNLKEQEKSLS-------RVVDTSASSF-----KYLSDSIQTLAQELVSVIGSMSQST 1072
            +E  L   +++L+       R ++  A++        +SD+ Q +  E     G +S++ 
Sbjct: 1228 IEERLGTMDRALNIGLENVNRTIEGKAAALVTSLRGAVSDATQEIDAEAARSAGLLSKAG 1287

Query: 1073 TDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQ 1132
             D +G L                       A   E +  +E +    + R  ++++ + +
Sbjct: 1288 ADFAGAL----------------------AASNAEFASSIEQTASATAARHADLARSVAE 1325

Query: 1133 NNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVD 1192
              D  T ++  + S++      I     E  + L+ R +   S LD              
Sbjct: 1326 AADTATARLASTNSQIATHAKSIQQSLTEAEKALDARGQSIRSTLDE------------- 1372

Query: 1193 HTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESL 1252
                  T E  S++  R  E       L R L+     V +Q   Y    +   E + SL
Sbjct: 1373 -----STRELNSMLAGRSME-------LSRLLDEQARPVIEQ---YAATGKEAAERIASL 1417

Query: 1253 FDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANAL 1312
              ++ D +    +  +  L N +++R+ E  D+IS     E               A A+
Sbjct: 1418 TQESADRL----RAENAALINAITERTGETLDAIS--LRAE-------------ETAKAM 1458

Query: 1313 KKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTV 1372
            K +E  L S    + +++  S+  + T+I  A+ +L  +D+RL  T  +++ET      +
Sbjct: 1459 KMVENRLQSTAMGLIDQLASSNSAIATVIDQASGNLGDMDQRLEATAAKVSETARQASDM 1518

Query: 1373 LAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDK 1432
            L+ S++L E K+  L +IS  +L Q+  IV +F+ +S++L ++ D L  AQS    +L++
Sbjct: 1519 LSTSTRLIEGKVDKLSDISSSTLSQIGGIVGRFEDHSKVLGQASDLLAAAQSNLVSTLEE 1578

Query: 1433 DANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKID 1492
              + L  L+  LV +S E ++ + ++   V    ++A+  S  V  N+   IQSSF  + 
Sbjct: 1579 RQDALRTLSVGLVQRSEEIERTMRALEGFVDGAFQRAEERSGQVAGNLRSGIQSSFSDVG 1638

Query: 1493 GTLSNIETRS-------RDTV---------------------------RL---IDHNLAD 1515
              LSN E R+       RDT+                           RL   ++ + AD
Sbjct: 1639 RLLSNTEQRATEAAEALRDTLVKASDEAAASVEGVFSQAEERSRQIADRLRSGVETSFAD 1698

Query: 1516 -------------------------IGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTI 1550
                                      G +  + ++  F +++E++ D ++ +R  I +++
Sbjct: 1699 ANKTLSQVEGRALSASEALRQVMAKTGEEAGQALEGAFASVEERAKDAASRLRGTIGASV 1758

Query: 1551 PNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDI 1610
             ++E + +   +KSD       +++   ++    + +  +DDI  ++  I ++L+ +R+ 
Sbjct: 1759 SDVERMLAESGKKSDGVAAQLREAVRQAIEDAIGRFNGATDDIRRSAGEIRKELDMTREE 1818

Query: 1611 LKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS 1650
            LKR +  L +EAKE+A  +R A+ EQI  L++  ++I  S
Sbjct: 1819 LKRGAFDLPEEAKENAALMRRAVGEQIKALQELSEIIGKS 1858



 Score =  126 bits (316), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 82/108 (75%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V+LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +   R
Sbjct: 1980 SLNSLSVDIARAIDHDASVELWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFR 2039

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI++FE++L+++A+++ D  + Q ++ S+ GKVYTML HA+GR
Sbjct: 2040 TAVDRYIADFEKLLADVARNDPDKRITQTYLTSDTGKVYTMLAHAAGR 2087


>gi|307318537|ref|ZP_07597971.1| chemotaxis sensory transducer [Sinorhizobium meliloti AK83]
 gi|306895877|gb|EFN26629.1| chemotaxis sensory transducer [Sinorhizobium meliloti AK83]
          Length = 2089

 Score =  402 bits (1034), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 416/1840 (22%), Positives = 803/1840 (43%), Gaps = 337/1840 (18%)

Query: 74   FYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNS--PMDSF 131
              PAND        +L+++   S   A+R A + SL+W    LG     Y      + S 
Sbjct: 93   LAPANDDTRKSPAAMLRSLEVRSSRAAIRVAAIISLVWTVAGLGVAHLLYAPGIWQIRSL 152

Query: 132  YDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSE 191
             D A  P  I + L +++ P++LFFSF IMI+RA+++  A++S+A +A+RL +PE  +++
Sbjct: 153  GDLAAMPGAIGILLGIAL-PVMLFFSFAIMIARAQELRSAARSMAEVAMRLAEPETNAAD 211

Query: 192  KMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLK 251
            ++ ++  AVR+E+  M E I+R I+RA+ELE  V SE+  LE +Y+++E+R+  + Q L 
Sbjct: 212  RVMTVGQAVRREVSAMNEGIERTIARATELEALVHSEVSALERSYSENELRVRTLVQELG 271

Query: 252  QEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEK 311
             EREAII H  ++ T+IA  H  LK++L   SE+I+  ++ + ++F S++D R A +T+K
Sbjct: 272  LEREAIIGHSDRIRTAIAGAHTKLKDDLETASEDIASRIAVSGEAFASLIDTRAAALTDK 331

Query: 312  TTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYT 371
            +   ++  +  ++++ D LL  L +  + ++ +FD R+++LS+ L   G  L +Q     
Sbjct: 332  SDHALENLSTMLTTRTDALLSGLTTAGVALSNEFDARLDALSDNLTQRGEQLLSQFETRA 391

Query: 372  LMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQE 431
              L  NT+K++ AL E+++Q  +   +   +++      Q++I+  L+DVL SL  +L E
Sbjct: 392  STLDANTEKLNAALNERARQLNETLIARTRDLNESLRIGQQAISGGLDDVLSSLNSALDE 451

Query: 432  KEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEF 491
               SF  +LKS+ D+ + ++D R    E ++   + ++   F+    +F+S +    S+ 
Sbjct: 452  MGASFRQSLKSSADDAIMDLDLRGGFFEEKLQTTVGQLASAFDERFHEFASAFDKRASQL 511

Query: 492  ESNLQ-----------GNIDKLQGCF------------------ADSHGNMEDLFLSNIQ 522
            ++ L            G  + + G                    A + G  +D F+   +
Sbjct: 512  DTKLMESLHRINETVSGGSEAIGGALDSSVDKINSALSEQSLTLATALGATQD-FIE--E 568

Query: 523  TIGSNLDKKTLLF-------EDILSKKQNNISQITSMNTERLEN-----------TLTNS 564
            TIGS   + + L        E +LS K  ++    +   ER+EN            LT S
Sbjct: 569  TIGSRTSELSSLIGNAHNRIESVLSDKTGSLMGALTEAQERIENGFGQRADALANALTTS 628

Query: 565  INSLKDMLEEK-----------RQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFS 613
              SL D L+ +             RI+  +   ++E+ S+  +S  ++ N +S+R    S
Sbjct: 629  ERSLTDGLDSRTSAFIEGLQSAHARIEQTLTGSTDEITSAIAASQHRLDNTLSERTAALS 688

Query: 614  NSLARVQSHFEETIAG-----------HPQSIVDSISNSTNNLYDKIMVLAAA-----LS 657
             +L    S  E  + G             Q+I D++S  T  L D ++   A      +S
Sbjct: 689  TALTSGASVIESAVGGTADRLERVLSERGQTITDALSTQTAAL-DGVLAERATQINSTMS 747

Query: 658  ESQKSLDNSLKAHATDVVH---------------KITNAENQLVNRFDESSKN------- 695
                 + +SL  HA DV                 ++   EN+L     E ++N       
Sbjct: 748  ARASEMADSLSRHAEDVADSLTFRAMAVAETMTDRVGEIENKLSQSVSEVAENLGGRVSL 807

Query: 696  IICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELL 755
            I  +   ++ ++       +   ++T    S  ++  L   T       +  A  +E+ L
Sbjct: 808  IADTLTDTSARIAEDLSSRVGKISETLAGTSAEIAEALTARTSEATASLAGKAAEIEQTL 867

Query: 756  HSGSANIESELSAISKAMNKSIDD-VETISTALKERCQELGSDLVNHSDKVLSSLKQAQE 814
               ++++   L+     +  ++DD +  I+ A+ +  ++L   L + S  + ++L  +  
Sbjct: 868  TGRASHLRDTLTTTHDQIRSTLDDRITAINLAVGQGREQLEELLSDQSMAMATTLATSAS 927

Query: 815  LLCTTFAQRNDSFVNA------------------LADNQSKFENNLVNQSHLLLDKLSSD 856
            +L  +  +R  S   A                  LAD  ++ +  L  ++  L D L++ 
Sbjct: 928  MLEMSLEERQASIAGAIERSTEALAARTSEATASLADKATEIDRTLSGKAAQLRDTLATT 987

Query: 857  IQKL--------------------------TDIAYSKAIDVANS-------LTEIQGNVG 883
             ++L                          +D + + A  +A S       L E Q ++ 
Sbjct: 988  HEQLRTTLDDRINTINLSVGQGRERLEELLSDQSIAMATTLATSASMLEMSLEERQASIA 1047

Query: 884  VTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDE--NR---------QTLDK---K 929
              ++  ++A+  ++ ++   +A+   E    I L+ D   NR           LD+   +
Sbjct: 1048 GAIDRSAEALDSRMRSTTGEIAERLAETADQISLAADTLTNRVDISISGVNSRLDETGAR 1107

Query: 930  LSDHIDVLRQNLAGSENKIDG-----------AIGSASQFIRD-------ILDENSSRIE 971
            +   +  L + + GS   +D            ++GS  + IR        IL +  +RIE
Sbjct: 1108 IETSLGSLEERIRGSVGDVDAILGETGSRIETSLGSLEERIRGSVGDVDAILGDTGARIE 1167

Query: 972  SLLSC-------SNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTIN 1024
            + L         S  SVN+ +  + Q+    L E++ E+ ++ +  A+ +STA+ T T  
Sbjct: 1168 TSLGSLEERIRDSVGSVNAIVDNAGQRIADSLGERAGEIDRISEAAATRISTAIETGTGR 1227

Query: 1025 LENNLKEQEKSLS-------RVVDTSASSF-----KYLSDSIQTLAQELVSVIGSMSQST 1072
            +E  L   +++L+       R ++  A++        +SD+ Q +  E     G +S++ 
Sbjct: 1228 IEERLGTMDRALNIGLENVNRTIEGKAAALVTSLRGAVSDATQEIDAEAARSAGLLSKAG 1287

Query: 1073 TDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQ 1132
             D +G L                       A   E +  +E +    + R  ++++ + +
Sbjct: 1288 ADFAGAL----------------------AASNAEFASSIEQTASATAARHADLARSVAE 1325

Query: 1133 NNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVD 1192
              D  T ++  + S++      I     E  + L+ R +   S LD              
Sbjct: 1326 AADTATARLASTNSQIATHAKSIQQSLTEAEKALDARGQSIRSTLDE------------- 1372

Query: 1193 HTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESL 1252
                  T E  S++  R  E       L R L+     V +Q   Y    +   E + SL
Sbjct: 1373 -----STRELNSMLAGRSME-------LSRLLDEQARPVIEQ---YAATGKEAAERIASL 1417

Query: 1253 FDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANAL 1312
              ++ D +    +  +  L N +++R+ E  D+IS     E               A A+
Sbjct: 1418 TQESADRL----RAENAALINAITERTGETLDAIS--LRAE-------------ETAKAM 1458

Query: 1313 KKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTV 1372
            K +E  L S    + +++  S+  + T+I  A+ +L  +D+RL  T  +++ET      +
Sbjct: 1459 KMVENRLQSTAMGLIDQLASSNSAIATVIDQASGNLGDMDQRLEATAAKVSETARQASDM 1518

Query: 1373 LAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDK 1432
            L+ S++L E K+  L +IS  +L Q+  IV +F+ +S++L ++ D L  AQS    +L++
Sbjct: 1519 LSTSTRLIEGKVDKLSDISSSTLSQIGGIVGRFEDHSKVLGQASDLLAAAQSNLVSTLEE 1578

Query: 1433 DANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKID 1492
              + L  L+  LV +S E ++ + ++   V    ++A+  S  V  N+   IQSSF  + 
Sbjct: 1579 RQDALRTLSVGLVQRSEEIERTMRALEGFVDGAFQRAEERSGQVAGNLRSGIQSSFSDVG 1638

Query: 1493 GTLSNIETRS-------RDTV---------------------------RL---IDHNLAD 1515
              LSN E R+       RDT+                           RL   ++ + AD
Sbjct: 1639 RLLSNTEQRATEAAEALRDTLVKASDEAAASVEGVFSQAEERSRQIADRLRSGVETSFAD 1698

Query: 1516 -------------------------IGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTI 1550
                                      G +  + ++  F +++E++ D ++ +R  I +++
Sbjct: 1699 ANKTLSQVEGRALSASEALRQVMAKTGEEAGQALEGAFASVEERAKDAASRLRGTIGASV 1758

Query: 1551 PNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDI 1610
             ++E + +   +KSD       +++   ++    + +  +DDI  ++  I ++L+ +R+ 
Sbjct: 1759 SDVERMLAESGKKSDGVAAQLREAVRQAIEDAIGRFNGATDDIRRSAGEIRKELDMTREE 1818

Query: 1611 LKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS 1650
            LKR +  L +EAKE+A  +R A+ EQI  L++  ++I  S
Sbjct: 1819 LKRGAFDLPEEAKENAALMRRAVGEQIKALQELSEIIGKS 1858



 Score =  126 bits (316), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 82/108 (75%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V+LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +   R
Sbjct: 1980 SLNSLSVDIARAIDHDASVELWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFR 2039

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI++FE++L+++A+++ D  + Q ++ S+ GKVYTML HA+GR
Sbjct: 2040 TAVDRYIADFEKLLADVARNDPDKRITQTYLTSDTGKVYTMLAHAAGR 2087


>gi|86357955|ref|YP_469847.1| hypothetical protein RHE_CH02340 [Rhizobium etli CFN 42]
 gi|86282057|gb|ABC91120.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 2324

 Score =  391 bits (1004), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 333/1428 (23%), Positives = 651/1428 (45%), Gaps = 152/1428 (10%)

Query: 5    KENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSKNFKQ 64
            K+N  + R    +  E + SD    + +    +  + SRR    E   R           
Sbjct: 28   KDNVPSRRGDAPQAPEGNVSDPSNARNQQGQEEAQRRSRRGAGAEQASR----------- 76

Query: 65   ASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYT 124
                   S F PAND        IL++    S   A+R A + S++W+   LG +   Y 
Sbjct: 77   ------ASAFAPANDASRNTPASILKSFDGASSRSAMRTATLFSVLWVMAGLGLMSLLY- 129

Query: 125  NSP----MDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIAL 180
             +P    + S  D    P VI   LV  ++P+++F++F IMISRA+DM +A++S+A +AL
Sbjct: 130  -APQIWQIRSIADLVALPGVIA-GLVGIIIPVMMFYAFAIMISRAQDMRNAARSMAEVAL 187

Query: 181  RLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSE 240
            RL +PE  +SE++ ++  AVR+E+  M E I+R I+RASELE  V SE+  LE +Y  +E
Sbjct: 188  RLAEPETIASERIMTVGQAVRREVSAMNEGIERTIARASELETLVHSEVNALERSYADNE 247

Query: 241  MRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSI 300
            +R+  +   L  EREAI+NH  ++ TSI  VH+ LKEELSL +EEI+V L+ + ++F S+
Sbjct: 248  LRVRGLVHELGSEREAIVNHADRIRTSIGSVHDQLKEELSLATEEIAVRLATSGEAFASL 307

Query: 301  VDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSG 360
            +D R A + EK+   +Q     +++K D LL+ L+++   +  +FDNR+E+LS  LN  G
Sbjct: 308  IDTRAATILEKSDSALQSMGSLLAAKTDSLLQTLNASGFALATEFDNRLEALSVNLNEHG 367

Query: 361  RSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLND 420
              L +Q       + ++T+K++ AL E++ Q  +   +   E++   +  +++I+ TL+D
Sbjct: 368  ERLLSQFETRASTMDSSTEKLNAALNERTHQLNEILIARTREINESLTSGERTISGTLDD 427

Query: 421  VLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDF 480
            VL  L  +L EK  +F  +L++T D+ + ++D R+   E R+   + ++   F+  + +F
Sbjct: 428  VLSKLNSALDEKGATFRQSLQNTADDAVMDLDLRSGFFEERLQTTVAQLSTAFDERVAEF 487

Query: 481  SSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILS 540
            +S +       ++ L  ++ ++    +    ++E +  S+I  +GS++  ++L     L+
Sbjct: 488  TSAFDKRTGSLDTKLMESLARINETLSGGSDSIEGILSSSIDRLGSSMTDQSLALATALA 547

Query: 541  KKQNNISQITSMNTERLENTLTNSINSLKDMLE--------------------------- 573
                 +    + +TE +   LT+    L   L+                           
Sbjct: 548  TGHEVLESTLNSHTEEITTALTSRTGELTSALQSATSDIALALASGTSDLHNNLQARSAE 607

Query: 574  -----------------EKRQRIDSDIGKKSEELCS-----------SFNSSYQKVSNVI 605
                                +++ +  G ++EEL S           +  ++++++ +V+
Sbjct: 608  FRDTLRTTTTDLTAAVAAGTEQVTTAFGGRAEELTSVLTARAAEIRDAVGTAHERIDSVM 667

Query: 606  SDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNS----TNNLYDKIMVLAAALSESQK 661
            ++R     ++L      FEE +     +I++++S +    +  L +K M LA +L+ESQ 
Sbjct: 668  AERGGALIDALTTHHGRFEEALTTRSDAIINAVSGTHDRLSETLDEKAMALAISLNESQS 727

Query: 662  SLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDT 721
             ++++L+  +   ++ ++    +L    D  +  +  S +  + ++E        +  ++
Sbjct: 728  RIEDTLETRSAAFLNAVSGTHERLSETLDTKAAALTTSLDERHARIEDALGTRAEALLNS 787

Query: 722  FNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDD-V 780
             +  SD ++  L      +    + +  R+EE L +GSA + + +S       +++ D  
Sbjct: 788  VSGTSDRLAETLDEKVMALAISLNESQARIEETLENGSAGLLNAVSGTHDRFAETLQDKA 847

Query: 781  ETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFEN 840
               + +L E    +   L   S  +L+++    + L  T  ++  +   +L + Q++ E+
Sbjct: 848  AAFANSLNETQARIEDTLETRSAALLNAVSGTHDRLSETLDEKAMALAISLTEGQARIED 907

Query: 841  NLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISAS 900
             L  +S  LL+ +S    +L++    KA+ +A SL E Q  +  TLE  S+A L+ +S +
Sbjct: 908  TLQTRSAALLNAVSGTHDRLSETLDEKAMALAISLNENQTRIEDTLEARSEAFLKAVSGA 967

Query: 901  NTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIR 960
            +  +A+T +E  S +  S +E +  L   L    +     ++ + +++   +   +  + 
Sbjct: 968  HERIAETLDEKASALTASLNEGQSRLQDTLESRSESFLNAVSATHDRLSETLDDRAMALA 1027

Query: 961  DILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST 1020
              L+E+ SR+E  L+   +++ + +  +H++ +            +LD KAS L+ +++ 
Sbjct: 1028 ISLNESQSRLEETLTSGADAITNAVSGTHERLN-----------GVLDQKASALAASLNE 1076

Query: 1021 QTINLENNLKEQEKSLSRVVDTSASSFKYLSDSI--QTLAQELVSVIGSMSQSTTDISGK 1078
              + LE  L  +  +L   V    +S   L+D++  +T+A                    
Sbjct: 1077 GQVRLEEALGHRAAAL---VGAVTASHDRLTDTLDEKTMA-------------------- 1113

Query: 1079 LEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVIT 1138
            L ISLD  NQ        F   + A  + I + +  +E R       ++       D I 
Sbjct: 1114 LAISLDD-NQS------RFDSALEARSNAIMEAVTSAEAR-------VAGAFADKTDAIH 1159

Query: 1139 NQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSH 1198
            N   D+  R+   + + S      S VL+    +F   +   +  I   L D    + S 
Sbjct: 1160 NAYADNQRRLESALSEHSAAL---SGVLDAGGARFEDLVGGLTGRIEGRLSDAHARLGSM 1216

Query: 1199 TNESRSLIEQRI---HE-VKDVLSNLDRALESYGSTVFKQ----FKEYVQCFETNMENME 1250
              E+ + IE  +   HE ++  L +   A+E   S    Q      E      T++    
Sbjct: 1217 AEEAAARIEGGLASAHERIRTTLEDRGNAIELSLSQAHAQISDTLTEQATSIGTSVATSV 1276

Query: 1251 SLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNV-------IDQ 1303
            S+ + + +    S ++  +     L  R    +  I+G F +  N + +        +DQ
Sbjct: 1277 SMLEMSLEDREASIRQAIDAGAQTLEDRMRAGAGQIAGRFQEAANTISSSAQNLSAHLDQ 1336

Query: 1304 QIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKV 1351
             + N A  L++  + + + +  I  RI D    V   +  AT  L+ V
Sbjct: 1337 SVENLAGRLEETGSRMEAGLTAIETRIRDGVGGVAEKVEAATSQLSGV 1384



 Score =  321 bits (822), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 368/1758 (20%), Positives = 743/1758 (42%), Gaps = 229/1758 (13%)

Query: 216  SRASELEKTVRSEIEVLENNYT-KSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHES 274
            +RA+E+   V +  E +++    +    ID +T +  +  EA+      +  +++  H+ 
Sbjct: 647  ARAAEIRDAVGTAHERIDSVMAERGGALIDALTTHHGRFEEALTTRSDAIINAVSGTHDR 706

Query: 275  LKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVL 334
            L E L   +  +++ L+ +    +  ++ R A                +S   ++L E L
Sbjct: 707  LSETLDEKAMALAISLNESQSRIEDTLETRSAAFL-----------NAVSGTHERLSETL 755

Query: 335  HSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDK----VSIALKEQSQ 390
             + +  +T   D R   + + L     +L N V   +  L    D+    ++I+L E   
Sbjct: 756  DTKAAALTTSLDERHARIEDALGTRAEALLNSVSGTSDRLAETLDEKVMALAISLNESQA 815

Query: 391  QFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLRE 450
            +  +   +    + N  S        TL           Q+K  +F ++L  T       
Sbjct: 816  RIEETLENGSAGLLNAVSGTHDRFAETL-----------QDKAAAFANSLNETQARIEDT 864

Query: 451  VDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSH 510
            ++ R+  L N ++     + ET +      +    +  +  E  LQ     L    + +H
Sbjct: 865  LETRSAALLNAVSGTHDRLSETLDEKAMALAISLTEGQARIEDTLQTRSAALLNAVSGTH 924

Query: 511  GNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKD 570
              + +        +  +L++     ED L  +     +  S   ER+  TL    ++L  
Sbjct: 925  DRLSETLDEKAMALAISLNENQTRIEDTLEARSEAFLKAVSGAHERIAETLDEKASALTA 984

Query: 571  MLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGH 630
             L E + R+   +  +SE   ++ ++++ ++S  + DR    + SL   QS  EET+   
Sbjct: 985  SLNEGQSRLQDTLESRSESFLNAVSATHDRLSETLDDRAMALAISLNESQSRLEETLTSG 1044

Query: 631  PQSIVDSISNS---TNNLYD-KIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLV 686
              +I +++S +    N + D K   LAA+L+E Q  L+ +L   A  +V  +T + ++L 
Sbjct: 1045 ADAITNAVSGTHERLNGVLDQKASALAASLNEGQVRLEEALGHRAAALVGAVTASHDRLT 1104

Query: 687  NRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSN 746
            +  DE +  +  S + + ++ ++  +   ++  +   +    V+G   + T  I + +++
Sbjct: 1105 DTLDEKTMALAISLDDNQSRFDSALEARSNAIMEAVTSAEARVAGAFADKTDAIHNAYAD 1164

Query: 747  NAKRMEELLHSGSANIESELSAISKAMNKSIDD-VETISTALKERCQE----LGSDLVNH 801
            N +R+E  L   SA     LS +  A     +D V  ++  ++ R  +    LGS     
Sbjct: 1165 NQRRLESALSEHSA----ALSGVLDAGGARFEDLVGGLTGRIEGRLSDAHARLGSMAEEA 1220

Query: 802  SDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLT 861
            + ++   L  A E + TT   R ++   +L+   ++  + L  Q+              T
Sbjct: 1221 AARIEGGLASAHERIRTTLEDRGNAIELSLSQAHAQISDTLTEQA--------------T 1266

Query: 862  DIAYSKAIDVAN---SLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLS 918
             I  S A  V+    SL + + ++   ++  +Q + +++ A    +A  F+E  +N + S
Sbjct: 1267 SIGTSVATSVSMLEMSLEDREASIRQAIDAGAQTLEDRMRAGAGQIAGRFQEA-ANTISS 1325

Query: 919  YDENRQTLDKKLSDHIDVLRQNLAGS---------------ENKIDGAIG-------SAS 956
              +N       LS H+D   +NLAG                E +I   +G       +A+
Sbjct: 1326 SAQN-------LSAHLDQSVENLAGRLEETGSRMEAGLTAIETRIRDGVGGVAEKVEAAT 1378

Query: 957  QFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLST 1016
              +  +L +  SR+ +L   +   +++TL  S     + +  ++  L + LD++ + L+ 
Sbjct: 1379 SQLSGVLTDGISRLGALGDEATQRISTTLEGSAANLTQAIDSRTANLAETLDSRTTTLAG 1438

Query: 1017 AVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSI-QTLAQELVSVIGSMSQSTTDI 1075
            A+  +T +L   L    + +   + T   +     D++ +T+  +   +  ++  +  + 
Sbjct: 1439 AIEGRTASLGETLDRGNERIEERLSTMDRALTVGLDAVNRTIEGKAAGLASTLRSAVAEA 1498

Query: 1076 SGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLL---- 1131
            +  +E       + + K  + F  ++ A  DE ++ M+    +I  R  E   +L     
Sbjct: 1499 AQGMEGEATRTTELLGKTGQQFAQDLNAKSDEFTRTMDERSSQIVTRVAEAQNRLATQAA 1558

Query: 1132 -------QNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNI 1184
                   +  + I N++ ++ + V  ++  IS    E  + LE R     + L      I
Sbjct: 1559 AVAQTFSEAGNAIVNKVAEAETVVGTQVNAISRALSEAGQSLEARGNAIRTTLSGAGSEI 1618

Query: 1185 SRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFET 1244
            S  + DV+  + + ++  RS +E+R  E+   LS++DRALE+ G+++    +E  +    
Sbjct: 1619 SATMADVERALEARSSAIRSNLEERAREIDTSLSDVDRALEARGNSIRSTLEERTRDL-- 1676

Query: 1245 NMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGA--------------- 1289
                         +SML     RS  L  IL + +  I D  + A               
Sbjct: 1677 -------------NSML---SGRSVELTRILDETARPIIDRYTDAGEQAAARITAAANLS 1720

Query: 1290 ---FHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATD 1346
                  E  A+ + +  +  N ANA+  +E  L+ +V  +  R+++SS  +  +++ A +
Sbjct: 1721 ADRLRAENEALASAVAARTENVANAVSAIENSLVGNVNGLVQRMSESSAAMAMMMNRAAE 1780

Query: 1347 SLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFD 1406
             L  VDERL +TT R  ++      ++  S++L E K+  L +IS  +L Q+  I+ +FD
Sbjct: 1781 QLTSVDERLGETTTRFADSATKAAEMVNASTRLLEGKVDRLSDISGQTLAQVGSIIGRFD 1840

Query: 1407 KNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIV 1466
            ++S++L ++   L  AQS    +L++    L  L+  LV +S E +K +  +   ++ + 
Sbjct: 1841 EHSKVLTQASQLLGAAQSNLASTLEEREGALQALSVSLVQRSDEIEKTMRGLGGMIETVF 1900

Query: 1467 EQADFLSDTVVKNMTDSIQSSF---------------------------------IKIDG 1493
            E+A+  S+ V  N+   +QSSF                                   ID 
Sbjct: 1901 ERAEQRSNQVTGNLRQGVQSSFADIGRILTETEKRAQEAAETMREAITRAGDEANTTIDS 1960

Query: 1494 TLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNI 1553
            T +N+E RS D    I   L      ++  ++         S   + HMR+ +   I + 
Sbjct: 1961 TFANVERRSGDLSNRIRGGL----TASLSEVERMLGEAGRASDGAAQHMRESLREAIEDA 2016

Query: 1554 ENIFSTLEE---KSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRR-IAEDLNNSRD 1609
               FS   E   +S   ++  LD+   ++      L + + + A   RR +AE +   +D
Sbjct: 2017 VGRFSGATEDIRRSAADIRNELDATRAELKRGAFDLPEEAKESASAMRRAVAEQIKALQD 2076

Query: 1610 I---LKRDSVSLAKEAKESADTIRSAIEEQINTLK--------------------DFQKL 1646
            I   + R S  L    + S  T RS  + Q                           +  
Sbjct: 2077 ISQLVGRSSQQL----EISEPTARSLAQAQPTPRPTPPIAAQPPQPAAPPPIEAAGLRGT 2132

Query: 1647 ITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKSS 1706
            I  S    AA+  + +        ++ ++   +++        W + +L  ++  +   +
Sbjct: 2133 IAPSAP--AATPQRAVQQPVPTRQELGRQEPPRESGG------WISDLLRGASREEAADA 2184

Query: 1707 SHIDISDKDS------------------LSSIDSLVENISKFIDYDAFVQLWKSYTLGED 1748
            +   +  + +                  + S++SL  +I++ ID+DA V LW+ Y  GE 
Sbjct: 2185 APARVPARSAETAAPAARSNDSRNPRHVVESLNSLSVDIARAIDHDASVDLWRRYQRGER 2244

Query: 1749 DIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEH 1808
            D+F++RLYT+KGQ+ F  ++ +Y  +   R A+DRYI +FE++L+++A+++ +  + Q +
Sbjct: 2245 DVFTRRLYTLKGQQTFDEIKRKYDREPEFRTAVDRYIGDFEKLLADVARTDPNQTVTQSY 2304

Query: 1809 IMSNYGKVYTMLVHASGR 1826
            + S+ GKVYTML HA+GR
Sbjct: 2305 LTSDTGKVYTMLAHAAGR 2322



 Score =  134 bits (337), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 228/1256 (18%), Positives = 514/1256 (40%), Gaps = 175/1256 (13%)

Query: 389  SQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTL 448
            ++Q   AF     E+++  + +   I   +    + +   + E+  +    L +      
Sbjct: 627  TEQVTTAFGGRAEELTSVLTARAAEIRDAVGTAHERIDSVMAERGGALIDALTTHHGRFE 686

Query: 449  REVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFAD 508
              +  R++ + N ++     + ET +      +    ++ S  E  L+          + 
Sbjct: 687  EALTTRSDAIINAVSGTHDRLSETLDEKAMALAISLNESQSRIEDTLETRSAAFLNAVSG 746

Query: 509  SHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSL 568
            +H  + +   +    + ++LD++    ED L  +   +    S  ++RL  TL   + +L
Sbjct: 747  THERLSETLDTKAAALTTSLDERHARIEDALGTRAEALLNSVSGTSDRLAETLDEKVMAL 806

Query: 569  KDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIA 628
               L E + RI+  +   S  L ++ + ++ + +  + D+   F+NSL   Q+  E+T+ 
Sbjct: 807  AISLNESQARIEETLENGSAGLLNAVSGTHDRFAETLQDKAAAFANSLNETQARIEDTLE 866

Query: 629  GHPQSIVDSISNS----TNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQ 684
                ++++++S +    +  L +K M LA +L+E Q  ++++L+  +  +++ ++   ++
Sbjct: 867  TRSAALLNAVSGTHDRLSETLDEKAMALAISLTEGQARIEDTLQTRSAALLNAVSGTHDR 926

Query: 685  LVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLF 744
            L    DE +  +  S N +  ++E   +    +F    +   + ++  L      +    
Sbjct: 927  LSETLDEKAMALAISLNENQTRIEDTLEARSEAFLKAVSGAHERIAETLDEKASALTASL 986

Query: 745  SNNAKRMEELLHSGSANIESELSAISKAMNKSIDD-VETISTALKERCQELGSDLVNHSD 803
            +    R+++ L S S +  + +SA    +++++DD    ++ +L E    L   L + +D
Sbjct: 987  NEGQSRLQDTLESRSESFLNAVSATHDRLSETLDDRAMALAISLNESQSRLEETLTSGAD 1046

Query: 804  KVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDI 863
             + +++    E L     Q+  +   +L + Q + E  L +++  L+  +++   +LTD 
Sbjct: 1047 AITNAVSGTHERLNGVLDQKASALAASLNEGQVRLEEALGHRAAALVGAVTASHDRLTDT 1106

Query: 864  AYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENR 923
               K + +A SL + Q      LE  S A++E ++++   VA  F +    I  +Y +N+
Sbjct: 1107 LDEKTMALAISLDDNQSRFDSALEARSNAIMEAVTSAEARVAGAFADKTDAIHNAYADNQ 1166

Query: 924  QTLDKKLSDHIDVLRQNL-----------AGSENKIDGAIGSASQFIRDILDENSSRIES 972
            + L+  LS+H   L   L            G   +I+G +  A   +  + +E ++RIE 
Sbjct: 1167 RRLESALSEHSAALSGVLDAGGARFEDLVGGLTGRIEGRLSDAHARLGSMAEEAAARIEG 1226

Query: 973  LLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQ 1032
             L+ ++  + +TL       +  L +   ++   L  +A+ + T+V+T    LE +L+++
Sbjct: 1227 GLASAHERIRTTLEDRGNAIELSLSQAHAQISDTLTEQATSIGTSVATSVSMLEMSLEDR 1286

Query: 1033 EKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQK 1092
            E S+ + +D  A          QTL   + +  G        I+G+ + + ++++   Q 
Sbjct: 1287 EASIRQAIDAGA----------QTLEDRMRAGAG-------QIAGRFQEAANTISSSAQN 1329

Query: 1093 CREFFG---DNIVAFMDEISKVMEIS----EKRISQRTQEISQQLLQNNDVITNQIIDST 1145
                     +N+   ++E    ME      E RI      +++++      ++  + D  
Sbjct: 1330 LSAHLDQSVENLAGRLEETGSRMEAGLTAIETRIRDGVGGVAEKVEAATSQLSGVLTDGI 1389

Query: 1146 SRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSL 1205
            SR+ G + D + + I T+  LE        A+DS + N++        T+ S T      
Sbjct: 1390 SRL-GALGDEATQRISTT--LEGSAANLTQAIDSRTANLA-------ETLDSRTTTLAGA 1439

Query: 1206 IEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFK 1265
            IE R   + + L                                    D+ N+ +    +
Sbjct: 1440 IEGRTASLGETL------------------------------------DRGNERI----E 1459

Query: 1266 ERSNILDNILSQRSMEIS-DSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVE 1324
            ER + +D     R++ +  D+++     +   + + +   +  AA  ++        +  
Sbjct: 1460 ERLSTMD-----RALTVGLDAVNRTIEGKAAGLASTLRSAVAEAAQGME-------GEAT 1507

Query: 1325 KITNRITDSSQDVTTIISDATDSLNK-VDERLHQTTNRITETTGHIDTVLAESSKLFEKK 1383
            + T  +  + Q     ++  +D   + +DER  Q   R+ E    + T  A  ++ F + 
Sbjct: 1508 RTTELLGKTGQQFAQDLNAKSDEFTRTMDERSSQIVTRVAEAQNRLATQAAAVAQTFSEA 1567

Query: 1384 IKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSR 1443
                           + IV+K  +   ++    +++ +A SE   SL+   N +    + 
Sbjct: 1568 --------------GNAIVNKVAEAETVVGTQVNAISRALSEAGQSLEARGNAI---RTT 1610

Query: 1444 LVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSR 1503
            L    SE    + + + DV++ +E                 +SS I+     SN+E R+R
Sbjct: 1611 LSGAGSE----ISATMADVERALE----------------ARSSAIR-----SNLEERAR 1645

Query: 1504 DTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEK 1563
            +    ID +L+D+        +S   TL+E++ DL+                  S L  +
Sbjct: 1646 E----IDTSLSDVDRALEARGNSIRSTLEERTRDLN------------------SMLSGR 1683

Query: 1564 SDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLA 1619
            S +  ++  ++    +D +T    + +  I   +       N S D L+ ++ +LA
Sbjct: 1684 SVELTRILDETARPIIDRYTDAGEQAAARITAAA-------NLSADRLRAENEALA 1732


>gi|190892027|ref|YP_001978569.1| hypothetical protein RHECIAT_CH0002438 [Rhizobium etli CIAT 652]
 gi|190697306|gb|ACE91391.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 2367

 Score =  388 bits (996), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 350/1521 (23%), Positives = 680/1521 (44%), Gaps = 177/1521 (11%)

Query: 5    KENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSKNFKQ 64
            K+N  + R    E  E + SD    + +    +  + +RR                N +Q
Sbjct: 28   KDNVPSRRGDAPEAPEGNVSDPSNARNQQAQEEAQRRNRR--------------GANGEQ 73

Query: 65   ASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYT 124
            AS       F PAND        IL++    S   A+R A + S +W+   LG +   Y 
Sbjct: 74   ASR---APAFAPANDASRTTPASILKSFDGASSRSAMRTATLFSALWVMAGLGLMSLLY- 129

Query: 125  NSP----MDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIAL 180
             +P    + S  D    P VI   LV  +VP+++F++F IMISRA+DM +A++S+A +AL
Sbjct: 130  -APQIWQIRSIADLVALPGVIA-GLVGIIVPVMMFYAFAIMISRAQDMRNAARSMAEVAL 187

Query: 181  RLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSE 240
            RL +PE  +SE++ ++  AVR+E+  M E I+R I+RASELE  V SE+  LE +Y  +E
Sbjct: 188  RLAEPETIASERIMTVGQAVRREVSAMNEGIERTIARASELETLVHSEVNALERSYADNE 247

Query: 241  MRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSI 300
            +R+  +   L  EREAI+NH  ++ TSI  VH+ LKEELSL +EEI+V L+ + ++F S+
Sbjct: 248  LRVRGLVHELGSEREAIVNHADRIRTSIGSVHDQLKEELSLATEEIAVRLATSGEAFASL 307

Query: 301  VDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSG 360
            +D R A + EK+   +Q     +++K D LL+ L+++   +  +FDNR+E+L+  LN  G
Sbjct: 308  IDTRAATILEKSDSALQSMGSLLAAKTDSLLQTLNASGFALATEFDNRLEALTVNLNEHG 367

Query: 361  RSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLND 420
              L +Q       + ++T+K++ AL E++ Q  +   +   E++   +  +++I  TL+D
Sbjct: 368  EKLLSQFETRASTIDSSTEKLNAALNERTHQLNEILIARTREINESLTSGERTIGGTLDD 427

Query: 421  VLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDF 480
            VL  L  +L EK  SF  +L+ST D+T+ ++D RT   E R+   + ++   F+  + +F
Sbjct: 428  VLSKLNSALDEKGASFRQSLQSTADDTVMDLDLRTGFFEERLQTTVAQLSTAFDERVAEF 487

Query: 481  SSFYK-----------DNLSEFESNLQGN-----------IDKLQGCFAD---------- 508
            +S +            ++L+     L G            ID+L     D          
Sbjct: 488  TSAFDKRTGSLDTKLMESLARINETLTGGSDSIDGILNSSIDRLGSSMTDQSLALAAALA 547

Query: 509  -SHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLEN-------- 559
              H  +E    ++ + I + L  +T      L    ++I+   +  T  L+N        
Sbjct: 548  TGHEMLESTLGTHSEEITTALTSRTGQLTSALQNATSDIALALASGTSDLQNNLQARSAE 607

Query: 560  ---TLTNSINSLKDMLEEKRQRIDSDIGKKSEELCS-----------SFNSSYQKVSNVI 605
               TL  + + L   +    Q + +  G ++EEL             +  +++ ++ +V+
Sbjct: 608  FRDTLRTTTSELTAAVAAGTQEVTTAFGGRAEELSGLLTARTAEISEALGAAHGRIDSVM 667

Query: 606  SDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLY----DKIMVLAAALSESQK 661
            ++R     ++L      FEE ++    +I+++++ + + L     +K M LA +L+ESQ 
Sbjct: 668  AERGGALVDALTSHHGRFEEALSTRSDAIINAVAGTHDRLAETLDEKAMALAISLNESQA 727

Query: 662  SLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDT 721
             ++++L+  +  +++ ++   ++L    DE +  +  S N S +++E   +    +F + 
Sbjct: 728  RIEDTLETRSATLLNAVSGTHDRLSETLDEKAMALAISLNESQSRIEDTLETRSAAFLNA 787

Query: 722  FNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDD-V 780
             +   + +S  L      +         R+E+ L + +  + + ++     + +++D+  
Sbjct: 788  VSGTHERLSETLDTKAAALTTSLDERHARIEDALGTRAEALLNTIAGTRDRLAETLDEKA 847

Query: 781  ETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFEN 840
              ++ +L E    L   L   S  +L+++    +        +  +   +L++ Q++ EN
Sbjct: 848  LALAISLNEGQSRLEDTLETRSAALLNAVSSTHDRFAEALDGKASAIATSLSETQARLEN 907

Query: 841  NLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISAS 900
             L  +S  L+D +S    +L++    KA+ +A SL E Q  +  TLE  S A+L  +S +
Sbjct: 908  TLETRSAALMDAVSGTHDRLSETLDEKAMALAISLNESQARIEDTLETRSAALLNSVSGT 967

Query: 901  NTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIR 960
                ++T +E    + +S +E++  ++  L    +     ++G+            Q I 
Sbjct: 968  YDRFSETLDEKAMTLAISINESQARIEDTLGTRSEAFLNAVSGTH-----------QRIS 1016

Query: 961  DILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST 1020
            + LD+N+S + + L+     +  TL    + F   +    D L + LD++A  L+ +++ 
Sbjct: 1017 ETLDQNTSALAATLNEGQRRLQDTLETRSESFLNAVSATHDRLSETLDDRAMALAISLNE 1076

Query: 1021 QTINLE-----------NNLKEQEKSLSRVVDTSASSFKYLSDSIQ-----TLAQELVSV 1064
                LE           N +    + L+ V+D  AS+     +  Q      LA    ++
Sbjct: 1077 SQSRLEETLTSGADAITNAVSGTHERLNGVLDQKASALAASLNEGQVRIEEALAHRTAAI 1136

Query: 1065 IGSMSQSTTDISGKLE-------ISLD-------------------SVNQKIQKCREFFG 1098
            IG+++ S   ++  L+       ISLD                   +V     +    F 
Sbjct: 1137 IGAVTASHDRLTDSLDEKTMALAISLDDNQSRFDSALEARSNSMMEAVASAEARVAGAFA 1196

Query: 1099 DNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNK 1158
            D   A  +  +   +  E  +SQ +  +S  L        + +   T R+ G    +S  
Sbjct: 1197 DKTDAIHNAYADNQQRLENALSQHSAALSGALDAGGARFEDLVGGLTGRIEG---SLSEA 1253

Query: 1159 FIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHE------ 1212
             +    + E+   +  S LDS  + I   L D  + I    N++ +LI   + E      
Sbjct: 1254 HVRLGGLAEEAAARIESGLDSAHERIRTTLEDRANAIDLSLNQAHALISDTLTEQATSIG 1313

Query: 1213 --VKDVLSNLDRALE----------------------SYGSTVFKQFKEYVQCFETNMEN 1248
              V   +S L+ +LE                      +    +  +F++      ++ +N
Sbjct: 1314 TSVATTVSMLEMSLEHREASIRQAIDASAQTLEERMHAGAGQIAGRFQDAANAISSSAQN 1373

Query: 1249 MESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNA 1308
            + +  D++ +S+    +E  + ++  L+     I D + G   K     ++    Q+   
Sbjct: 1374 LSTHLDQSVESLAERLQETGSRMEAGLTTIESRIRDGVGGVADK-----IDAASSQLSGV 1428

Query: 1309 -ANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNK-VDERLHQTTNRITETT 1366
             A+ + +L AL     ++I+  +  S+ ++T  I   T +L + +D R    T  I   T
Sbjct: 1429 LADGISRLGALGDDTTQRISATLEGSAANLTQAIDSRTTNLAETLDSRTSTLTGAIEGRT 1488

Query: 1367 GHIDTVLAESSKLFEKKIKDL 1387
              +   L   +   E+++  +
Sbjct: 1489 ASLGETLDRGNARIEERLSTM 1509



 Score =  295 bits (755), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 313/1487 (21%), Positives = 664/1487 (44%), Gaps = 112/1487 (7%)

Query: 243  IDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVD 302
            +D +T +  +  EA+      +  ++A  H+ L E L   +  +++ L+ +    +  ++
Sbjct: 675  VDALTSHHGRFEEALSTRSDAIINAVAGTHDRLAETLDEKAMALAISLNESQARIEDTLE 734

Query: 303  VRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRS 362
             R A +    +      ++T+  K   L   L+ +   I    + R  +  N ++ +   
Sbjct: 735  TRSATLLNAVSGTHDRLSETLDEKAMALAISLNESQSRIEDTLETRSAAFLNAVSGTHER 794

Query: 363  LANQVGNYTLMLGNNTD----KVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTL 418
            L+  +      L  + D    ++  AL  +++  +         ++    EK  ++ ++L
Sbjct: 795  LSETLDTKAAALTTSLDERHARIEDALGTRAEALLNTIAGTRDRLAETLDEKALALAISL 854

Query: 419  NDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRIT---AFLKEIVETFNN 475
            N+    L  +L+ +  +  + + ST D     +D + + +   ++   A L+  +ET + 
Sbjct: 855  NEGQSRLEDTLETRSAALLNAVSSTHDRFAEALDGKASAIATSLSETQARLENTLETRSA 914

Query: 476  SITDFSSFYKDNLSEF---------------ESNLQGNIDKLQGCFADSHGNMEDLFLSN 520
            ++ D  S   D LSE                ++ ++  ++       +S     D F   
Sbjct: 915  ALMDAVSGTHDRLSETLDEKAMALAISLNESQARIEDTLETRSAALLNSVSGTYDRFSET 974

Query: 521  I----QTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKR 576
            +     T+  ++++     ED L  +        S   +R+  TL  + ++L   L E +
Sbjct: 975  LDEKAMTLAISINESQARIEDTLGTRSEAFLNAVSGTHQRISETLDQNTSALAATLNEGQ 1034

Query: 577  QRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVD 636
            +R+   +  +SE   ++ ++++ ++S  + DR    + SL   QS  EET+     +I +
Sbjct: 1035 RRLQDTLETRSESFLNAVSATHDRLSETLDDRAMALAISLNESQSRLEETLTSGADAITN 1094

Query: 637  SISNS---TNNLYD-KIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDES 692
            ++S +    N + D K   LAA+L+E Q  ++ +L      ++  +T + ++L +  DE 
Sbjct: 1095 AVSGTHERLNGVLDQKASALAASLNEGQVRIEEALAHRTAAIIGAVTASHDRLTDSLDEK 1154

Query: 693  SKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRME 752
            +  +  S + + ++ ++  +   +S  +   +    V+G   + T  I + +++N +R+E
Sbjct: 1155 TMALAISLDDNQSRFDSALEARSNSMMEAVASAEARVAGAFADKTDAIHNAYADNQQRLE 1214

Query: 753  ELLHSGSANIESELSAISKAMNKSIDDVET-ISTALKERCQELGSDLVNHSDKVLSSLKQ 811
              L   SA +   L A        +  +   I  +L E    LG      + ++ S L  
Sbjct: 1215 NALSQHSAALSGALDAGGARFEDLVGGLTGRIEGSLSEAHVRLGGLAEEAAARIESGLDS 1274

Query: 812  AQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLL-DKLSSDIQKLTDIAYSKAID 870
            A E + TT   R ++   +L            NQ+H L+ D L+   ++ T I  S A  
Sbjct: 1275 AHERIRTTLEDRANAIDLSL------------NQAHALISDTLT---EQATSIGTSVATT 1319

Query: 871  VAN---SLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS-------NILLSYD 920
            V+    SL   + ++   ++  +Q + E++ A    +A  F++  +       N+    D
Sbjct: 1320 VSMLEMSLEHREASIRQAIDASAQTLEERMHAGAGQIAGRFQDAANAISSSAQNLSTHLD 1379

Query: 921  ENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIG-------SASQFIRDILDENSSRIESL 973
            ++ ++L ++L +    +   L   E++I   +G       +AS  +  +L +  SR+ +L
Sbjct: 1380 QSVESLAERLQETGSRMEAGLTTIESRIRDGVGGVADKIDAASSQLSGVLADGISRLGAL 1439

Query: 974  LSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQE 1033
               +   +++TL  S     + +  ++  L + LD++ S L+ A+  +T +L   L    
Sbjct: 1440 GDDTTQRISATLEGSAANLTQAIDSRTTNLAETLDSRTSTLTGAIEGRTASLGETLDRGN 1499

Query: 1034 KSLSRVVDTSASSFKYLSDSI-QTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQK 1092
              +   + T   +     D++ +T+  +   +  ++  +  + +  +E       + + K
Sbjct: 1500 ARIEERLSTMDRALTVGLDAVNRTIEGKAAGLASTLRSAVAEAAQGMEGEATRTTELLGK 1559

Query: 1093 CREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLL-----------QNNDVITNQI 1141
              + F +++ A  DE ++ M+    +I  R  E   +L            +  + I N++
Sbjct: 1560 TGQQFAEDLNAKSDEFTRTMDERSSQIVTRVAEAQNRLATQAAAVAQTFSEAGNAIVNKV 1619

Query: 1142 IDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNE 1201
             ++ + V  ++  IS    +  + LE R     + L      IS  + DVD  + + ++ 
Sbjct: 1620 AEAETIVGTQVNAISRALSDAGQSLEARGNAIRTTLSGAGSEISATMADVDRALEARSSA 1679

Query: 1202 SRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSML 1261
             R+ +E+R  E+   LS++DRALE+ G+++    +E  +                 +SML
Sbjct: 1680 IRTNLEERTREIDATLSDIDRALEARGNSIRTTLEERTRDL---------------NSML 1724

Query: 1262 LSFKERSNILDNILSQRSMEISDSISGA------------------FHKEGNAVVNVIDQ 1303
                 RS  L  IL + +  I D  + A                     E  A+ + +  
Sbjct: 1725 ---SGRSVELTRILDETARPIIDRYTDAGEQAAARITAAANLSADRLRAENEALASAVAA 1781

Query: 1304 QIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRIT 1363
            +  N ANA+  +E+ L+ +V  +  R+++SS  +  +++ A + L  VD RL +TT R  
Sbjct: 1782 RTENVANAVSAIESSLVGNVNGLVQRMSESSAAMAMMMNRAAEQLTSVDGRLGETTTRFA 1841

Query: 1364 ETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQ 1423
            ++      ++  S++L E K+  L +IS  +L Q+  I+ +FD++S++L ++   L  AQ
Sbjct: 1842 DSATKAAEMVNASTRLLEGKVDRLSDISGQTLAQVGGIIGRFDEHSKVLTQASQLLGAAQ 1901

Query: 1424 SETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDS 1483
            S    +L++  + L  L+  LV +SSE +K ++ +   ++ + E+A+  S+ V  N+   
Sbjct: 1902 SNLASTLEERESALQALSVSLVQRSSEIEKTMLGLGGMIETVFERAEQRSNQVTGNLRQG 1961

Query: 1484 IQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMR 1543
            +QSSF  I   L+  E R+++    +   +   G++   TID  F  ++ +S DLSN +R
Sbjct: 1962 VQSSFADIGRILTETEKRAQEAAETMRQAITRAGDEANTTIDGTFANVERRSGDLSNRIR 2021

Query: 1544 QKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAED 1603
              + +++  +E + +     SD + Q   +SL   ++    + S  ++DI  ++  I  +
Sbjct: 2022 GGLTASLSEVERMLAEAGRASDGAAQTMRESLREAIEDAVGRFSGATEDIRRSAADIRSE 2081

Query: 1604 LNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS 1650
            L+ +R  LKR +  L +EAKESA  +R A+ EQI  L+D  +L+  S
Sbjct: 2082 LDATRAELKRGAFDLPEEAKESASAMRRAVAEQIKALQDISQLVGRS 2128



 Score =  123 bits (309), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 80/108 (74%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +   R
Sbjct: 2258 SLNSLSVDIARAIDHDASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFR 2317

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI +FE++L+++A+++ +  + Q ++ S+ GKVYTML HA+GR
Sbjct: 2318 TAVDRYIGDFEKLLADVARTDPNQTVTQSYLTSDTGKVYTMLAHAAGR 2365


>gi|209549569|ref|YP_002281486.1| Apolipoprotein A1/A4/E [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209535325|gb|ACI55260.1| Apolipoprotein A1/A4/E [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 2335

 Score =  385 bits (989), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 344/1496 (22%), Positives = 677/1496 (45%), Gaps = 244/1496 (16%)

Query: 37   KKHKYSRRDDSIESKDR-------------QQTTLSKNFKQASNKQTYSG--FYPANDLD 81
            K +  SRR D+ E+ +              Q+    +N + A  +Q   G  F PAND  
Sbjct: 28   KDNVPSRRGDAPEAPEANVSDPSNARNQQAQEEAQRRNRRSAGAEQASRGPAFTPANDAS 87

Query: 82   NGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSP----MDSFYDFAMR 137
                  IL++    S   A+R A + S++W+   LG +   Y  +P    + S  D    
Sbjct: 88   RNTPASILKSFDGASSRSAVRTATLFSVLWVMGGLGLMSLLY--APQIWQIRSLADLVAL 145

Query: 138  PEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSIS 197
            P VI   LV  ++P+++F++F IMI+RA+DM +A++S+A +ALRL +PE  +SE++ ++ 
Sbjct: 146  PGVIA-GLVGIIIPVMMFYAFAIMIARAQDMRNAARSMAEVALRLAEPETIASERIMTVG 204

Query: 198  SAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAI 257
             AVR+E+  M E I+R I+RASELE  V SE+  LE +Y  +E+R+  +   L  EREAI
Sbjct: 205  QAVRREVSAMNEGIERTIARASELETLVHSEVNALERSYADNELRVRGLVHELGSEREAI 264

Query: 258  INHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQ 317
            +NH  ++ TSI  VH+ LKEELSL +EEI+V LS + ++F S++D R A + EK+   +Q
Sbjct: 265  VNHADRIRTSIGSVHDQLKEELSLATEEIAVRLSTSGEAFASLIDTRAATILEKSDNALQ 324

Query: 318  ESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNN 377
                 +++K D LL+ L+++   +  +FDNR+E+LS  LN+ G  L +Q       + ++
Sbjct: 325  SIGSLLAAKTDSLLQTLNASGFALATEFDNRLEALSVNLNDHGEKLLSQFETRASTMDSS 384

Query: 378  TDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFC 437
            T+K++ AL E++QQ  +   +   E++   +  +++I  TL+DVL  L  +L EK  SF 
Sbjct: 385  TEKLNAALHERTQQLSEILIARTREINESLTSGERTIGGTLDDVLSKLNSALDEKGASFR 444

Query: 438  SNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYK-----------D 486
             +L+ST D+ + ++D R+   E R+   + ++   F+  + +F+S +            +
Sbjct: 445  QSLQSTADDAVMDLDVRSGFFEERLQTTVAQLSTAFDERVAEFTSAFDKRTGSLDTKLME 504

Query: 487  NLSEFESNLQGNIDKLQG----------------------CFADSHGNMEDLFLSNIQTI 524
            +L+     L G  D + G                        +  H  +E    +    I
Sbjct: 505  SLARINETLTGGSDSIDGILSSGIERLSSSMTDQSLALATALSTGHEVLEGAIGTRADEI 564

Query: 525  GSNLDKKTLLFEDILSKKQNNISQITSMNTERLEN-----------TLTNSINSLKDMLE 573
             + L  +T      L    + I+   +  T  L+N           TL  + + L   + 
Sbjct: 565  TAALTSRTGELTSALQSATSEIALTLASGTSDLQNNLQARSAEFRDTLRTTTSDLTTAVA 624

Query: 574  EKRQRIDSDIGKKSEELCS-----------SFNSSYQKVSNVISDREKLFSNSLARVQSH 622
               +++ +  G + EEL             +  +++ ++ +V+++R     ++L      
Sbjct: 625  AGTEQVTAAFGGRGEELSGMLTARAAEISEALGTAHGRIDSVMAERGGALVDALTTHHGR 684

Query: 623  FEETIAGHPQSIVDSISNSTNNLY----DKIMVLAAALSESQKSLDNSLKAHATDVVHKI 678
            FEE +     +I+D++S + + L     +K + LA +L+ESQ  ++++L+  +  ++  +
Sbjct: 685  FEEALTSRADAIIDAVSGTHDRLAETLDEKAIALAISLNESQARIEDTLETRSEALLSAV 744

Query: 679  TNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHS-----------FNDTFNNKSD 727
            +   ++L    DE +  +  S N +  ++E   +    +            ++T ++K+ 
Sbjct: 745  SGTHDRLSETLDEKAMALAISLNENQARIEDTLETRSAALLNAVSGTHDRLSETLDSKAA 804

Query: 728  HVSGILKNSTQHIDDLFSNNAK---------------------------------RMEEL 754
             ++  L      ID+     A+                                 R+EE 
Sbjct: 805  ALTTSLDERHARIDNALGTRAEALLNTVSGTRDRLAETLDEKAAAFAISLNESQARIEET 864

Query: 755  LHSGSANIESELSAISKAMNKSIDD-VETISTALKERCQELGSDLVNHSDKVLSSLKQAQ 813
            L + SA + + +S+    ++++++  VE  +T+L E    +   L + S  +L+++    
Sbjct: 865  LQTRSAALLNAVSSTHDRLSETLEGKVEAFATSLSEGQARIDETLESRSAALLNAVSGTH 924

Query: 814  ELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVAN 873
            E L  T  ++  +   +L ++QS+ E+ L  +S   L  +S   ++L++    K+  +A 
Sbjct: 925  ERLSETLDEKAMTLAISLNESQSRIEDTLEARSEAFLKAVSGTHERLSETLDEKSAALAA 984

Query: 874  SLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDH 933
            SL E Q  +  TL++ S++ L  +S ++  +++T ++    + +S +E++  L++ L+  
Sbjct: 985  SLNEGQSRLQDTLDSRSESFLSAVSTTHDRLSETLDDRAMALAISLNESQSRLEEALTSG 1044

Query: 934  IDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSH---- 989
             D + Q ++G+ + ++G +   +  I   L+E  +R+E  L     ++   +  +H    
Sbjct: 1045 ADAITQAVSGTHDGLNGVLDRKAAAIASSLNEGQARLEEALVHRTAAIIGAVTATHDRLT 1104

Query: 990  ------------------QKFDRLLQEKSDELIQLLDNKASCLSTAVSTQT--------- 1022
                               +FD +L+ +S+ +++ +    S ++ A + +T         
Sbjct: 1105 DTLDEKTMALAISLDDNQSRFDSVLEARSNAIMEAVSGAESRVAGAFTDKTDAIRAAYTD 1164

Query: 1023 --INLENNLKEQEKSLSRVVDTSASSFK----YLSDSIQTLAQELVSVIGSMSQSTTDIS 1076
                LEN L E   +LS V+D   + F+     L+  I+    +  + +G ++    + +
Sbjct: 1165 NQQRLENALSEHSAALSGVLDAGGARFEDLVGGLTGRIEGRLSDAHARLGGLAD---EAA 1221

Query: 1077 GKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDV 1136
             ++E  L S +++I+   E                          R   I   L Q + +
Sbjct: 1222 ARIEGGLTSAHERIRTTLE-------------------------DRANAIDLSLNQAHAL 1256

Query: 1137 ITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTIS 1196
            I + + +  + + G  V  S   +E S  LE RE     A+D+                S
Sbjct: 1257 INDTLTEHATSI-GTSVATSVSMLEMS--LEDREASIRQAIDA----------------S 1297

Query: 1197 SHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKN 1256
            + T      +E+R+H              +    +  +F+E      T+ +N  +  D++
Sbjct: 1298 AQT------LEERMH--------------AGAGQIAGRFQEAANAISTSTQNFSAQLDQS 1337

Query: 1257 NDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNA-ANALKKL 1315
             +S+   F+E  + +++ L+     IS+ + G   K     V     Q+    A+ + ++
Sbjct: 1338 VESLTGRFEETGSRVESGLAAIETRISNGVGGVAEK-----VEAASGQLSGVLADGISRI 1392

Query: 1316 EALLISDVEKITNRITDSSQDVTTII-SDATDSLNKVDERLHQTTNRITETTGHID 1370
             AL      +I+  +  S+ ++T  I S A +    +D       +R T  TG ID
Sbjct: 1393 GALSDDANRRISATLEGSAANLTQAIDSRAANLAETLD-------SRATTLTGAID 1441



 Score =  308 bits (789), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 317/1466 (21%), Positives = 652/1466 (44%), Gaps = 114/1466 (7%)

Query: 243  IDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVD 302
            +D +T +  +  EA+ +    +  +++  H+ L E L    +E ++ L+ +++  Q+   
Sbjct: 675  VDALTTHHGRFEEALTSRADAIIDAVSGTHDRLAETL----DEKAIALAISLNESQA--- 727

Query: 303  VRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRS 362
             RI    E  +  +  +   +S   D+L E L   ++ +    +     + +TL     +
Sbjct: 728  -RIEDTLETRSEALLSA---VSGTHDRLSETLDEKAMALAISLNENQARIEDTLETRSAA 783

Query: 363  LANQV-GNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDV 421
            L N V G +        D++S  L  ++     +       + N    + +++  T++  
Sbjct: 784  LLNAVSGTH--------DRLSETLDSKAAALTTSLDERHARIDNALGTRAEALLNTVSGT 835

Query: 422  LQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFS 481
               L  +L EK  +F  +L  +       +  R+  L N +++    + ET    +  F+
Sbjct: 836  RDRLAETLDEKAAAFAISLNESQARIEETLQTRSAALLNAVSSTHDRLSETLEGKVEAFA 895

Query: 482  SFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSK 541
            +   +  +  +  L+     L    + +H  + +       T+  +L++     ED L  
Sbjct: 896  TSLSEGQARIDETLESRSAALLNAVSGTHERLSETLDEKAMTLAISLNESQSRIEDTLEA 955

Query: 542  KQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKV 601
            +     +  S   ERL  TL     +L   L E + R+   +  +SE   S+ ++++ ++
Sbjct: 956  RSEAFLKAVSGTHERLSETLDEKSAALAASLNEGQSRLQDTLDSRSESFLSAVSTTHDRL 1015

Query: 602  SNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYD----KIMVLAAALS 657
            S  + DR    + SL   QS  EE +     +I  ++S + + L      K   +A++L+
Sbjct: 1016 SETLDDRAMALAISLNESQSRLEEALTSGADAITQAVSGTHDGLNGVLDRKAAAIASSLN 1075

Query: 658  ESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHS 717
            E Q  L+ +L      ++  +T   ++L +  DE +  +  S + + ++ +++ +   ++
Sbjct: 1076 EGQARLEEALVHRTAAIIGAVTATHDRLTDTLDEKTMALAISLDDNQSRFDSVLEARSNA 1135

Query: 718  FNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSI 777
              +  +     V+G   + T  I   +++N +R+E  L   SA     LS +  A     
Sbjct: 1136 IMEAVSGAESRVAGAFTDKTDAIRAAYTDNQQRLENALSEHSA----ALSGVLDAGGARF 1191

Query: 778  DD-VETISTALKERCQELGSDLVNHSD----KVLSSLKQAQELLCTTFAQRNDSFVNALA 832
            +D V  ++  ++ R  +  + L   +D    ++   L  A E + TT   R ++   +L 
Sbjct: 1192 EDLVGGLTGRIEGRLSDAHARLGGLADEAAARIEGGLTSAHERIRTTLEDRANAIDLSL- 1250

Query: 833  DNQSKFENNLVNQSHLLL-DKLSSDIQKLTDIAYSKAIDVAN---SLTEIQGNVGVTLEN 888
                       NQ+H L+ D L+   +  T I  S A  V+    SL + + ++   ++ 
Sbjct: 1251 -----------NQAHALINDTLT---EHATSIGTSVATSVSMLEMSLEDREASIRQAIDA 1296

Query: 889  HSQAMLEKISASNTLVAKTFEECMSNILLS-------YDENRQTLDKKLSDHIDVLRQNL 941
             +Q + E++ A    +A  F+E  + I  S        D++ ++L  +  +    +   L
Sbjct: 1297 SAQTLEERMHAGAGQIAGRFQEAANAISTSTQNFSAQLDQSVESLTGRFEETGSRVESGL 1356

Query: 942  AGSENKIDGAIG-------SASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDR 994
            A  E +I   +G       +AS  +  +L +  SRI +L   +N  +++TL  S     +
Sbjct: 1357 AAIETRISNGVGGVAEKVEAASGQLSGVLADGISRIGALSDDANRRISATLEGSAANLTQ 1416

Query: 995  LLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSI 1054
             +  ++  L + LD++A+ L+ A+  +T++L   L    + +   + T   +     D++
Sbjct: 1417 AIDSRAANLAETLDSRATTLTGAIDGRTVSLGETLDRGNERIEERLSTMDRALTVGLDAV 1476

Query: 1055 -QTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVME 1113
             +T+  +   +  ++  +  + +  +E       + + K  + F  ++ A  DE ++ M+
Sbjct: 1477 NRTIEGKAAGLASTLRSAVAEAAQGMEGEATRTTELLGKTGQQFAVDLNAKSDEFTRTMD 1536

Query: 1114 ---------ISEK--RISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIET 1162
                     ++E   R++ +   ++Q   +  + I N++ ++ + V  ++  IS    + 
Sbjct: 1537 ERSSQIVTRVAEAQSRLASQAAAVAQTFSEAGNAIVNKVAEAETIVGTQVNAISKALSDA 1596

Query: 1163 SRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDR 1222
             + LE R +   S L      IS  + DVD  + + +N  RS +E+R  E+    S +DR
Sbjct: 1597 GQSLETRGDAIRSTLSRAGSEISATMADVDRALEARSNAIRSNLEERAREIDTTFSGIDR 1656

Query: 1223 ALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEI 1282
            ALE+ G+++     E  +                 +SML     RS  L  IL + +  I
Sbjct: 1657 ALEARGNSIRATLDERTRDL---------------NSMLAG---RSVELTRILDETARPI 1698

Query: 1283 SDSISGA------------------FHKEGNAVVNVIDQQIYNAANALKKLEALLISDVE 1324
             D  + A                     E  A+ + +  +  N ANA+  +E  L+ +V 
Sbjct: 1699 IDRYTDAGEQAAARITAAANLSADRLRAENEALASAVAARTENVANAVSAIENSLVGNVN 1758

Query: 1325 KITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKI 1384
             +  R+++SS  +  +++ A + L  VD RL +TT R  ++T     ++  S++L E K+
Sbjct: 1759 GLVERMSESSAAMAMMMNRAVEQLTSVDSRLGETTTRFADSTTKAAEMVNASTRLLEGKV 1818

Query: 1385 KDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRL 1444
              L +IS  +L Q+  I+ +FD++S++L ++   L  AQS    +L++    L  L+  L
Sbjct: 1819 DRLSDISGQTLSQVGGIIGRFDEHSKVLTQASQLLGAAQSNLASTLEEREGALQTLSVSL 1878

Query: 1445 VSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRD 1504
            V +S E +K +  +   ++ + E+A+  S  V  N+   +QSSF  I   L+  E R+++
Sbjct: 1879 VQRSDEIEKTMRGLGGMIETVFERAEQRSSQVTGNLRQGVQSSFADIGRILTETEKRAQE 1938

Query: 1505 TVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKS 1564
                +   +   G++   TID  F  ++ +S DLSN +R  + +++  +E +       S
Sbjct: 1939 AAETMREAITRAGDEANTTIDGTFANVERRSGDLSNRIRGGLTASLSEVERMLGEAGRAS 1998

Query: 1565 DQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKE 1624
            D + Q   ++L   +D    + S  +DDI  ++  I  +L+ +R  LKR +  L +EAKE
Sbjct: 1999 DGAAQHMREALREAIDDAVGRFSGATDDIRRSAADIRNELDATRAELKRGAFDLPEEAKE 2058

Query: 1625 SADTIRSAIEEQINTLKDFQKLITDS 1650
            SA  +R A+ EQI  L+D  +L+  S
Sbjct: 2059 SASAMRRAVAEQIKALQDISQLVGRS 2084



 Score =  121 bits (304), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 80/108 (74%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +   R
Sbjct: 2226 SLNSLSVDIARAIDHDASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFR 2285

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI +FE++L+++A+++ +  + Q ++ S+ GKVYTML HA+GR
Sbjct: 2286 TAVDRYIGDFEKLLADVARTDPNQIVSQSYLTSDTGKVYTMLAHAAGR 2333


>gi|241204907|ref|YP_002976003.1| hypothetical protein Rleg_2187 [Rhizobium leguminosarum bv. trifolii
            WSM1325]
 gi|240858797|gb|ACS56464.1| conserved hypothetical protein [Rhizobium leguminosarum bv. trifolii
            WSM1325]
          Length = 2331

 Score =  379 bits (973), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 326/1454 (22%), Positives = 677/1454 (46%), Gaps = 128/1454 (8%)

Query: 5    KENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSKNFKQ 64
            K+N  + R    +  E + SD    + +    +  + SRR  + E   R           
Sbjct: 28   KDNVPSRRGDAPQAPEANVSDPVNARNQQAQEEAQRRSRRGAAGEQTSR----------- 76

Query: 65   ASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYT 124
                     F PAND        IL++    S   A+R A + S++W+   LG +   Y 
Sbjct: 77   ------APAFAPANDASRNTPASILKSFDGASSRSAVRTATLFSVLWVMAGLGLMSLLY- 129

Query: 125  NSP----MDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIAL 180
             +P    + S  D    P VI   LV  ++P+++F++F IMISRA+DM +A++S+A +AL
Sbjct: 130  -APQIWQIRSLADLVALPGVIA-GLVGIIIPVMMFYAFAIMISRAQDMRNAARSMAEVAL 187

Query: 181  RLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSE 240
            RL +PE  +SE++ ++  AVR+E+  M E I+R I+RASELE  V SE+  LE +Y  +E
Sbjct: 188  RLAEPETIASERIMTVGQAVRREVSAMNEGIERTIARASELETLVHSEVNALERSYADNE 247

Query: 241  MRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSI 300
            +R+  +   L  EREAI+NH  ++ TSI  VH+ LKEELSL +EEI+V L+ + ++F S+
Sbjct: 248  LRVRGLVHELGSEREAIVNHADRIRTSIGSVHDQLKEELSLATEEIAVRLATSGEAFASL 307

Query: 301  VDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSG 360
            +D R A + EK+   +Q     +++K D LL+ L+++   +  +FDNR+E+LS  LN+ G
Sbjct: 308  IDTRAATILEKSDSALQSMGSLLAAKTDTLLQTLNASGFALATEFDNRLEALSVNLNDHG 367

Query: 361  RSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLND 420
              L +Q       + ++T+K++ AL E++ Q  +   +   E++   +  +++I  TL+D
Sbjct: 368  ERLLSQFETRASTMDSSTEKLNAALNERTHQLNEILIARTREINESLTSGERTIGGTLDD 427

Query: 421  VLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDF 480
            VL  L  +L EK  SF  +L++T D+ + ++D R+   E R+   + ++   F+  +++F
Sbjct: 428  VLSKLNSALDEKGASFRQSLQTTADDAVMDLDVRSGFFEERLQTTVAQLSTAFDERVSEF 487

Query: 481  SSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTL------- 533
            +S +       ++ L  ++ ++         +++ +  S I  +GS++  ++L       
Sbjct: 488  TSAFDKRTGSLDTKLMESLARINETLTGGSDSIDGILNSGIDRLGSSISDQSLALATALA 547

Query: 534  ----LFEDILSKKQNNISQITSMNTERLEN-----------TLTNSINSLKDMLEEKR-- 576
                + E  L  + + I+   +  T  L +           TL +  + L++ L+ +   
Sbjct: 548  TGHEVLESTLGSRADEITTALTSRTGELTSALQSATSDIALTLASGTSELQNNLQTRSAE 607

Query: 577  --------------------QRIDSDIGKKSEELCS-----------SFNSSYQKVSNVI 605
                                +++ S  G ++EEL             +  +++ ++ +V+
Sbjct: 608  FRDALRTTTTDLTTAVAAGTEQVTSAFGGRAEELSGVLTARAAEISEALGTAHGRIDSVM 667

Query: 606  SDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLY----DKIMVLAAALSESQK 661
            ++R      +L      FEE +     +I++++S + + L     +K M LA +L+ESQ 
Sbjct: 668  AERGGALLEALTTHHGRFEEALTTRSDAIINAVSGTHDRLAETLDEKAMALAISLNESQA 727

Query: 662  SLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDT 721
             ++++L+  +   ++ ++   ++L    D  +  +  S +  + ++E        +  +T
Sbjct: 728  RIEDTLETRSEAFLNAVSGTHDRLSETLDSKAAALTTSLDERHARIEDALGTRAEALLNT 787

Query: 722  FNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDD-V 780
             +   D ++  L      +    +    R+E+ L + SA + + +S     +++++D   
Sbjct: 788  VSGTRDRLAETLDEKAMALAISLNEGQARIEDTLETRSAALLNAVSGTHDRLSETLDGKA 847

Query: 781  ETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFEN 840
               +T+L E    + + L   S  +L+++    + L  T  ++  +   +L + Q++ E+
Sbjct: 848  AAFATSLSEGHARIENTLETRSAALLNAVSSTHDRLSETLDEKAMALAISLNETQTRIED 907

Query: 841  NLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISAS 900
             L  +S  LL+ +S    +L++    KA+ +A SL E Q  +  TLE  S+A L+ +S +
Sbjct: 908  TLETRSAALLNAVSGTHDRLSETLDEKAMTLAISLNESQSRIEDTLEARSEAFLKAVSGT 967

Query: 901  NTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIR 960
            +  +++T +E  + I  S +E +  L   L    + L   ++ + +++   +   +  + 
Sbjct: 968  HDRLSETLDEKATAIAASLNEGQSRLQDTLESRSESLLNAVSATHDRLSETLDDRAMALA 1027

Query: 961  DILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELI-----------QLLDN 1009
              L+E+ SR+E  L+    ++ + +  +H   + +L +K+  L            + L +
Sbjct: 1028 ISLNESQSRLEETLTTGAEAITNAVSGTHVGLNGVLDQKAAALAASLTEGQARLEEALGH 1087

Query: 1010 KASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMS 1069
            + + +  AV+     L + L E+  +L+  +D + S F    DS+  L     +++ ++S
Sbjct: 1088 RTAAIIGAVTATHDRLTDTLDEKTMALAISLDDNQSRF----DSV--LEARSNAIMEAVS 1141

Query: 1070 QSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKR----ISQRTQE 1125
             +   ++G      D++       ++   + +      +S V++    R    +   T  
Sbjct: 1142 GAEARVAGAFSDKTDAIRTAYTDNQQRLENALSEHSAALSGVLDTGGARFEDLVGGLTGR 1201

Query: 1126 ISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNIS 1185
            I  +L   +  +     ++ +R+ G +     +   T   LE R      +L+     IS
Sbjct: 1202 IEGRLTDAHTRLGGLADEAAARIEGGLASAHERIRTT---LEDRANAIDLSLNQAHALIS 1258

Query: 1186 RILLDVDHTISSHTNESRSL----IEQRIHEVKDVLSNLDRALE----SYGSTVFKQFKE 1237
              L +   +I +    S  +    +E R   ++  +    + LE    +    +  +F+E
Sbjct: 1259 DTLAEQATSIGTSVATSVGMLELSLEHREAAIRQAIDAGAQTLEDRMHAGAGQIAGRFQE 1318

Query: 1238 YVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAV 1297
              +   ++ +++ +  D++ +S+   F+E  + ++  L+     I D + G   K     
Sbjct: 1319 AARAISSSTQDLSTHLDRSVESLTGRFEETGSRVEAGLAAIETRIRDGVGGVAEK----- 1373

Query: 1298 VNVIDQQIYNA-ANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLH 1356
            V     Q+    A+ + ++ AL     ++I+  +  S+ ++T  I   T +L +  +   
Sbjct: 1374 VEAASGQLSGVLADGVSRIGALSNDATQRISATLEGSAANLTQAIDSRTANLAETLD--- 1430

Query: 1357 QTTNRITETTGHID 1370
               +R T  TG ID
Sbjct: 1431 ---SRTTSLTGAID 1441



 Score =  298 bits (762), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 294/1389 (21%), Positives = 611/1389 (43%), Gaps = 109/1389 (7%)

Query: 323  ISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDK-- 380
            +S   D+L E L S +  +T   D R   + + L     +L N V      L    D+  
Sbjct: 744  VSGTHDRLSETLDSKAAALTTSLDERHARIEDALGTRAEALLNTVSGTRDRLAETLDEKA 803

Query: 381  --VSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCS 438
              ++I+L E   +      +    + N  S     ++ TL+    +   SL E       
Sbjct: 804  MALAISLNEGQARIEDTLETRSAALLNAVSGTHDRLSETLDGKAAAFATSLSEG------ 857

Query: 439  NLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGN 498
               +  +NTL   + R+  L N +++    + ET +      +    +  +  E  L+  
Sbjct: 858  --HARIENTL---ETRSAALLNAVSSTHDRLSETLDEKAMALAISLNETQTRIEDTLETR 912

Query: 499  IDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLE 558
               L    + +H  + +       T+  +L++     ED L  +     +  S   +RL 
Sbjct: 913  SAALLNAVSGTHDRLSETLDEKAMTLAISLNESQSRIEDTLEARSEAFLKAVSGTHDRLS 972

Query: 559  NTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLAR 618
             TL     ++   L E + R+   +  +SE L ++ ++++ ++S  + DR    + SL  
Sbjct: 973  ETLDEKATAIAASLNEGQSRLQDTLESRSESLLNAVSATHDRLSETLDDRAMALAISLNE 1032

Query: 619  VQSHFEETIAGHPQSIVDSISNS---TNNLYD-KIMVLAAALSESQKSLDNSLKAHATDV 674
             QS  EET+    ++I +++S +    N + D K   LAA+L+E Q  L+ +L      +
Sbjct: 1033 SQSRLEETLTTGAEAITNAVSGTHVGLNGVLDQKAAALAASLTEGQARLEEALGHRTAAI 1092

Query: 675  VHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILK 734
            +  +T   ++L +  DE +  +  S + + ++ +++ +   ++  +  +     V+G   
Sbjct: 1093 IGAVTATHDRLTDTLDEKTMALAISLDDNQSRFDSVLEARSNAIMEAVSGAEARVAGAFS 1152

Query: 735  NSTQHIDDLFSNNAKRME-----------ELLHSGSANIESELSAISKAMNKSIDDVET- 782
            + T  I   +++N +R+E            +L +G A  E  +  ++  +   + D  T 
Sbjct: 1153 DKTDAIRTAYTDNQQRLENALSEHSAALSGVLDTGGARFEDLVGGLTGRIEGRLTDAHTR 1212

Query: 783  -----------ISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNAL 831
                       I   L    + + + L + ++ +  SL QA  L+  T A++  S   ++
Sbjct: 1213 LGGLADEAAARIEGGLASAHERIRTTLEDRANAIDLSLNQAHALISDTLAEQATSIGTSV 1272

Query: 832  ADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQ 891
            A +    E +L ++   +   + +  Q L D  ++ A  +A    E              
Sbjct: 1273 ATSVGMLELSLEHREAAIRQAIDAGAQTLEDRMHAGAGQIAGRFQEAA------------ 1320

Query: 892  AMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGA 951
                 IS+S   ++   +  + ++   ++E    ++  L+     +R  + G   K++ A
Sbjct: 1321 ---RAISSSTQDLSTHLDRSVESLTGRFEETGSRVEAGLAAIETRIRDGVGGVAEKVEAA 1377

Query: 952  IGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKA 1011
             G  S     +L +  SRI +L + +   +++TL  S     + +  ++  L + LD++ 
Sbjct: 1378 SGQLS----GVLADGVSRIGALSNDATQRISATLEGSAANLTQAIDSRTANLAETLDSRT 1433

Query: 1012 SCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSI-QTLAQELVSVIGSMSQ 1070
            + L+ A+  +T +L   L    + +   + T   +     D++ +T+  +   +  ++  
Sbjct: 1434 TSLTGAIDGRTASLAETLDRGNERIEERLSTMDRALTVGLDAVNRTIEGKAAGLASTLRS 1493

Query: 1071 STTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVME---------ISEK--RI 1119
            +  D +  +E       + + K  + F +++    DE ++ M+         ++E   R+
Sbjct: 1494 AVADAAQGMEGEATRTTELLGKTGQQFAEDLNVKSDEFTRTMDERSSQIVTRVAEAQNRL 1553

Query: 1120 SQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDS 1179
            + +   ++Q   +  + I N++ ++ + V  ++  IS    +  + LE R     S L  
Sbjct: 1554 ASQAAAVAQTFSEAGNAIVNKVAEAETIVGTQVNAISKVLSDAGQSLETRGNAIRSTLSG 1613

Query: 1180 FSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYV 1239
                IS  + DVD ++ + ++  R+ +E+R  E+    S +DRALE+ G+++    +E  
Sbjct: 1614 AGTEISATMADVDRSLEARSSAIRTNLEERAREIDTTFSEIDRALEARGNSIRSTLEERT 1673

Query: 1240 QCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGA---------- 1289
            +                 +SML     RS  L  IL + +  I D  + A          
Sbjct: 1674 RDL---------------NSML---SGRSVELTRILDETARPIIDRYTDAGEQAAARITA 1715

Query: 1290 --------FHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTII 1341
                       E  A+ + +  +  N ANA+  +E  L+ +V  +  R+++SS  +  ++
Sbjct: 1716 AANLSADRLRAENEALASAVAARTENVANAVSAIENSLVGNVNGLVERMSESSAAMAMMM 1775

Query: 1342 SDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEI 1401
            + A + L  VD RL  TT R  ++      +++ S++L E K+  L +IS  +L Q+  I
Sbjct: 1776 NRAAEQLTSVDGRLGDTTTRFADSATKAAEMVSASTRLLEGKVDRLSDISGQTLAQVGGI 1835

Query: 1402 VSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVD 1461
            + +FD++S++L ++   L  AQS    +L++  + L  L+  LVS+S+E +K +  +   
Sbjct: 1836 IGRFDEHSKVLTQASQLLGAAQSNLASTLEERESALQTLSVGLVSRSAEIEKTMQGLGSM 1895

Query: 1462 VKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTV 1521
            ++ + E+A+  S+ V  N+   +QSSF  I   L+  E R+++    +   +   G++  
Sbjct: 1896 IETVFERAEQRSNQVTGNLRQGVQSSFADIGRILTETEKRAQEAAETMREAITRAGDEAN 1955

Query: 1522 KTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDS 1581
             TID  F  ++ +S DLSN +R  + +++  ++ +       SD + Q   ++L   +D 
Sbjct: 1956 TTIDGTFANVERRSGDLSNRIRGGLTASLSEVDRMLGEAGRASDGAAQHMREALREAIDD 2015

Query: 1582 FTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLK 1641
               + S  ++DI  ++  I  +L+ +R  LKR +  L +EAKESA  +R A+ EQI  L+
Sbjct: 2016 AVGRFSGATEDIRRSAADIRNELDATRAELKRGAFDLPEEAKESASAMRRAVAEQIKALQ 2075

Query: 1642 DFQKLITDS 1650
            D  +L+  S
Sbjct: 2076 DISQLVGRS 2084



 Score =  123 bits (309), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 80/108 (74%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +   R
Sbjct: 2222 SLNSLSVDIARAIDHDASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFR 2281

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI +FE++L+++A+++ +  + Q ++ S+ GKVYTML HA+GR
Sbjct: 2282 TAVDRYIGDFEKLLADVARTDPNRTVTQSYLTSDTGKVYTMLAHAAGR 2329


>gi|116252400|ref|YP_768238.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257048|emb|CAK08142.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
            3841]
          Length = 2375

 Score =  379 bits (973), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 372/1685 (22%), Positives = 756/1685 (44%), Gaps = 201/1685 (11%)

Query: 5    KENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLSKNFKQ 64
            K+N  + R    +  E + SD    + +    +  + SRR  + E   R           
Sbjct: 28   KDNVPSRRGDAPQAPEANVSDPVNARNQQAQEEAQRRSRRGAAGEQASR----------- 76

Query: 65   ASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYT 124
                     F PAND        IL++    S   A+R A + S++W+   LG +   Y 
Sbjct: 77   ------GPAFAPANDASRNTPASILKSFDGASSRSAVRTATLFSVLWVMAGLGLMSLLY- 129

Query: 125  NSP----MDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIAL 180
             +P    + S  D    P VI   LV  ++P+++F++F IMISRA+DM +A++S+A +AL
Sbjct: 130  -APQIWQIRSLADLVALPGVIA-GLVGIIIPVMMFYAFAIMISRAQDMRNAARSMAEVAL 187

Query: 181  RLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSE 240
            RL +PE  +SE++ ++  AVR+E+  M E I+R I+RASELE  V SE+  LE +Y  +E
Sbjct: 188  RLAEPETIASERIMTVGQAVRREVSAMNEGIERTIARASELETLVHSEVNALERSYADNE 247

Query: 241  MRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSI 300
            +R+  +   L  EREAI+NH  ++ TSI  VH+ LKEELSL +EEI+V L+ + ++F S+
Sbjct: 248  LRVRGLVHELGSEREAIVNHADRIRTSIGSVHDQLKEELSLATEEIAVRLATSGEAFASL 307

Query: 301  VDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSG 360
            +D R A + EK+   +Q     +++K D LL+ L+++   +  +FDNR+E+LS  LN+ G
Sbjct: 308  IDTRAATILEKSDSALQSMGSLLAAKTDTLLQTLNASGFALATEFDNRLEALSVNLNDHG 367

Query: 361  RSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLND 420
              L +Q       + ++T+K++ AL E++ Q  +   +   E++   +  +++I  TL+D
Sbjct: 368  ERLLSQFETRASTMDSSTEKLNAALNERTHQLNEILIARTREINESLTSGERTIGGTLDD 427

Query: 421  VLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDF 480
            VL  L  +L EK  SF  +L++T D+ + ++D R+   E R+   + ++   F+  +++F
Sbjct: 428  VLSKLNNALDEKGASFRQSLQTTADDAVMDLDVRSGFFEERLQTTVAQLSTAFDERVSEF 487

Query: 481  SSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILS 540
            +S +       ++ L  ++ ++         +++ +  S I  +GS++  ++L     L+
Sbjct: 488  TSAFDKRTGSLDTKLMESLARINETLTGGSDSIDGILNSGIDRLGSSMTDQSLALATALA 547

Query: 541  KKQ--------NNISQITSMNTER--------------LENTLTNSINSLKDMLEEKR-- 576
                       N   +IT+  T R              +  TL    + L++ L+ +   
Sbjct: 548  TGHEVLESTLGNRADEITTALTSRTGELTSALQSATSEIALTLATGTSELQNNLQTRSAE 607

Query: 577  --------------------QRIDSDIGKKSEELCS-----------SFNSSYQKVSNVI 605
                                +++ +  G ++EEL             +  +++ ++ +V+
Sbjct: 608  FRDTLRTTTTDLTTAVAAGTEQVTTAFGGRAEELSGVLAARAAEISEALGTAHGRIDSVM 667

Query: 606  SDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLY----DKIMVLAAALSESQK 661
            ++R      +L      FEE +     +I++++S++ + L     +K M LA +L+ESQ 
Sbjct: 668  AERGGALVEALTTHHGRFEEALTTRSDAIINAVSDTHDRLAETLDEKSMALAISLNESQA 727

Query: 662  SLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDT 721
             ++++L+  +   ++ ++   ++L    DE +  +  S + +  ++E   +    +F + 
Sbjct: 728  RIEDTLETRSEAFLNAVSGTHHRLSETLDEKAMALAISLSENQARIEDTLETRSEAFLNA 787

Query: 722  FNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDD-V 780
             +   D +S  L +    +         R+E+ L + +  + + +S     + +++D+  
Sbjct: 788  VSGTHDRLSETLDSKAAALTTSLDERHARIEDALGTRAEALLNTVSGTRDRLAETLDEKA 847

Query: 781  ETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFEN 840
              ++ +L E    +   L   S  +L+++    + L  T   +  +F  +L++ Q++ EN
Sbjct: 848  MALAMSLNESHARIEETLETRSAALLNAVSGTHDRLSETLDGKAAAFATSLSEGQARIEN 907

Query: 841  NLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISAS 900
             L ++S  LL+  S    +L++    KA+ +A SL E Q  +  TLE  S A+L  +S +
Sbjct: 908  TLESRSAALLNAASGIHDRLSETLDEKAMALAISLNETQTRIEDTLETRSAALLNAVSGT 967

Query: 901  NTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIR 960
            +  +++T +E    + +S +E++  ++  L    +   + ++G+ +++            
Sbjct: 968  HDRLSETLDEKAMTLAISLNESQSRIEDTLEARSEAFLKAVSGTHDRLS----------- 1016

Query: 961  DILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST 1020
            + LDE ++ I + L+   + +  TL    + F   +    D L + LD++A  L+ +++ 
Sbjct: 1017 ETLDEKATAIAASLNEGQSRLQDTLESRSESFLNAVSATHDRLSETLDDRAMALAISLNE 1076

Query: 1021 QTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLE 1080
                LE  L     +++  V  +      + D      Q+  ++  S+S+       +LE
Sbjct: 1077 SQSRLEETLTTGADAITNAVSGTHVGLNGVLD------QKAAALATSLSEG----QARLE 1126

Query: 1081 ISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQ 1140
             +L      I        D +   +DE +  + IS   +          L   ++ I   
Sbjct: 1127 EALGHRTAAIIGAVTATHDRLTDTLDEKTMALAIS---LDDNQSRFDSVLEARSNAIMEA 1183

Query: 1141 IIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTN 1200
            +  + +RV G   D ++  I T                +++DN  R+    ++ +S H+ 
Sbjct: 1184 VSGAEARVAGAFSDKTDA-IRT----------------AYTDNQQRL----ENALSEHSA 1222

Query: 1201 ESRSLIEQRIHEVKDVLSNLDRALES--------YGSTVFKQFKEYVQCFETNMENMESL 1252
                +++   +  +D++  L   +E          G    +          +  E + + 
Sbjct: 1223 ALSGVLDAGGNRFEDLVGGLTGRIEGRLTDAHTRLGGLADEAAARIEGGLASAHERIRTT 1282

Query: 1253 FDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAF--------HKEGNAVVNVIDQQ 1304
             +   +++ LS  +   ++ + L++++  I  S++ +         H+E  A+   ID  
Sbjct: 1283 LEDRANAIDLSLNQAHALISDTLAEQATSIGTSVATSVGMLELSLEHREA-AIRQAIDAG 1341

Query: 1305 IYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITE 1364
                 + +      +    ++  N I+ S+QD +  +  + +SL          T R  E
Sbjct: 1342 AQTLEDRMHAGAGQIAGRFQEAANAISSSTQDFSAHLDRSVESL----------TGRFEE 1391

Query: 1365 TTGHIDTVLAESSKLFEKKIKD-LGEIS-RVSLL--QMSEIVSKFDKNSQILIKSHDSLM 1420
            T   ++  LA      E +I+D +G ++ RV     Q+S +++  D  S+I   S D+  
Sbjct: 1392 TGARVEAGLA----AIETRIRDGVGGVAERVEAASGQLSGVLA--DGVSRIGALSDDATQ 1445

Query: 1421 KAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNM 1480
            +  +    +L+  A NL                      +D  +    A+ L D+   ++
Sbjct: 1446 RISA----TLEGSAANLTQ-------------------AID-NRTANLAETL-DSRTTSL 1480

Query: 1481 TDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSN 1540
            TD+I      +  TL     R  + +  +D  L  +G + V        T++ K+  L++
Sbjct: 1481 TDAIDGRTASLGETLDRGNERIEERLSTMDRALT-VGLEAVNR------TIEGKAAGLAS 1533

Query: 1541 HMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
             +R  +      +E   +   E   ++ Q F + LN K D FT+ + + S  I     R+
Sbjct: 1534 TLRSAVADAAQGMEGEATRTTELLGKTGQQFAEDLNTKSDEFTRTMDERSSQIVT---RV 1590

Query: 1601 AEDLN 1605
            AE  N
Sbjct: 1591 AEAQN 1595



 Score =  293 bits (749), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 308/1391 (22%), Positives = 613/1391 (44%), Gaps = 113/1391 (8%)

Query: 323  ISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVS 382
            +S   D+L E L S +  +T   D R   + + L     +L N V      L    D+ +
Sbjct: 788  VSGTHDRLSETLDSKAAALTTSLDERHARIEDALGTRAEALLNTVSGTRDRLAETLDEKA 847

Query: 383  IALK----EQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCS 438
            +AL     E   +  +   +    + N  S     ++ TL+    +   SL E       
Sbjct: 848  MALAMSLNESHARIEETLETRSAALLNAVSGTHDRLSETLDGKAAAFATSLSEG------ 901

Query: 439  NLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGN 498
              ++  +NTL   ++R+  L N  +     + ET +      +    +  +  E  L+  
Sbjct: 902  --QARIENTL---ESRSAALLNAASGIHDRLSETLDEKAMALAISLNETQTRIEDTLETR 956

Query: 499  IDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLE 558
               L    + +H  + +       T+  +L++     ED L  +     +  S   +RL 
Sbjct: 957  SAALLNAVSGTHDRLSETLDEKAMTLAISLNESQSRIEDTLEARSEAFLKAVSGTHDRLS 1016

Query: 559  NTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLAR 618
             TL     ++   L E + R+   +  +SE   ++ ++++ ++S  + DR    + SL  
Sbjct: 1017 ETLDEKATAIAASLNEGQSRLQDTLESRSESFLNAVSATHDRLSETLDDRAMALAISLNE 1076

Query: 619  VQSHFEETIAGHPQSIVDSISNS---TNNLYD-KIMVLAAALSESQKSLDNSLKAHATDV 674
             QS  EET+     +I +++S +    N + D K   LA +LSE Q  L+ +L      +
Sbjct: 1077 SQSRLEETLTTGADAITNAVSGTHVGLNGVLDQKAAALATSLSEGQARLEEALGHRTAAI 1136

Query: 675  VHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILK 734
            +  +T   ++L +  DE +  +  S + + ++ +++ +   ++  +  +     V+G   
Sbjct: 1137 IGAVTATHDRLTDTLDEKTMALAISLDDNQSRFDSVLEARSNAIMEAVSGAEARVAGAFS 1196

Query: 735  NSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQEL 794
            + T  I   +++N +R+E  L   SA +   L A     N+  D V  ++  ++ R  + 
Sbjct: 1197 DKTDAIRTAYTDNQQRLENALSEHSAALSGVLDA---GGNRFEDLVGGLTGRIEGRLTDA 1253

Query: 795  GSDLVNHSD----KVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLL 850
             + L   +D    ++   L  A E + TT   R ++   +L            NQ+H L+
Sbjct: 1254 HTRLGGLADEAAARIEGGLASAHERIRTTLEDRANAIDLSL------------NQAHALI 1301

Query: 851  -DKLSSDIQKLTDIAYSKAIDVAN---SLTEIQGNVGVTLENHSQAMLEKISASNTLVAK 906
             D L+   ++ T I  S A  V     SL   +  +   ++  +Q + +++ A    +A 
Sbjct: 1302 SDTLA---EQATSIGTSVATSVGMLELSLEHREAAIRQAIDAGAQTLEDRMHAGAGQIAG 1358

Query: 907  TFEECMSNILLS-------YDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIG------ 953
             F+E  + I  S        D + ++L  +  +    +   LA  E +I   +G      
Sbjct: 1359 RFQEAANAISSSTQDFSAHLDRSVESLTGRFEETGARVEAGLAAIETRIRDGVGGVAERV 1418

Query: 954  -SASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKAS 1012
             +AS  +  +L +  SRI +L   +   +++TL  S     + +  ++  L + LD++ +
Sbjct: 1419 EAASGQLSGVLADGVSRIGALSDDATQRISATLEGSAANLTQAIDNRTANLAETLDSRTT 1478

Query: 1013 CLSTAVSTQTINLENNLKEQ----EKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSM 1068
             L+ A+  +T +L   L       E+ LS +        + ++ +I+  A  L S + S 
Sbjct: 1479 SLTDAIDGRTASLGETLDRGNERIEERLSTMDRALTVGLEAVNRTIEGKAAGLASTLRS- 1537

Query: 1069 SQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVME---------ISEK-- 1117
              +  D +  +E       + + K  + F +++    DE ++ M+         ++E   
Sbjct: 1538 --AVADAAQGMEGEATRTTELLGKTGQQFAEDLNTKSDEFTRTMDERSSQIVTRVAEAQN 1595

Query: 1118 RISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSAL 1177
            R++ +   ++Q   +  + I N++ ++ + V  ++  IS    +  + LE R     S L
Sbjct: 1596 RLASQAAAVAQTFSEAGNAIVNKVAEAETIVGTQVNAISKVLSDAGQSLETRGNAIRSTL 1655

Query: 1178 DSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKE 1237
                  IS  + DVD  + + ++  R+ +E+R  E+    S++DRALE+ G+++    +E
Sbjct: 1656 SGAGSEISATMADVDRALEARSSAIRTNLEERAREIDTTFSDIDRALEARGNSIRSTLEE 1715

Query: 1238 YVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGA-------- 1289
              +                 +SML     RS  L  IL + +  I D  + A        
Sbjct: 1716 RTRDL---------------NSML---SGRSVELTRILDETARPIIDRYTDAGEQAAARI 1757

Query: 1290 ----------FHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTT 1339
                         E  A+ + +  +  N ANA+  +E  L+ +V  +  R+++SS  +  
Sbjct: 1758 TAAANLSADRLRAENEALASAVAARTENVANAVSAIENSLVGNVNGLVERMSESSAAMAM 1817

Query: 1340 IISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMS 1399
            +++ A + L  VD RL  TT R  ++      +++ S++L E K+  L +IS  +L Q+ 
Sbjct: 1818 MMNRAAEQLASVDGRLGDTTTRFADSATKAAEMVSASTRLLEGKVDRLSDISGQTLAQVG 1877

Query: 1400 EIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSIL 1459
             I+ +FD++S++L ++   L  AQS    +L++  + L  L+  LV +S+E +K +  + 
Sbjct: 1878 GIIGRFDEHSKVLTQASQLLGAAQSNLASTLEERESALQTLSVGLVQRSAEIEKTMQGLG 1937

Query: 1460 VDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNK 1519
              ++ + E+A+  S  V  N+   +QSSF  I   L+  E R+++    +   +   G++
Sbjct: 1938 GMIETVFERAEQRSAQVTGNLRQGVQSSFADIGRILTETEKRAQEAAETMREAITRAGDE 1997

Query: 1520 TVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKV 1579
               TID  F  ++ +S DLSN +R  + +++  +E +       SD + Q   ++L   +
Sbjct: 1998 ANTTIDGTFANVERRSGDLSNRIRGGLTASLSEVERMLGEAGRASDGAAQNMREALREAI 2057

Query: 1580 DSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINT 1639
            D    + S  ++DI  ++  I  +L+ +R  LKR +  L +EAKESA  +R A+ EQI  
Sbjct: 2058 DDAVGRFSGATEDIRRSAADIRSELDATRAELKRGAFDLPEEAKESASAMRRAVAEQIKA 2117

Query: 1640 LKDFQKLITDS 1650
            L+D  +L+  S
Sbjct: 2118 LQDISQLVGRS 2128



 Score =  123 bits (309), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 80/108 (74%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +   R
Sbjct: 2266 SLNSLSVDIARAIDHDASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFR 2325

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI +FE++L+++A+++ +  + Q ++ S+ GKVYTML HA+GR
Sbjct: 2326 TAVDRYIGDFEKLLADVARTDPNRTVTQSYLTSDTGKVYTMLAHAAGR 2373


>gi|325292707|ref|YP_004278571.1| hypothetical protein AGROH133_05796 [Agrobacterium sp. H13-3]
 gi|325060560|gb|ADY64251.1| hypothetical protein AGROH133_05796 [Agrobacterium sp. H13-3]
          Length = 2183

 Score =  340 bits (871), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 315/1345 (23%), Positives = 636/1345 (47%), Gaps = 137/1345 (10%)

Query: 74   FYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNS--PMDSF 131
               AND        IL+++   S+  ALRNA + S+IW    LG     Y ++   + S 
Sbjct: 72   LEAANDGSKRSPAMILKSLEGGSIGGALRNATIMSVIWALGGLGIAHLIYGSALWNIGSV 131

Query: 132  YDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSE 191
             D A  P ++ + + + VVPI+LFF+F IM++RARD+ +A++S+A +ALRL +PE  +S+
Sbjct: 132  ADLAAIPGLMAIVVGI-VVPIMLFFAFAIMMARARDLRNAARSMAEVALRLAEPETVASD 190

Query: 192  KMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLK 251
            ++ S+  AVR+E+  M + I+R I+RA+ELE  V SE+  LE +Y  +E+R+ ++ Q L 
Sbjct: 191  RIMSVGQAVRREVSAMNDGIERTIARATELETLVHSEVNALERSYADNELRVRSLVQELS 250

Query: 252  QEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEK 311
             ER+AI+NH  ++ +SI    E +KEELS+  EE+S+ LS   ++F S++D R A + EK
Sbjct: 251  AERDAIVNHAERIRSSIVGAQEQIKEELSIVGEELSMRLSTTGEAFASMIDTRSAALLEK 310

Query: 312  TTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYT 371
            +    +     I++K + LL+ L+S+   ++ +FD R+ +L++TL+  G  L  +   + 
Sbjct: 311  SRASTEAMGSLIAAKTENLLQALNSSGATLSSEFDMRLHNLTSTLDERGEVLLERFAIHA 370

Query: 372  LMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQE 431
              L +  + ++ AL+E+++Q  +  ++   E++      Q+ I  +L++VL  L  +L+E
Sbjct: 371  STLDSGAESLNSALEERTRQLNETLSTRTLELNRNIDRGQQIIGGSLDNVLDKLSTTLEE 430

Query: 432  KEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEF 491
            K  SF  +L+ST D+ + ++D R+   E R+ A + ++   F+  + DF+S +       
Sbjct: 431  KGLSFRQSLQSTADDAIMDLDLRSGLYEERLQATVGQVNSAFDEHVADFASAFDQRAGSL 490

Query: 492  ESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITS 551
            +S L  ++ ++    A     ++ +  S ++ IG+ +  ++L     L   Q        
Sbjct: 491  DSKLMESLARINETVAGGSEALDTMLTSGLERIGNTMTDQSLALATALGTGQ-------- 542

Query: 552  MNTERLENTLTNSINSLKDMLEEKRQRIDSD-IGKKSEELCSSFNSSYQKVSNVISDREK 610
               E LE+ L            E R R  SD IG+++ E+  +F +S++K+  V+++R  
Sbjct: 543  ---EMLESAL------------ETRTRAFSDAIGQRTAEITDAFANSHEKIDGVLAERSN 587

Query: 611  LFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAAL----SESQKSLDNS 666
                +L+  Q  F+E +A    +I  S+S +   L   +   AAA+    ++ ++ L  +
Sbjct: 588  ALFGALSASQDRFDEALASRSLAITGSVSGTAERLAAMLEERAAAINSVVADVERRLSET 647

Query: 667  LKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKS 726
            L+  A  +   ++  E+++ +  +  +  +    + + N++         + +   +   
Sbjct: 648  LETRAAAITGAVSGIEDRISDTLESRTAALHDVVSGAENRIAETLDGRTAALSSAISGVE 707

Query: 727  DHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTA 786
            + ++  + + T  +D  F+N  +R+ E L     N  S LS I  +        E I+ A
Sbjct: 708  ERIADTMDSRTLSLDMTFANVEERLSETLD----NRTSALSGIVASAE------ERIAGA 757

Query: 787  LKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQS 846
            L  R    G  +     ++  +L                       D ++   N +V+ +
Sbjct: 758  LDSRTSTFGDVVAGAESRIAETL-----------------------DGRTAALNAVVSGA 794

Query: 847  -HLLLDKLSSDIQKLTDIAYSKA----IDVANSLTEIQGNVGVTLENHSQAMLEKISASN 901
               + D L S    L D+A+S A     +  ++ T + G +    E      L+  +A+ 
Sbjct: 795  EERIADALDSRTMAL-DMAFSGAEEKITEALDTRTAVLGELVAGAETRIAETLDGRTAAL 853

Query: 902  TLVAKTFEECMSNIL----LSYDENRQTLDKKLSDHID----VLRQNLAGSENKIDGAIG 953
              V    E+ +++ L    +++D      ++K+++ +D    VL + +AG+E +I  A+ 
Sbjct: 854  NAVVSGVEDRIADALDSRTMAFDMAFSGAEEKITEALDTRTAVLGELVAGAETRIASALD 913

Query: 954  SASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASC 1013
            S +  +++++     RI  +L     +++ +     +K           +  +LD + + 
Sbjct: 914  SRTASLKNVVSGAEERITDVLDSRTMALDLSFSGIEEK-----------IADILDGRTAA 962

Query: 1014 LSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSI--QTLAQELV--SVIGSMS 1069
            L +AVS     + + L  +  +LS +V   +S+ + ++D++  +T+A ++    V   +S
Sbjct: 963  LHSAVSGVEDRIADALDSRTAALSGIV---SSAEERIADALDSRTMALDMTISGVEERIS 1019

Query: 1070 QSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQ 1129
            ++    +  L ++   V Q+++    F  +N +A   E  + M      +  + + I+  
Sbjct: 1020 EAMDARTASLSLAAAGVGQRLEST-AFTLENALASGHERLETM------LGSQAERIAGS 1072

Query: 1130 LLQNNDVITNQIIDSTSRVRGEIVDISNKFIET-----SRV---LEQREEKFHSALDSFS 1181
            L +N+ +I   +  + SR+   + D S++F +T     SR+   L Q  E   +AL+   
Sbjct: 1073 LERNSGLIEQSVSGAASRIESVVEDGSSRFAQTVEEGVSRLENNLSQSHEDIRTALEQRQ 1132

Query: 1182 DNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQC 1241
                    D+  T+SS T            ++ D+LS  ++A+   G+TV          
Sbjct: 1133 -------ADIAATLSSATT-----------QMGDMLS--EQAM-MIGTTVASSASMLELS 1171

Query: 1242 FETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEI---SDSISGAFHKEGNAVV 1298
             ET  E ++   D +  ++    +  +  +   + + + EI   +D++S         V 
Sbjct: 1172 LETQQETLQKAIDGSAATLEQRLRNSAGDIAVKIGEAAREIGGATDALSSRIETSIGTVT 1231

Query: 1299 NVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKV-DERLHQ 1357
              +D+       +L  L+  + SD+  +   I D+ +     + D T +  +  D+   +
Sbjct: 1232 GRLDETGTRIETSLGALQERVSSDLGNVNTSIEDAGRRFADALEDKTAAFARTSDDAAQR 1291

Query: 1358 TTNRITETTGHI-DTVLAESSKLFE 1381
             T  + E T  + DT  + +S+L E
Sbjct: 1292 ITGILDEQTIRVADTFESRTSRLAE 1316



 Score =  211 bits (537), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 294/1441 (20%), Positives = 596/1441 (41%), Gaps = 198/1441 (13%)

Query: 323  ISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVS 382
            +S+  D+  E L S S+ IT       E L+  L     ++ + V +           V 
Sbjct: 593  LSASQDRFDEALASRSLAITGSVSGTAERLAAMLEERAAAINSVVAD-----------VE 641

Query: 383  IALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKS 442
              L E  +    A T  +  + +  S+  +S T  L+DV+                   S
Sbjct: 642  RRLSETLETRAAAITGAVSGIEDRISDTLESRTAALHDVV-------------------S 682

Query: 443  TTDNTLRE-VDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDK 501
              +N + E +D RT  L + I+   + I +T ++        + +        L      
Sbjct: 683  GAENRIAETLDGRTAALSSAISGVEERIADTMDSRTLSLDMTFANVEERLSETLDNRTSA 742

Query: 502  LQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTL 561
            L G  A +            + I   LD +T  F D+++  ++ I++           TL
Sbjct: 743  LSGIVASAE-----------ERIAGALDSRTSTFGDVVAGAESRIAE-----------TL 780

Query: 562  TNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQS 621
                 +L  ++    +RI   +  ++  L  +F+ + +K++  +  R  +    +A  ++
Sbjct: 781  DGRTAALNAVVSGAEERIADALDSRTMALDMAFSGAEEKITEALDTRTAVLGELVAGAET 840

Query: 622  HFEETIAGHPQSIVDSISNSTNNLYD----KIMVLAAALSESQKSLDNSLKAHATDVVHK 677
               ET+ G   ++   +S   + + D    + M    A S +++ +  +L      +   
Sbjct: 841  RIAETLDGRTAALNAVVSGVEDRIADALDSRTMAFDMAFSGAEEKITEALDTRTAVLGEL 900

Query: 678  ITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNST 737
            +  AE ++ +  D  + ++    + +  ++  +      + + +F+   + ++ IL   T
Sbjct: 901  VAGAETRIASALDSRTASLKNVVSGAEERITDVLDSRTMALDLSFSGIEEKIADILDGRT 960

Query: 738  QHIDDLFSNNAKRMEELLHSGSA-----------NIESELSAISKAMNKSIDDVE-TIST 785
              +    S    R+ + L S +A            I   L + + A++ +I  VE  IS 
Sbjct: 961  AALHSAVSGVEDRIADALDSRTAALSGIVSSAEERIADALDSRTMALDMTISGVEERISE 1020

Query: 786  ALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQ 845
            A+  R   L           L++    Q L  T F     +  NALA    + E  L +Q
Sbjct: 1021 AMDARTASLS----------LAAAGVGQRLESTAF-----TLENALASGHERLETMLGSQ 1065

Query: 846  SHLLLDKL--------------SSDIQKLTDIAYSKAI-------------------DVA 872
            +  +   L              +S I+ + +   S+                     D+ 
Sbjct: 1066 AERIAGSLERNSGLIEQSVSGAASRIESVVEDGSSRFAQTVEEGVSRLENNLSQSHEDIR 1125

Query: 873  NSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSD 932
             +L + Q ++  TL + +  M + +S    ++  T     S + LS +  ++TL K +  
Sbjct: 1126 TALEQRQADIAATLSSATTQMGDMLSEQAMMIGTTVASSASMLELSLETQQETLQKAIDG 1185

Query: 933  HIDVLRQNLAGSENKIDGAIGSASQFIRDI------------------LDENSSRIESLL 974
                L Q L  S   I   IG A++ I                     LDE  +RIE+ L
Sbjct: 1186 SAATLEQRLRNSAGDIAVKIGEAAREIGGATDALSSRIETSIGTVTGRLDETGTRIETSL 1245

Query: 975  SCSN-------NSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLEN 1027
                        +VN+++  + ++F   L++K+    +  D+ A  ++  +  QTI + +
Sbjct: 1246 GALQERVSSDLGNVNTSIEDAGRRFADALEDKTAAFARTSDDAAQRITGILDEQTIRVAD 1305

Query: 1028 NLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELV--------SVIGSMSQSTTDISGKL 1079
                 E   SR+ +T  +    + + + T+ + L         ++ G  S+    + G +
Sbjct: 1306 TF---ESRTSRLAETFDAGSARIDERLGTMDRALTIGLENVNRTIEGKASELAVGLRGAV 1362

Query: 1080 EISLDSVNQK-------IQKCREFFGDNIVAFMDEISKVME---------IS--EKRISQ 1121
              +  S++++       + K    F + + A  D  +K +E         IS  + R+S 
Sbjct: 1363 ISATQSIDEEAVRSTALLAKTGSEFAEQVQAQNDAFTKAIEERSGEIVNRISDAQTRLSG 1422

Query: 1122 RTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFS 1181
            +   ++Q   +  ++I N++ ++ + VR ++  IS         L+ R E   SALD   
Sbjct: 1423 QAAAVAQTFSEAGNIIVNKVAEAEAVVRSQVGVISETLTGVESALDARGESIRSALD--- 1479

Query: 1182 DNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQC 1241
             N +R   +++  ++S + E   LIE++   V D  + + R       +  +Q  E +  
Sbjct: 1480 -NRTR---ELNSMLASRSAELSRLIEEKAKPVVDEYATIGREAAEKIVSAAQQSAELLSQ 1535

Query: 1242 FETNMENM--ESLFDKNND-----SMLLSFKERSNILDNILSQRSMEISDSISGA---FH 1291
              + M  M  +++ D  N      S L++   +S    ++LSQ    ++D++      + 
Sbjct: 1536 SNSGMVGMVEQAISDYANAGSEAASKLVAATRQST---DMLSQTHTAMADAVEEGIDKYT 1592

Query: 1292 KEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKV 1351
            + G+ V N +      + + L +    +   VEK       S+ +  + +  A       
Sbjct: 1593 RTGSDVANKLVAATRQSTDMLSQTHNSMAEIVEK-------SANNFNSAVERAAQEFGTA 1645

Query: 1352 DERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQI 1411
            DE L+ +  R +E+      +++ SS+L E KI  L  IS  +L Q++ IV +F+++S++
Sbjct: 1646 DEALNASATRFSESALQAADMVSSSSRLLEGKIDRLSNISGQTLAQVAGIVGRFEEHSKV 1705

Query: 1412 LIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADF 1471
            L ++ + L  AQS    +L++  + L  L+  LV +S E +  +  ++  V+  + +A+ 
Sbjct: 1706 LSQASELLNAAQSSLVGTLEERQDALRSLSVGLVKRSEEIETAMRGVVSVVETTLNEAEE 1765

Query: 1472 LSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTL 1531
             S  V  N+ D++Q+SF  I  +L   E R+R   + +   L   G    ++I+S     
Sbjct: 1766 RSQNVAGNLRDNLQASFSDIGRSLDETEQRARSAAQTMRGALLAAGQDASRSIESTLSDA 1825

Query: 1532 KEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSD 1591
            ++ S +L N +R  + S++  ++N+  +  EKS+ +     ++L   V+    + +  +D
Sbjct: 1826 QKYSDELVNRLRGGVESSLSEVDNLLGSASEKSNAAAANLKETLRQAVEEAVSRFAGATD 1885

Query: 1592 DIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSV 1651
            +I  +S  I  +L+ +R  LKR +  L +EAKESA  +R A+ EQI  L+D  +L+  S 
Sbjct: 1886 EIRRSSHDIRRELDATRAELKRGAFDLPEEAKESAAAMRRAVSEQIKALQDISQLVGRST 1945

Query: 1652 K 1652
            +
Sbjct: 1946 Q 1946


>gi|222148654|ref|YP_002549611.1| hypothetical protein Avi_2239 [Agrobacterium vitis S4]
 gi|221735640|gb|ACM36603.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 2252

 Score =  339 bits (869), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 321/1375 (23%), Positives = 626/1375 (45%), Gaps = 152/1375 (11%)

Query: 74   FYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYD 133
              PAND      + +L+++   S+  ALRNA + S++W A  L      Y  S + S   
Sbjct: 103  LAPANDASRRSSSAVLKSLDAGSMGGALRNATIVSILWGAGGLALSQLLY-GSQIWSGGA 161

Query: 134  FAM--RPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSE 191
             A+   P +I + LV +V+PI +FFSF IM+SRA+DM +A++S+A +ALRL +PE  +SE
Sbjct: 162  AAIFANPGIIAI-LVGTVLPIFVFFSFAIMMSRAQDMRNAARSMAEVALRLSEPETVASE 220

Query: 192  KMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLK 251
            ++ S+  AVR+E+  M E I+R I+RA+ELE  V SE+  LE +YT +E+R+ ++ Q L 
Sbjct: 221  RIMSVGQAVRREVSAMNEGIERTIARATELETLVHSEVTALERSYTDNELRVRSLVQELS 280

Query: 252  QEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEK 311
             ER+AI+NH  ++ +SI   H+ LKE+LSL +EEI + L+ + ++F S++D+R A + EK
Sbjct: 281  AERDAIVNHADRIRSSIVGAHDQLKEDLSLATEEIGIRLATSGEAFASMIDMRAATIMEK 340

Query: 312  TTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYT 371
            +          +++K D++++ L +    ++ +FDNR+++L+ +++  G  +  Q     
Sbjct: 341  SNTAATTLGSLLTAKTDEMVQTLGAAGFSLSSEFDNRLQALTGSMSTHGEEILRQFETRA 400

Query: 372  LMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQE 431
              L  NT+K++ AL ++++Q  +   +   E++  F++ + SI+ +L+  L  L  SL+E
Sbjct: 401  STLDANTEKLNAALNDRARQLNETLVARTREIAQSFTQGEASISGSLDSALTRLNTSLEE 460

Query: 432  KEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEF 491
            K  SF  +L++  ++ L ++D R+   E+R+ A + +I  TF++ +T+F++ +       
Sbjct: 461  KSVSFRQSLQTNAEDALVDIDIRSGLFEDRMQATIGQINATFDDRMTEFATAFDQRAGTL 520

Query: 492  ESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITS 551
            +S L  ++ ++    A     ++ +  ++I  +G+ +  ++      L            
Sbjct: 521  DSKLNESLLRINETMAGGSETIDGILTTSIDRLGNTMTDQSFALAATLGG---------- 570

Query: 552  MNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKL 611
             N E L   L++    L D LE +R+ +D  I           +++  ++  ++++R   
Sbjct: 571  -NQEALTEALSSHSRELADALERRRRELDETI-----------SNAQSRIDQIMAERGTA 618

Query: 612  FSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIM----VLAAALSESQKSLDNSL 667
             + +L   Q+ F+ET+    +++++ ++ S + + D +      +  A++ S+  L N+L
Sbjct: 619  LTEALNTSQTRFDETLGSRSEAVINQLTGSHDRISDLLQNASSGIVEAVTSSETRLANTL 678

Query: 668  KAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDT------ 721
               A  ++     A+ ++     + +  I  +Y +++ +L ++    +     T      
Sbjct: 679  DRKAQTIIEAADGADARIEAALSDKADAIRAAYETNHERLTSVLDAKVEQLEQTALAVDS 738

Query: 722  -----FNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKS 776
                 F NK+D +    + S   +         ++ +        IE  L      +   
Sbjct: 739  RVEAAFGNKADAIRAAYEESEARLTRTLDGKVDQITDAATEADMRIELALGNRMDTIRAV 798

Query: 777  IDDVE-----TISTALKERCQELGS-------DLVNHSDKVLSSLKQAQELLCTTFAQRN 824
             +D E     TI   L    + LG+            +D+VLS+ +Q++  L  T   + 
Sbjct: 799  YEDSESRLASTIDAKLGALTETLGNADNRIEQAFGTKADQVLSAYEQSEARLARTLDSKI 858

Query: 825  DSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVA-NSLTEIQGNVG 883
            D   +A +D   + E  L N+    +D + + + + ++   S  ID    +LTE  GN  
Sbjct: 859  DQISDAASDADMRIELALGNR----MDTIRA-VYEESESRLSNTIDAKLGALTETLGNAD 913

Query: 884  VTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAG 943
            V +E                  + F      +L +Y+++   L + L   I+ +    + 
Sbjct: 914  VRIE------------------QAFGTKADQVLSAYEQSEARLARTLDSKIEQISDAASD 955

Query: 944  SENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDE- 1002
            ++ +I+ A+G+    IR + +E+ +R+   +     ++  TL  +  + ++    K+D+ 
Sbjct: 956  ADMRIELALGNRMDTIRAVYEESETRLSGTIDAKLGALTETLGTADSRIEQAFGSKADQL 1015

Query: 1003 ----------LIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSD 1052
                      L Q LD+K   LS   +   + +E  L  +  S+  V + S +      D
Sbjct: 1016 RAVYEEGQARLTQTLDSKVDQLSDVAAEADMRIEFALGSKVDSIRSVYEDSEARLAGTID 1075

Query: 1053 S-----IQTLA-------QELVSVIGSMSQSTTDISGKLEISLDS-VNQKIQKCREFFGD 1099
            +     I+T+        Q L S    + ++     G+L   LDS +NQ +    E    
Sbjct: 1076 AKLGQLIETVGFADSRVQQALGSKADQIREAYEANHGRLAEMLDSRINQVMDTATEADLR 1135

Query: 1100 NIVAF---MDEISKVMEISEKRISQ----RTQEISQQLLQNNDVITNQIIDSTSRVR--- 1149
              +AF    D+I    E ++ R+ Q     +  +++ L Q+ D +      ST RV    
Sbjct: 1136 MALAFGNKADDIRAAYEENQGRLEQSLEAHSSRLTETLGQSTDRVEQVFGRSTDRVEQVL 1195

Query: 1150 GEIV-----DISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNE--- 1201
            G  V     DI+          E    +    LD   + I+  L +    +    NE   
Sbjct: 1196 GSGVSRIESDITGSVSRLETTFEDNHNRLRQTLDERGNAITNALQNARSGLEETLNEQGM 1255

Query: 1202 --------SRSLIEQRIHEVKDVL-SNLDRA-------LESYGSTVFKQFKEYVQCFETN 1245
                    S  ++E  + E +D L S +D +       L      +  +F +  +     
Sbjct: 1256 AIGASIAASAGMLEMSLEEQQDNLRSTIDASSRDLQDRLRGSAGAIAGEFGQAAREISRT 1315

Query: 1246 MENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQI 1305
             E   +  + + D +            N LS+    I  S+ G+  +     +  +D ++
Sbjct: 1316 AEEFSTRVEGSLDGVA-----------NRLSETGARIETSL-GSLEQRIQGSLEGVDLKV 1363

Query: 1306 YNAANALKKLEALLISDVEKITN----RITDSSQDVTTIISDATDSLNKV-DERL 1355
             NA + +    +  +SD+E++T     RI  +  D T  ++D  DS   V DERL
Sbjct: 1364 SNAGDNVAAKLSEKVSDLERVTTDATQRIEQTLGDATQRVADTFDSRTSVIDERL 1418



 Score =  221 bits (562), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 292/1507 (19%), Positives = 618/1507 (41%), Gaps = 238/1507 (15%)

Query: 305  IAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLA 364
            +A   E+  R + E+     S+IDQ   ++      +T+  +        TL +   ++ 
Sbjct: 586  LADALERRRRELDETISNAQSRIDQ---IMAERGTALTEALNTSQTRFDETLGSRSEAVI 642

Query: 365  NQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQS 424
            NQ       L  + D++S  L+  S   ++A TS    ++N    K ++I    +     
Sbjct: 643  NQ-------LTGSHDRISDLLQNASSGIVEAVTSSETRLANTLDRKAQTIIEAADGADAR 695

Query: 425  LRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFY 484
            +  +L +K D+  +  ++  +     +D +   LE    A    +   F N      + Y
Sbjct: 696  IEAALSDKADAIRAAYETNHERLTSVLDAKVEQLEQTALAVDSRVEAAFGNKADAIRAAY 755

Query: 485  KDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQN 544
            +++ +     L G +D++     ++   +E         +G+ +D    ++ED  S    
Sbjct: 756  EESEARLTRTLDGKVDQITDAATEADMRIE-------LALGNRMDTIRAVYEDSES---- 804

Query: 545  NISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNV 604
                       RL +T+   + +L + L     RI+   G K++++ S++  S  +++  
Sbjct: 805  -----------RLASTIDAKLGALTETLGNADNRIEQAFGTKADQVLSAYEQSEARLART 853

Query: 605  ISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNN--------LYDKIMVLAAAL 656
            +                           S +D IS++ ++        L +++  + A  
Sbjct: 854  LD--------------------------SKIDQISDAASDADMRIELALGNRMDTIRAVY 887

Query: 657  SESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLH 716
             ES+  L N++ A    +   + NA+ ++   F   +  ++ +Y  S  +L       + 
Sbjct: 888  EESESRLSNTIDAKLGALTETLGNADVRIEQAFGTKADQVLSAYEQSEARLARTLDSKIE 947

Query: 717  SFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKS 776
              +D  ++    +   L N    I  ++  +  R+       S  I+++L A++      
Sbjct: 948  QISDAASDADMRIELALGNRMDTIRAVYEESETRL-------SGTIDAKLGALT------ 994

Query: 777  IDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTF---------------- 820
                ET+ TA     Q  GS     +D++ +  ++ Q  L  T                 
Sbjct: 995  ----ETLGTADSRIEQAFGS----KADQLRAVYEEGQARLTQTLDSKVDQLSDVAAEADM 1046

Query: 821  ------AQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANS 874
                    + DS  +   D++++    +  +   L++ +     ++     SKA  +  +
Sbjct: 1047 RIEFALGSKVDSIRSVYEDSEARLAGTIDAKLGQLIETVGFADSRVQQALGSKADQIREA 1106

Query: 875  LTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHI 934
                 G +   L++    +++  + ++  +A  F     +I  +Y+EN+  L++ L  H 
Sbjct: 1107 YEANHGRLAEMLDSRINQVMDTATEADLRMALAFGNKADDIRAAYEENQGRLEQSLEAHS 1166

Query: 935  DVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDR 994
              L + L  S ++++   G ++  +  +L    SRIES ++ S + + +T   +H +  +
Sbjct: 1167 SRLTETLGQSTDRVEQVFGRSTDRVEQVLGSGVSRIESDITGSVSRLETTFEDNHNRLRQ 1226

Query: 995  LLQEKSDELIQLLDNKASCLSTAVSTQTIN-----------LENNLKEQEKSLSRVVDTS 1043
             L E+ + +   L N  S L   ++ Q +            LE +L+EQ+ +L   +D S
Sbjct: 1227 TLDERGNAITNALQNARSGLEETLNEQGMAIGASIAASAGMLEMSLEEQQDNLRSTIDAS 1286

Query: 1044 ---------------ASSFKYLSDSIQTLAQEL-VSVIGSM---SQSTTDISGKLEISLD 1084
                           A  F   +  I   A+E    V GS+   +   ++   ++E SL 
Sbjct: 1287 SRDLQDRLRGSAGAIAGEFGQAAREISRTAEEFSTRVEGSLDGVANRLSETGARIETSLG 1346

Query: 1085 SVNQKIQKCREFF-------GDNIVAFMDE----ISKVMEISEKRISQ------------ 1121
            S+ Q+IQ   E         GDN+ A + E    + +V   + +RI Q            
Sbjct: 1347 SLEQRIQGSLEGVDLKVSNAGDNVAAKLSEKVSDLERVTTDATQRIEQTLGDATQRVADT 1406

Query: 1122 ---RTQEISQQL----------LQN-NDVITNQIIDSTSRVRGEIVDISNKF-------- 1159
               RT  I ++L          LQN N+ I  +     S +R  ++  + +         
Sbjct: 1407 FDSRTSVIDERLSTMDRALNIGLQNVNNTIEGKAAGLASSLREAVIGATREIDSEAQKSA 1466

Query: 1160 -------IETSRVLEQREEKFHSALDSFSDNISRILLDVDH------------------T 1194
                    E S  +  R E+F  ++   +++++R + D  +                   
Sbjct: 1467 ELLGRTGQEFSETMNARNEEFTRSVREQAEDLTRRISDTQNRLAGQGAQIAQSFSDAGDA 1526

Query: 1195 ISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFD 1254
            I S  + + + I  +   +   L++ ++ALE   + +              +++++   D
Sbjct: 1527 IVSKVSAAEATITAKAGAIAGTLTDAEKALEERATAIRAALSATTGDMTEALDSVDKALD 1586

Query: 1255 KNNDSMLLSFKERSNILDNILSQRSMEISDSISGA-------FHKEGNAVVNVIDQQIYN 1307
               +++  +  ER+  L+++LS R+ E++  I          + + G   V  I Q    
Sbjct: 1587 ARGNAIRTTLDERTRELNSMLSGRTSELARLIEEKAKPTVEQYAQVGRDAVERIAQAADQ 1646

Query: 1308 AANALKK----------------------LEALLISDVEKITNRITDSSQDVTTIISDAT 1345
            +A++L++                       E  L S   ++ +RI++++Q +  ++  A 
Sbjct: 1647 SAHSLRQENAKLADALAARAAEAARQMNAAENSLTSSAGEMIDRISETNQTLHAVVEQAA 1706

Query: 1346 DSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKF 1405
             S+   D +   TT+R+  TT     VLA S +L E  ++ L  +S  +L Q++ IV +F
Sbjct: 1707 QSMANADRQFGATTDRLAATTHKAADVLATSGRLLESNLERLSNVSNQALSQVTGIVGRF 1766

Query: 1406 DKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKI 1465
              ++++L ++ + L  AQS    +L++    L DL+  +V +S E +  + S+   V   
Sbjct: 1767 GDHAKVLGQASELLGAAQSNLAGTLEERQQALRDLSIGIVKRSEEIENTMKSLAGMVDGA 1826

Query: 1466 VEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTID 1525
              QA+  S  V  N+   I++SF  I   L   E +++     +  +L   G    + I+
Sbjct: 1827 FSQAEQRSSQVAGNLRQGIETSFADIGQILGETEQKAKSAAGSMRDSLLSAGEDATRAIE 1886

Query: 1526 SNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQK 1585
                  +++S +L+N +R  + S++ +++ I +   +KSD +     +++ + V+    +
Sbjct: 1887 RTLGDAEKRSSELANRLRGGLSSSLADVDRILTEAGQKSDGTANQMREAVRSAVEDALGR 1946

Query: 1586 LSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQK 1645
             S  +D+I  +++ I ++L+ +R  LKR +  L +EAKESA  +R A+ EQI  L+D  +
Sbjct: 1947 FSGATDEIRRSAQEIRQELDLTRTELKRGAFDLPEEAKESAGAMRRAVAEQIKALQDISQ 2006

Query: 1646 LITDSVK 1652
            L+  S +
Sbjct: 2007 LVGRSAQ 2013



 Score =  125 bits (315), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 81/108 (75%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +   R
Sbjct: 2143 SLNSLSVDIARAIDHDASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPEFR 2202

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI++FE++LS++A+++ D  + Q ++ S+ GKVYTML HA+GR
Sbjct: 2203 TAVDRYIADFEKLLSDVARTDRDKSITQSYLTSDTGKVYTMLAHAAGR 2250


>gi|159184723|ref|NP_354355.2| hypothetical protein Atu1348 [Agrobacterium tumefaciens str. C58]
 gi|159140011|gb|AAK87140.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 2115

 Score =  337 bits (864), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 372/1696 (21%), Positives = 742/1696 (43%), Gaps = 225/1696 (13%)

Query: 15   LKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIES--KDRQQTTLSKNFKQASNKQTYS 72
            L  FEE+  +      K+  +R K + SR+  + E+     +QT  S N + A++    S
Sbjct: 24   LGAFEEKPETRKTAKPKQPEARVK-EASRQTPAPEATRAPVEQTPRSPNLEAANDGSKRS 82

Query: 73   GFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNS--PMDS 130
               PA          IL+++   S+  ALRNA + S+IW    LG     Y N+   + S
Sbjct: 83   ---PA---------MILKSLEGGSIGGALRNATIMSVIWALGGLGIAHLLYGNALWSIGS 130

Query: 131  FYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSS 190
              D    P ++ + + + +VP++LFF+F IM++RARD+ +A++S+A +ALRL +PE  +S
Sbjct: 131  LADLTAIPGLMAIVVGI-LVPVMLFFAFAIMMARARDLRNAARSMAEVALRLAEPETVAS 189

Query: 191  EKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNL 250
            +++ S+  AVR+E+  M + I+R I+RA+ELE  V SE+  LE +Y  +E+R+ ++ Q L
Sbjct: 190  DRIMSVGQAVRREVSAMNDGIERTIARATELETLVHSEVNALERSYADNELRVRSLVQEL 249

Query: 251  KQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTE 310
              ER+AI+NH  ++ +SI    E +KEELS+  EE+S+ ++   ++F S++D R A + E
Sbjct: 250  TAERDAIVNHAERIRSSIVGAQEQIKEELSIVGEELSMRIATTGEAFASMIDTRSAALLE 309

Query: 311  KTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNY 370
            K+    +     I++K + LL+ L+S+   I+ +FD R+ +L++TL+  G  L  +   +
Sbjct: 310  KSRASTEAMGSLIAAKTENLLQALNSSGSTISNEFDMRLHNLTSTLDERGEVLLERFAIH 369

Query: 371  TLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQ 430
               L +  + ++ AL+E+++Q  +  ++   E++      Q+ I  +L+ VL  L  +L+
Sbjct: 370  ASTLDSGVESLNSALEERTRQLNETLSARSLELNRNIERGQQVIGGSLDTVLDKLSTTLE 429

Query: 431  EKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSE 490
            EK  SF  +L+ST D+ + ++D R+   E R+ A + ++   F+  +  F+S +      
Sbjct: 430  EKGLSFRQSLQSTADDAIMDLDLRSGLYEERMQATVGQVNSAFDEHVAQFASAFDQRAGS 489

Query: 491  FESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQIT 550
             +S L  ++ ++    A     ++ +  S ++ IGS +  ++L     L   Q       
Sbjct: 490  LDSKLMESLARINETVAGGSEALDTILTSGLERIGSTMTDQSLALATALGTGQ------- 542

Query: 551  SMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREK 610
                E LEN            LE + Q     IG+++ E+  +F +S+ K+  V+++R  
Sbjct: 543  ----EMLENA-----------LESRTQAFSDAIGQRTAEITDAFTNSHAKIDTVLAERSN 587

Query: 611  LFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAAL----SESQKSLDNS 666
                +L+  Q  F+E +A    +I  S+S +  +L   +   AAA+    ++ ++ L  +
Sbjct: 588  ALFGALSASQDRFDEALASRSLAITGSVSGTAEHLAAMLDERAAAINSVVADVERRLTET 647

Query: 667  LKAHA---------------------TDVVHK-ITNAENQLVNRFDESS----------- 693
            L+  A                     T  +H  ++ AE+++ +  D  +           
Sbjct: 648  LETRAAAITGAVSGIEDRISDTLESRTAALHDVVSGAESRIADTLDGRTAALSSAISGVE 707

Query: 694  KNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEE 753
            + I  + +S    L+  F       ++T +N++  ++GI+ ++ + I     +      +
Sbjct: 708  ERIADTMDSRTLSLDMTFANVEERLSETLDNRTSALTGIVASAEEKIAGALDSRTATFGD 767

Query: 754  LLHSGSANIESELSAISKAMNKSIDDV-ETISTALKERCQELGSDLVNHSDKVLSSL--- 809
            ++      I   L   + A+N  +    E I+ AL  R   L        +K+  +L   
Sbjct: 768  VVAGAETRIAETLDGRTAALNAVVSGAEERIADALDSRTMALDMTFSGAEEKIAEALDTR 827

Query: 810  --------KQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLT 861
                      A+  +      R DS    ++  + +  + L +++  L    S   +K+T
Sbjct: 828  TAALGELVASAETRIAGALDSRTDSLKTVVSGAEERITDVLDSRTMALDMSFSGVEEKIT 887

Query: 862  DIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDE 921
            DI   +   + +++  ++  +   L++ + A+   +S +   +A    E + +  L+ D 
Sbjct: 888  DILDGRTAALKSAVAGVEDRIAGALDSRTAALSGIVSGAEERIA----EALDSRTLALDM 943

Query: 922  NRQTLDKKLSDHIDV----------------------LRQNLAGSENKIDGAIGSASQFI 959
                +++++++ +D                       L   LA    +++  +GS ++ I
Sbjct: 944  TISGVEERIAEAMDARASSLSLAAAGVGQRLEATAFTLENALASGHERLETMLGSQAERI 1003

Query: 960  RDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEK-----------SDELIQLLD 1008
               L+ NS  IE  +S + N + + +     +F + ++E             +E+   LD
Sbjct: 1004 AGSLERNSGLIEQSVSGAANRIENVVEDGSSRFAQTVEEGVSRLENNLSQSHEEIRTALD 1063

Query: 1009 NKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSM 1068
             + + L+  +S+ T  + + L EQ   +   V +SAS  +   ++ Q   Q+      ++
Sbjct: 1064 QRQADLAATLSSATTQMGDMLSEQAMMIGTTVASSASMLELSLETQQDTLQK------AI 1117

Query: 1069 SQSTTDISGKLEISLDSVNQKI-QKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEIS 1127
              S   +  +L  S   +  KI +  RE  G       D +S  +E S   ++ R  E  
Sbjct: 1118 DGSAATLEARLRNSAGDIAVKIGEAAREIGGAT-----DALSTRIETSIGNVTTRLDETG 1172

Query: 1128 QQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRI 1187
             ++  + D +  ++    + V   I D   +F +    LE +   F    D  ++ I+ I
Sbjct: 1173 ARIETSLDALQTRVGGDLANVNNSIEDAGRRFAD---ALEDKTAVFARTSDEAAERITGI 1229

Query: 1188 LLDVDHTISSHTNESR------------SLIEQRIHEVKDVLS----NLDRALESYGSTV 1231
             LD   T  + T E+R            + I++R+  +   L+    N++R +E   S +
Sbjct: 1230 -LDEQTTRVADTFENRTSRLAETFDAGTARIDERLGTMDRALTIGLENVNRTIEGKASDL 1288

Query: 1232 FKQFKEYVQCFETNMEN----MESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSIS 1287
                +  V     N+ +      +L  K+        + ++      + +RS EI   IS
Sbjct: 1289 AVSLRGAVVSATQNIGDEAARSSALLAKSGSEFAEQVQAQNEAFTKAIEERSGEIVTRIS 1348

Query: 1288 GA---FHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDA 1344
             A      +  AV     +      N + + EA++ S V  I       S+ +T++ S  
Sbjct: 1349 DAQTRLSGQAAAVAQTFSEAGNIIVNKVAEAEAVVRSQVGVI-------SETLTSVES-- 1399

Query: 1345 TDSLNKVDERLHQTT-NRITETTGHIDTVLAESSKLFEKKIKD-LGEISRVSLLQMSEIV 1402
              +L+   E +     NR  E    + +  AE S+L E+K K  + E + +      +IV
Sbjct: 1400 --ALDARGESIRSALDNRTRELNSMLASRSAELSRLIEEKAKPVVEEYATIGREAAEKIV 1457

Query: 1403 SKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDV 1462
            S   +++++L +S+                  + +V +  + +S  + A     S LV  
Sbjct: 1458 SAAQQSAELLSQSN------------------SGMVGMVEQAISDYAAAGTDAASKLVAA 1499

Query: 1463 KKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVK 1522
             +  +  D LS+T    M D+++    K                     + +D  NK   
Sbjct: 1500 TR--QSTDMLSETHTA-MADAVEQGIDK------------------YARSGSDAANK--- 1535

Query: 1523 TIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSF 1582
                  V    +S D+ +     +   +      F+   E++ Q      ++LN     F
Sbjct: 1536 -----LVAATRQSTDMLSQTHNSMAEIVEQSATNFNAAVERAAQGFGAADEALNASATRF 1590

Query: 1583 TQKLSKTSDDIALTSR 1598
            ++  S+ +D ++ +SR
Sbjct: 1591 SESASQAADMVSSSSR 1606



 Score =  303 bits (776), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 340/1629 (20%), Positives = 696/1629 (42%), Gaps = 186/1629 (11%)

Query: 349  IESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFS 408
            +E + +T+ +   +LA  +G    ML N       AL+ ++Q F  A      E+++ F+
Sbjct: 520  LERIGSTMTDQSLALATALGTGQEMLEN-------ALESRTQAFSDAIGQRTAEITDAFT 572

Query: 409  EKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKE 468
                 I   L +   +L  +L   +D F   L S    +L    + + T E+ + A L E
Sbjct: 573  NSHAKIDTVLAERSNALFGALSASQDRFDEALAS---RSLAITGSVSGTAEH-LAAMLDE 628

Query: 469  IVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADS----HGNMEDLFLSNIQTI 524
                 N+ + D      + L    + + G +  ++   +D+       + D+       I
Sbjct: 629  RAAAINSVVADVERRLTETLETRAAAITGAVSGIEDRISDTLESRTAALHDVVSGAESRI 688

Query: 525  GSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIG 584
               LD +T      +S  +  I+      T  L+ T  N    L + L+ +   +   + 
Sbjct: 689  ADTLDGRTAALSSAISGVEERIADTMDSRTLSLDMTFANVEERLSETLDNRTSALTGIVA 748

Query: 585  KKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSI------ 638
               E++  + +S      +V++  E   + +L    +     ++G  + I D++      
Sbjct: 749  SAEEKIAGALDSRTATFGDVVAGAETRIAETLDGRTAALNAVVSGAEERIADALDSRTMA 808

Query: 639  -----SNSTNNLYDKIMVLAAALSE----SQKSLDNSLKAHATDVVHKITNAENQLVNRF 689
                 S +   + + +    AAL E    ++  +  +L +    +   ++ AE ++ +  
Sbjct: 809  LDMTFSGAEEKIAEALDTRTAALGELVASAETRIAGALDSRTDSLKTVVSGAEERITDVL 868

Query: 690  DESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAK 749
            D  +  +  S++    K+  I      +         D ++G L + T  +  + S   +
Sbjct: 869  DSRTMALDMSFSGVEEKITDILDGRTAALKSAVAGVEDRIAGALDSRTAALSGIVSGAEE 928

Query: 750  RMEELLHSGSANIESELSA----ISKAMNKSIDDVETISTALKERCQE----LGSDLVNH 801
            R+ E L S +  ++  +S     I++AM+     +   +  + +R +     L + L + 
Sbjct: 929  RIAEALDSRTLALDMTISGVEERIAEAMDARASSLSLAAAGVGQRLEATAFTLENALASG 988

Query: 802  SDKVLSSLKQAQELLCTTFAQRNDSFV-NALADNQSKFENNLVNQSHLLLDKLSSDIQKL 860
             +++ + L    E +  +  +RN   +  +++   ++ EN + + S      +   + +L
Sbjct: 989  HERLETMLGSQAERIAGSL-ERNSGLIEQSVSGAANRIENVVEDGSSRFAQTVEEGVSRL 1047

Query: 861  TDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYD 920
             +       ++  +L + Q ++  TL + +  M + +S    ++  T     S + LS +
Sbjct: 1048 ENNLSQSHEEIRTALDQRQADLAATLSSATTQMGDMLSEQAMMIGTTVASSASMLELSLE 1107

Query: 921  ENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDI------------------ 962
              + TL K +      L   L  S   I   IG A++ I                     
Sbjct: 1108 TQQDTLQKAIDGSAATLEARLRNSAGDIAVKIGEAAREIGGATDALSTRIETSIGNVTTR 1167

Query: 963  LDENSSRIESLLSCSNN-------SVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLS 1015
            LDE  +RIE+ L            +VN+++  + ++F   L++K+    +  D  A  ++
Sbjct: 1168 LDETGARIETSLDALQTRVGGDLANVNNSIEDAGRRFADALEDKTAVFARTSDEAAERIT 1227

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSAS---------------SFKYLSDSIQTLAQE 1060
              +  QT  + +  + +   L+   D   +                 + ++ +I+  A +
Sbjct: 1228 GILDEQTTRVADTFENRTSRLAETFDAGTARIDERLGTMDRALTIGLENVNRTIEGKASD 1287

Query: 1061 L-VSVIGSMSQSTTDI-------SGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVM 1112
            L VS+ G++  +T +I       S  L  S     +++Q   E F   I     EI   +
Sbjct: 1288 LAVSLRGAVVSATQNIGDEAARSSALLAKSGSEFAEQVQAQNEAFTKAIEERSGEIVTRI 1347

Query: 1113 EISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEK 1172
              ++ R+S +   ++Q   +  ++I N++ ++ + VR ++  IS         L+ R E 
Sbjct: 1348 SDAQTRLSGQAAAVAQTFSEAGNIIVNKVAEAEAVVRSQVGVISETLTSVESALDARGES 1407

Query: 1173 FHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVF 1232
              SALD    N +R   +++  ++S + E   LIE++   V +  + + R       +  
Sbjct: 1408 IRSALD----NRTR---ELNSMLASRSAELSRLIEEKAKPVVEEYATIGREAAEKIVSAA 1460

Query: 1233 KQFKEYVQCFETNMENM--ESLFD-----KNNDSMLLSFKERSNILDNILSQRSMEISDS 1285
            +Q  E +    + M  M  +++ D      +  S L++   +S    ++LS+    ++D 
Sbjct: 1461 QQSAELLSQSNSGMVGMVEQAISDYAAAGTDAASKLVAATRQST---DMLSETHTAMAD- 1516

Query: 1286 ISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR-------ITDSSQDVT 1338
                      AV   ID+   + ++A  KL A      + ++         +  S+ +  
Sbjct: 1517 ----------AVEQGIDKYARSGSDAANKLVAATRQSTDMLSQTHNSMAEIVEQSATNFN 1566

Query: 1339 TIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQM 1398
              +  A       DE L+ +  R +E+      +++ SS+L E KI  L  IS  +L Q+
Sbjct: 1567 AAVERAAQGFGAADEALNASATRFSESASQAADMVSSSSRLLEGKIDRLSNISGQTLAQV 1626

Query: 1399 SEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSI 1458
            + IV +F+++S++L ++ + L  AQS    +L++  + L  L+  LV +S E +  + ++
Sbjct: 1627 AGIVGRFEEHSKVLSQASELLNAAQSSLVGTLEERQDALRSLSVGLVKRSEEIETAMRNV 1686

Query: 1459 LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGN 1518
            +  V+  + +A+  S  V  N+ D++Q+SF  I  +L   E R+R   + +   L   G 
Sbjct: 1687 VGVVENTLNEAEERSQNVAGNLRDNLQASFSDIGRSLDETEQRARSAAQTMRGALLSAGQ 1746

Query: 1519 KTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNK 1578
               ++I+S     ++ S +L N +R  + S++  ++N+  +  EKS+ +     ++L   
Sbjct: 1747 DASRSIESTLSDAQKYSDELVNRLRGGVESSLSEVDNLLGSASEKSNAAAANLKETLRQA 1806

Query: 1579 VDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQIN 1638
            V+    + +  +D+I  +S  I  +L+ +R  LKR +  L +EAKESA  +R A+ EQI 
Sbjct: 1807 VEEAVSRFAGATDEIRRSSHDIRRELDATRAELKRGAFDLPEEAKESAAAMRRAVSEQIK 1866

Query: 1639 TLKDFQKLITDS-----------------------------------------VKNNAAS 1657
             L+D  +L+  S                                          +   A 
Sbjct: 1867 ALQDISQLVGRSTHQMEVSEPVARAIAATQPAAERRVEPRPQPAAAAPVQQRPAQPQPAP 1926

Query: 1658 YNKGLHSDEYNISQVDKR----PSGKKTKNNHAIKE----WFNKILSSSTHSKGKSSSHI 1709
              +G    E    QV+ R    P+     N    +E    W + +L  ++     +S+  
Sbjct: 1927 ALRGTLPLENR--QVENRQAPAPAQPVATNPAGRREEGGGWISDLLRGASQETPAASTPR 1984

Query: 1710 DISDKDSLSSID------------SLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYT 1757
              +++    + D            SL  +I++ ID+DA V+LW+ Y  GE D+F++RLYT
Sbjct: 1985 ASTEQQPTRAADTRNPRHMVESLNSLSVDIARAIDHDASVELWRRYQRGERDVFTRRLYT 2044

Query: 1758 IKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVY 1817
            +KGQ  F  ++ +Y+ ++  R A+DRYI++FE++L+++A+++ D  + Q ++ S+ GKVY
Sbjct: 2045 LKGQTTFDEIKRKYEREAEFRTAVDRYITDFEKLLADVARTDRDRSVTQSYLTSDTGKVY 2104

Query: 1818 TMLVHASGR 1826
            TML HA+GR
Sbjct: 2105 TMLAHAAGR 2113


>gi|163759624|ref|ZP_02166709.1| hypothetical protein HPDFL43_09732 [Hoeflea phototrophica DFL-43]
 gi|162283221|gb|EDQ33507.1| hypothetical protein HPDFL43_09732 [Hoeflea phototrophica DFL-43]
          Length = 1512

 Score =  287 bits (734), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 273/1142 (23%), Positives = 514/1142 (45%), Gaps = 153/1142 (13%)

Query: 74   FYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSP----MD 129
              PAND        +L+ +   S   ALRNA + S++W    LG     Y   P    + 
Sbjct: 85   LAPANDDSRKTTAGLLRALEIRSSRGALRNASILSVLWAVGVLGLANLLY--GPEIWQIR 142

Query: 130  SFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYS 189
            S  D    P  I  F V  +VP+L+FF+F IM++RAR+M   ++S+A +ALRL +PE  +
Sbjct: 143  SVQDVLAMPAAIG-FAVAIIVPVLMFFAFSIMMARAREMRSVARSMAEVALRLAEPENIA 201

Query: 190  SEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQN 249
             +++ S+  AVR+E+  M E I+R I+RASELE  V SE+  LE +Y+ +E+R+  + Q 
Sbjct: 202  GDRILSVGQAVRREVSAMNEGIERTIARASELETLVHSEVNALERSYSDNEIRVRGLVQE 261

Query: 250  LKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVT 309
            L  ER+AI++H  ++  SIA  HE LK+EL+  SEEI+  +S + ++   ++D R A + 
Sbjct: 262  LGSERDAIVSHSERIRASIAGAHEELKQELTTASEEIANRISTSGEALAQLMDTRAANLQ 321

Query: 310  EKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGN 369
            E+T    ++  Q +S + + L+  L ++   +T +FD R+E L+  LN  G++L ++   
Sbjct: 322  ERTEATSRDIEQVLSGRTEALVTALKTSGGELTDEFDTRLEMLNVQLNQRGKALLSEFET 381

Query: 370  YTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISL 429
                L ++T+K++ AL E+++Q  +   +   E+S      Q++I+  L + L +L  SL
Sbjct: 382  RASTLDSSTEKLNAALGERAKQLNETLIARTREISESLGVGQQAISSGLEETLATLNASL 441

Query: 430  QEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLS 489
             EK  SF   LK++ D+ + ++D R+   E ++ + +  +   F+  + DF+S +     
Sbjct: 442  DEKGASFRQALKTSADDAIMDLDLRSGFFEEKLQSSIGSLTAAFDERVADFTSAFDSRAG 501

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
              +  L  ++ ++      S   ++ +  ++++ IG+ L  ++   E  L+     I   
Sbjct: 502  SLDGKLGESLARINETLTGSTSAIDGILAASLERIGATLADRSQELEASLASGTGRIETA 561

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            T    +++  TL +  +++   L    +RIDS++ ++S  L +        ++  ++D E
Sbjct: 562  TGQAADKIATTLADRTDAIDKALAMGAERIDSNLAERSSALVAG-------IAGRVTDLE 614

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKA 669
               S S  R+ S   E      Q++          L ++   L   LSE+ + L  +L  
Sbjct: 615  TAISASADRIDSSLNE----RSQALF-------GGLEERTSTLQTGLSEASERLSATLDV 663

Query: 670  HATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHV 729
              +               RF+E +K  +        +++  F K     ++     ++ +
Sbjct: 664  EGS---------------RFNEITKAAV-------ERVDETFIKGTERVDERLTTMNNML 701

Query: 730  SGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKE 789
               L + ++ I+   S  A ++ E +    AN   EL A      +++   ET+ T    
Sbjct: 702  GAGLDSVSKTIEGKASGLAAKLREAV----ANAAVELDA------EALKAGETLGT---- 747

Query: 790  RCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLL 849
                +G+      D      +QA+E     FA++ D+ V+    + S     + N+    
Sbjct: 748  ----VGAGFAGRMD------EQARE-----FARKLDAHVDERTADLSVHAETIANRISTG 792

Query: 850  LDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFE 909
              +LS++  ++ D+                  VG T+   +  +   + AS    AK  E
Sbjct: 793  ATELSAEASRIGDLVE---------------RVGETVGGQADRIATTLDASEARFAKQAE 837

Query: 910  ECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSR 969
               + +    +     +  +L +  + L   L      I G IG  +  +   LD  +  
Sbjct: 838  ALAARL----ETETGAISNRLGETAETLVTTLDSKTQDIAGRIGQTTDALVSALDTKADA 893

Query: 970  IESLLS-CSNNSVNSTLLRSHQKFDRLLQEKSDELI-------QLLDNKASCLSTAVSTQ 1021
            I S L+    N V+ T           L++K+  ++       Q +D +A+ + + +  +
Sbjct: 894  ISSRLAETGENLVSRT-----GSVGEALEQKAAAIVQHLVEAEQAMDVRATRVHSTLDER 948

Query: 1022 TINLENNLKEQEKSLSRVVDTSASSF--KYLSDSIQTLAQELVSVIGSMSQSTTDISGKL 1079
            T  L + L  +   LSRV+D  A     +Y+S       +E  + I  ++Q++TD   +L
Sbjct: 949  TRELNSMLASRSAELSRVIDEKARPLVEQYVSS-----GEEFSNRITEVTQTSTD---RL 1000

Query: 1080 EI------------------SLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISE----- 1116
                                +L++VNQ +        + +     EISKV+E +      
Sbjct: 1001 RAENAALINAITNRTSETLSALETVNQSLTGSVGELLNRLGVSNQEISKVIETATLTLGA 1060

Query: 1117 --KRISQRTQEIS------QQLLQNN----DVITNQIIDSTSRVRGEIVDISNKFIETSR 1164
               R+ + T E S       +LL  +    D    ++ D +SR   ++  I+ +F + S+
Sbjct: 1061 ANARLEETTGEFSSSTEKAAELLSGSARLLDGKVEKLTDISSRTLNQVGAIAGRFDDHSK 1120

Query: 1165 VL 1166
            VL
Sbjct: 1121 VL 1122



 Score =  148 bits (373), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 214/1065 (20%), Positives = 434/1065 (40%), Gaps = 147/1065 (13%)

Query: 545  NISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSF-------NSS 597
            +I Q+ S  TE L   L  S   L D  + + + ++  + ++ + L S F       +SS
Sbjct: 330  DIEQVLSGRTEALVTALKTSGGELTDEFDTRLEMLNVQLNQRGKALLSEFETRASTLDSS 389

Query: 598  YQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALS 657
             +K++  + +R K  + +L        E++    Q+I       ++ L + +  L A+L 
Sbjct: 390  TEKLNAALGERAKQLNETLIARTREISESLGVGQQAI-------SSGLEETLATLNASLD 442

Query: 658  ESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHS 717
            E   S   +LK  A D +  +      L + F E          SS   L   F + +  
Sbjct: 443  EKGASFRQALKTSADDAIMDL-----DLRSGFFEEK------LQSSIGSLTAAFDERVAD 491

Query: 718  FNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSI 777
            F   F++++  + G L  S   I++  + +   ++ +L +                    
Sbjct: 492  FTSAFDSRAGSLDGKLGESLARINETLTGSTSAIDGILAA-------------------- 531

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
              +E I   L +R QEL + L + + ++ ++  QA + + TT A R D+   ALA    +
Sbjct: 532  -SLERIGATLADRSQELEASLASGTGRIETATGQAADKIATTLADRTDAIDKALAMGAER 590

Query: 838  FENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKI 897
             ++NL  +S  L+  ++  +  L + A S + D  +S          +L   SQA+   +
Sbjct: 591  IDSNLAERSSALVAGIAGRVTDL-ETAISASADRIDS----------SLNERSQALFGGL 639

Query: 898  SASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQ 957
                                  +E   TL   LS+                      AS+
Sbjct: 640  ----------------------EERTSTLQTGLSE----------------------ASE 655

Query: 958  FIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDR-------LLQEKSDELIQLLDNK 1010
             +   LD   SR   +   +   V+ T ++  ++ D        +L    D + + ++ K
Sbjct: 656  RLSATLDVEGSRFNEITKAAVERVDETFIKGTERVDERLTTMNNMLGAGLDSVSKTIEGK 715

Query: 1011 ASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFK-YLSDSIQTLAQELVSVIGSMS 1069
            AS L+  +     N    L  +       + T  + F   + +  +  A++L + +    
Sbjct: 716  ASGLAAKLREAVANAAVELDAEALKAGETLGTVGAGFAGRMDEQAREFARKLDAHV---D 772

Query: 1070 QSTTDIS------------GKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEK 1117
            + T D+S            G  E+S ++   +I    E  G+ +    D I+  ++ SE 
Sbjct: 773  ERTADLSVHAETIANRISTGATELSAEA--SRIGDLVERVGETVGGQADRIATTLDASEA 830

Query: 1118 RISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSAL 1177
            R +++ + ++ +L      I+N++ ++   +   +  + +K  + +  + Q  +   SAL
Sbjct: 831  RFAKQAEALAARLETETGAISNRLGETAETL---VTTLDSKTQDIAGRIGQTTDALVSAL 887

Query: 1178 DSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKE 1237
            D+ +D IS  L +    + S T      +EQ+   +   L   ++A++   + V     E
Sbjct: 888  DTKADAISSRLAETGENLVSRTGSVGEALEQKAAAIVQHLVEAEQAMDVRATRVHSTLDE 947

Query: 1238 YVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAV 1297
              +   + + +  +   +  D       E+        S R  E++ + +     E  A+
Sbjct: 948  RTRELNSMLASRSAELSRVIDEKARPLVEQYVSSGEEFSNRITEVTQTSTDRLRAENAAL 1007

Query: 1298 VNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQ 1357
            +N I  +     +AL+ +   L   V ++ NR+  S+Q+++ +I  AT +L   + RL +
Sbjct: 1008 INAITNRTSETLSALETVNQSLTGSVGELLNRLGVSNQEISKVIETATLTLGAANARLEE 1067

Query: 1358 TTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHD 1417
            TT   + +T     +L+ S++L + K++ L +IS  +L Q+  I  +FD +S++L  + D
Sbjct: 1068 TTGEFSSSTEKAAELLSGSARLLDGKVEKLTDISSRTLNQVGAIAGRFDDHSKVLASASD 1127

Query: 1418 SLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVV 1477
             L  AQS    +L++    L  L+  LVS+S + ++ + S+   V+K    AD LS    
Sbjct: 1128 LLGAAQSNLASTLEERREALQSLSLGLVSRSEQIEETMRSLEGIVEKAFSDADQLSQRAA 1187

Query: 1478 KNMTDSIQSSFIKIDGTLSNIETRS-------RDTVR-LIDHNLADIGNKT--------- 1520
              +   ++S+       L++ E R+       R++VR  I+  +      T         
Sbjct: 1188 SRLEGGLRSAAENASQLLTDTENRANSAAGSMRESVREAIEDAIGRFAGATDEIRQSASS 1247

Query: 1521 -VKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKS 1564
              + ++     LK  ++DL    R+   +    + +    L+E S
Sbjct: 1248 IRRELEDTRSELKRGAFDLPEETRESAAAMRRAVSDQIKALQELS 1292



 Score =  127 bits (318), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 84/108 (77%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA V LW+ Y  GE D+F++RLYT+KGQ+ F  ++++Y  +   R
Sbjct: 1401 SLNSLSVDIARAIDHDASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIKDKYGREPEFR 1460

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +A+DRYI++FE++LS++A+++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1461 SAVDRYIADFEKLLSDVARNDRDNMMTQTYLTSDTGKVYTMLAHASGR 1508


>gi|254502405|ref|ZP_05114556.1| hypothetical protein SADFL11_2444 [Labrenzia alexandrii DFL-11]
 gi|222438476|gb|EEE45155.1| hypothetical protein SADFL11_2444 [Labrenzia alexandrii DFL-11]
          Length = 1899

 Score =  275 bits (703), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 407/1926 (21%), Positives = 787/1926 (40%), Gaps = 336/1926 (17%)

Query: 103  NAFMSSLIWLACELGFLIKFYTN--SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFI 160
             AF  S +W A      +  + +  + +         P++I L  +  VVPI+ FF   +
Sbjct: 106  GAFALSAVWAALGTSLFMSSFADRVAGVTDAETLMQSPDMI-LAAIGIVVPIIFFFVMAM 164

Query: 161  MISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASE 220
            MI RA+++   ++ +  +ALRL +PE+ + E + S+  A+R+E+  M + I+RAI+RASE
Sbjct: 165  MIWRAQELRIVARGMTEVALRLAEPEDMAKESILSVGQAIRREVAAMGDGIERAIARASE 224

Query: 221  LEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELS 280
            LE  V +E+  LE +Y  +E++I ++ + L  +REAI+ +  ++  +IA  HE+   +LS
Sbjct: 225  LEVLVHNEVSSLERSYNDNELKIRSLIEELVTQREAIVMNAERVRETIAGAHENFASQLS 284

Query: 281  LTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIV 340
             TS E+  ++ +A    Q ++D   A+V E T+        T+ S+I+ L   L+++   
Sbjct: 285  DTSGELGSNVDQAT---QRMIDAVNARVEELTS--------TVDSRIESLGATLNASGNE 333

Query: 341  ITKDFDNRIESLSNTLNNSGRSLAN---QVGNYTL-MLGNNTDKVSIALKEQSQQFMQAF 396
            + +    R E     L+N+G  L +   Q G      L    ++V+    E +  F++  
Sbjct: 334  MVESLTVRAEDYVARLSNTGNELVDNLSQTGTTMYETLSYRGNEVNERFAETANTFVETL 393

Query: 397  TSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQ-----------EKEDSFCSNLKSTT- 444
            +    E++   +    ++  TL+      R +L+            + +   +NL  T+ 
Sbjct: 394  SKRGLEINEALTTSSTTVVDTLSSKADEFRTALETTGTQVGDTITARGEEINANLSLTSG 453

Query: 445  ------------------------DNTLREVDNRT--------NTLENRITAFLKEIVET 472
                                    D  L E  NR          T+ + I+    EIVET
Sbjct: 454  RLIDTITARTEELVTTVDTRVTHLDEALAETGNRVVESISEKGQTVTDTISIRGAEIVET 513

Query: 473  FNNSITDFSSFYKDN------------------LSEFESNLQGNIDKLQGCFADSHGNME 514
             ++  T+ +   +                    L E   +L   I    G  AD   N+ 
Sbjct: 514  LSSRSTEVAEILRGTGESIVVDLSLRGGEIAAKLDETAGSLTQTISVRGGELADKLDNIS 573

Query: 515  DLFLSNIQTIGSNLDKK---------------TLLFEDILSKKQNNISQITSMNTERLEN 559
            +   + I   G+ LD++               T+ F + L       +      T  L  
Sbjct: 574  ERIYTAISINGTELDERLAARSNEMASILEQQTIGFRETLESVSGQFAAGLGEQTGSLTQ 633

Query: 560  TLTNSINSLKDMLEEKRQRIDSDI----GK-------KSEELCSSFNSSYQKVSNVISDR 608
             L  +   L +++  +  R+  DI    GK       + + L     +   ++  ++SDR
Sbjct: 634  KLAETGTQLAELIGSRGDRVAGDINEISGKIAETIEVRGQALNDGLANRLGELETIVSDR 693

Query: 609  ----------------EKL----------FSNSLARVQSHFEETIAGHPQSIVDSISNST 642
                            E L          F N +  + S   E I     S+    S   
Sbjct: 694  GGQLIDAFDTKTLLLSEALDSRLSTLDVTFGNRIETMDSKLGERIETMDTSLDQRFSAID 753

Query: 643  NNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNR---FDESSKNIICS 699
              L D+I  + A+L +   ++D SL+       H+ T  +  L +R    D S +  + +
Sbjct: 754  TTLTDRISTMDASLGDRIAAMDTSLE-------HRFTTMDATLGDRISTMDASLEQRVTT 806

Query: 700  YNSS-NNKLETI---FQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELL 755
             +++   ++ T+      H+++ + T + ++      L++ TQ + D        + + L
Sbjct: 807  MDTTLGERISTMDSSLGSHINTLDLTLDQRTAAFEAALESRTQILGDAIEQRTTVISDTL 866

Query: 756  HSGSANIESELSAISKAMNKSIDD-VETISTALKERCQELGSDLVNHSDKVLSSLKQAQE 814
               + NI   L+  S A+   +   VE     L  R  E+G+ L +H D    ++ +  E
Sbjct: 867  EDKTRNITDVLADRSDAITLQLGQRVEAAGNTLANRVDEIGTKLTSHVDTAAGAMAEKAE 926

Query: 815  LLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANS 874
            LL  T     D     L     +  + L++++  +         ++T      A+D  N 
Sbjct: 927  LLTATMTSGTDRIDETLDARARQISDTLISRTKEIAQAFVEGQDEMT-----SALD--NR 979

Query: 875  LTEIQGNVGVTLENHSQAMLEKISASN-TLVAKTFEECMSNILLSYDENRQTLDKKLSDH 933
            LTE    +G   E  ++++ E+I+  N +L AK FE              +TLD + S  
Sbjct: 980  LTEAGSVLGKQSEQLTESLSERIAEINVSLGAKVFEVA------------ETLDTRASQL 1027

Query: 934  IDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFD 993
              VL + L      I G +   S+  RDIL    S   + LS       ST LR      
Sbjct: 1028 ETVLNERL----ESISGTLTGESERARDILTAVISEAGATLST-----ESTRLRD----- 1073

Query: 994  RLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTS---------A 1044
             ++QE     +Q L ++ +     V     +    L  +   + ++V  S          
Sbjct: 1074 -MVQEAVASAVQSLADERTRTVEIVDVALNDATAKLSGEGDRMRQIVLGSVGEARGILVG 1132

Query: 1045 SSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAF 1104
             S K      QT+AQ   S+     ++   IS  +E +  +++ +  K RE     +VA 
Sbjct: 1133 ESQKAAEQITQTVAQASGSLTSESQRAAVQISQTMEQATGAMSGESAKIRELV---LVAV 1189

Query: 1105 MDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSR 1164
             D    +   SEK  +     +++         T  +   + +VR E   +S    E S 
Sbjct: 1190 GDAARAMAAESEKARTLYAGTLAE--------FTGSLTGESDKVRSE---LSGLIAEISG 1238

Query: 1165 VLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSN----- 1219
             L    E+    L       +R L ++   +S   N  R+ +   + E  D+L N     
Sbjct: 1239 NLSAESEQARMTL-------ARTLEEIRGQMSGEANMIRTRVNSAVSEAADLLVNRGNEV 1291

Query: 1220 ----LDRAL---ESYGS-------TVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFK 1265
                LD+A    E++G+        V     E +   E    ++     + + ++L +  
Sbjct: 1292 ATEMLDKASALNEAFGARSGELAKIVGTDGNELISAIEMRANDLTGRLSEVHGAILEAIT 1351

Query: 1266 ERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEK 1325
             +   + +  +   ++ + S+  A    G+ +V  I+++   A   L   +  L +DV  
Sbjct: 1352 VKGKDVTDTFAHTGLDATRSLVEA----GDRIVASINERSDQATRLLTDTKHRLENDVTD 1407

Query: 1326 ITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAE---SSKLFEK 1382
            I N+I  S+ ++  I+S A ++L++V+  L +   R  E    +D  + E   ++ L ++
Sbjct: 1408 ILNKIETSNANLQAIVSTAGENLSEVEGNLAR---RAGEFRSAVDRAVTETNSTTSLIDE 1464

Query: 1383 KIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTS 1442
            ++ +L +++  +L  +  + ++F   S+ L K+   L            +D N  V+  S
Sbjct: 1465 QVGNLRDVTATTLADIQNLTNRFGDQSEELTKAARYL------------EDTNRSVE--S 1510

Query: 1443 RLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRS 1502
            R+  + S  ++   ++L   + +        DT++++ T ++         TL   + ++
Sbjct: 1511 RVTDRKSAIEEVADTLLAKTEAV--------DTLMRSFTQTLSE-------TLETADDKA 1555

Query: 1503 RDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEE 1562
            RD   ++         K  +  +S  +T   +     + +R          ++I S +  
Sbjct: 1556 RDAAGMLSAAAEAASKKVSEQFESMRLTAGMEGQKARDAIRAA-------QDDIISEMSR 1608

Query: 1563 KSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEA 1622
                       ++++  D F    ++  D     +R +  +L  +R+ LK+  ++L  EA
Sbjct: 1609 -----------TVSDASDRFNDAATRMRD----VARDVHRELEATRNELKQGVLNLPDEA 1653

Query: 1623 KESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKG--------------------- 1661
            +ES+  +R  + EQI  L +   ++  + ++NA   +K                      
Sbjct: 1654 EESSAALRKVVNEQIRALTELSDIV--AKQSNALDISKPQAQVATASAAPAPAPAPAPAP 1711

Query: 1662 --LHSDEYNISQVDKRPSGKKTKNNHAI------------------KEWFNKIL-SSSTH 1700
                +  +       RP+  +                         K W + +L  +S  
Sbjct: 1712 QIPQAPVFAQQPAQPRPAAPQQPETRGPVNTRRQQPAQPDTSGSTGKGWVSDLLRRASRD 1771

Query: 1701 SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKG 1760
                S +    S   ++ S++SL  +I++ ID++ F+ LW+ Y  GE  +F++RLYT++G
Sbjct: 1772 DDAASDTEQGRSPLQTVESLNSLSVDIARAIDHETFIDLWERYRSGERHVFTRRLYTLQG 1831

Query: 1761 QKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTML 1820
            Q+ F  ++++Y  D   R A++RY+S+FE++LS++++++ D+ L Q ++ S+ GKVYTML
Sbjct: 1832 QQTFDEIRQKYARDPEFRTAVERYVSDFEQLLSQVSRNDRDNMLGQTYLTSDTGKVYTML 1891

Query: 1821 VHASGR 1826
             HASGR
Sbjct: 1892 AHASGR 1897


>gi|328543116|ref|YP_004303225.1| hypothetical protein SL003B_1497 [polymorphum gilvum SL003B-26A1]
 gi|326412862|gb|ADZ69925.1| hypothetical protein SL003B_1497 [Polymorphum gilvum SL003B-26A1]
          Length = 1768

 Score =  271 bits (694), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 378/1848 (20%), Positives = 795/1848 (43%), Gaps = 313/1848 (16%)

Query: 104  AFMSSLIWLACELGFLIKFYTNS--PMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIM 161
            A + ++ W A      +  + +    +      A  P +I L  V  VVPIL F+   +M
Sbjct: 107  ALLLTVAWGAVGSALTLSTFGDQIDALTGIEQLAGSPALI-LAGVGVVVPILFFWVMAMM 165

Query: 162  ISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASEL 221
            I RA++M   ++ +  +ALRL +PE+ + E + S+  A+R+E+  M + I+RAI+RASEL
Sbjct: 166  IWRAQEMRIVARGMTEVALRLAEPEDMAKESVLSVGQAIRREVAAMGDGIERAIARASEL 225

Query: 222  EKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSL 281
            E  V +E+  LE +Y  +E++I  + + L  +REAII +  ++  SI+  HE    +LS+
Sbjct: 226  EVLVHNEVSSLERSYNDNELKIRALIEELVSQREAIIANAERVRESISGAHEQFAGQLSV 285

Query: 282  TSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTS--- 338
            TSEEI+  +  A D   + V+ RIA++T            T+ ++ID L   L S+    
Sbjct: 286  TSEEIARTVDSATDRLVNAVEDRIAELT-----------GTVDNRIDTLSASLTSSGNDL 334

Query: 339  ----IVITKDFDNR--------IESLSNTLNNSGRSL-----------ANQVGNYTLMLG 375
                 V   D+ +R        +++LS T N    +L           A    ++   L 
Sbjct: 335  VESLTVRADDYVSRLTTSGSEMVDNLSRTGNELWETLTLRGQEVNDRFAATASDFVETLS 394

Query: 376  NNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDS 435
                +++  L  ++Q+F +A       + +  + + + I  TL   L S R+        
Sbjct: 395  ARGGEINDTLNTRTQEFTEALERTGSSVGDTITRRGEEINATL--ALTSGRL-------- 444

Query: 436  FCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETF---NNSITDFSSFYKDNLSEFE 492
                + + T++ +  VD R   L+  ++   + +VE+       +TD  S     + E  
Sbjct: 445  -IDTITARTEDLIGTVDTRVTDLDTSLSRTGERVVESISQRGQEVTDTISVKGAEIVETL 503

Query: 493  SNLQGNIDK-LQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITS 551
            +     + + L+G        + DL L   + I + LD       + ++ +   +++   
Sbjct: 504  AERSTEVAEILRGT---GESIVVDLSLRGGE-IAAKLDDTAATLTETITGRGGELAERLG 559

Query: 552  MNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKL 611
              +ER+E  +T +   L D L  + Q +   I  ++     +  ++   +S  +  R   
Sbjct: 560  SISERIETAITVNGADLDDRLAARGQEMAMLIESQTSGFRETLEAASADISATLGHRTTE 619

Query: 612  FSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA 671
             +  LA   +     I    + +   I      + DKI   A  L    ++L   L A  
Sbjct: 620  LAQKLAETGTELARLIGTRGERVTSDI----GAVGDKI---AETLDSRGQALQEGLAARL 672

Query: 672  TDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSG 731
             ++   +    + LV  FD  S+ +  + +     L+  F   + S + + +++ + +  
Sbjct: 673  GELEQIVAERGSHLVEAFDGRSETLAQTLDQRLATLDATFDSRIGSLDSSLDSRINSLDL 732

Query: 732  ILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERC 791
             L+  T   +                  A +E+  + ++ A+       ET+S+ L+E+ 
Sbjct: 733  TLEQRTAAFE------------------AALETRSALLADAIASR---TETLSSTLEEKS 771

Query: 792  QELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLD 851
            + +   L + SD +   L +  E    + A+R        A++  +F    V+ +   + 
Sbjct: 772  RTIADVLADKSDAITFELSRRIETAGESLAER--------AEDVGRFMGERVDAAAAAMT 823

Query: 852  KLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEEC 911
            + +  + + T +  ++ ID              TL++ ++ + E + A    +AK F + 
Sbjct: 824  EKAEHLSE-TMLTGTERID-------------QTLDSRARQISETLIARTREIAKAFVDG 869

Query: 912  ---MSNILLS-YDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENS 967
               M+N L S  D+    L ++ ++  + L + +A    + + ++G+    + + LD  +
Sbjct: 870  QAEMTNALDSRLDQAGSVLARQSAELTESLSERIA----EFNVSLGAKVFEVAETLDTRA 925

Query: 968  SRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLEN 1027
            +++E++L+    S++ TL     + +R     +D + Q             +++T+N E+
Sbjct: 926  NQLETVLNDRLASISGTL---RTEAERARDALTDAMAQ-------------ASETLNGES 969

Query: 1028 NLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVN 1087
                     SRV D      + +S +  +LA+E    + +++ +  D++GKL    D + 
Sbjct: 970  ---------SRVRDM---VLEAVSHAAASLAEERTRTVETVTGTFADVTGKLSGEGDRLR 1017

Query: 1088 QKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDS--- 1144
            Q +       G+     + E  K        +++ T  +S +  +  D++ + + ++   
Sbjct: 1018 QLVLGA---VGEARGVLVGESQKAAGAVSAAMTEATSALSGEGSRVRDLVLSAVAEAARS 1074

Query: 1145 ----TSRVR----GEIVDISNKFI-ETSRVLEQREEKFHSALDSFSDNISRILLDVDHTI 1195
                + + R    G + D S     E++RV E               +++R + ++   +
Sbjct: 1075 MAAESEKARTLYVGTLADFSGSLTGESARVRE---------------DLARTIAEISGNL 1119

Query: 1196 SSHTNESRSLIEQRIHEVKDVLSN------------LDRALE---SYGSTVFKQF----K 1236
            S+ + ++R  + +   E+++++S             + +A E     G+ V K+      
Sbjct: 1120 SAESEQARLTLTRTAEEMRNLMSGEADIVRTRVSGAVQQAAELLSQRGNAVAKELLDKAS 1179

Query: 1237 EYVQCFETNMENMESLFDKNNDSMLLSFKERSN------------ILD----------NI 1274
            E    F T  +    L   + + ++ + + R++            ILD          +I
Sbjct: 1180 ELNAAFGTRSDEFAKLVGTDGNELIAAIEARASDLTTRVAEIHRAILDAVAVKGREVTDI 1239

Query: 1275 LSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSS 1334
             +Q  +E + S+  A    G+ +++ ID++   A   L + +  L +DV  I  R+  S+
Sbjct: 1240 FAQNGLEATRSLVDA----GDRIISGIDERSQRAVAMLDETKQRLEADVSDILQRLEQSN 1295

Query: 1335 QDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAE---SSKLFEKKIKDLGEIS 1391
              +  +++ A  +L++++  L +   R  E    +D  + E   S+ L ++++  L +++
Sbjct: 1296 ATLQDVMASAGTNLSEIETNLAR---RAGEFRTAVDRAVRETSASTGLIDEQVTALKDVT 1352

Query: 1392 RVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEA 1451
               L  +  + ++F + SQ L  +   L            +D N  V+  SR+  + +  
Sbjct: 1353 NTVLADIKALTARFGQQSQDLTAAARHL------------EDTNRAVE--SRVGERKTAI 1398

Query: 1452 QKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDH 1511
            +    ++L   + +        DT+++  T+++         TL   + ++R+   +   
Sbjct: 1399 EAVADTLLAKTETV--------DTLMRTFTNTLAE-------TLETADDKAREAASM--- 1440

Query: 1512 NLADIGNKTVKTIDSNFVTLKEKSYDLSNHMR-QKICSTIPNIENIFSTLEEKSDQSMQV 1570
             L        + +   F +++     L+  M  Q+    I +++          D+ M  
Sbjct: 1441 -LGAAAEAASRQVAEQFESMR-----LTAGMEGQRARDAIRSVQ----------DEIMAE 1484

Query: 1571 FLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIR 1630
               +++   + F +  S+  D     +R +  +L  +R  LK   ++L +EA+ES   +R
Sbjct: 1485 MGRTVSEASERFNEAASRMRD----VAREVHRELEATRKELKDGVLNLPEEAEESTAALR 1540

Query: 1631 SAIEEQINTLKDFQKLITDSVKNNA------------ASYNKGLHSD-------EYNISQ 1671
              + EQI  L +  +++  + ++NA            A++     S        E   + 
Sbjct: 1541 KVVNEQIRALTELSEIV--ARQSNALDISRPQERVASAAFPASGRSSASPRSEAEPRSAA 1598

Query: 1672 VDKRPS--GKKTK---------NNHAIKEWFNKIL--SSSTHSKGKSSSHIDISDKDSLS 1718
              +RP+   ++T               K W   +L  +S     G  +S    S    + 
Sbjct: 1599 APQRPAEPARRTPAPEPSAGVGTEPPAKGWVADLLRRASRDEETGAGASKPGRSALHMVE 1658

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID++ F+ LW  Y  GE  +F++RLYT++GQ+ F  ++++Y  D   R
Sbjct: 1659 SLNSLSMDIARAIDHETFIDLWDRYKRGERHVFTRRLYTLQGQQTFDEIRQKYGRDPEFR 1718

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRYI++FE++L+++++++ D+ L Q ++ S+ GKVYTML HASGR
Sbjct: 1719 TAVDRYITDFEQLLAQVSRNDRDNMLGQTYLTSDTGKVYTMLAHASGR 1766


>gi|307945706|ref|ZP_07661042.1| putative apolipoprotein A1/A4/E [Roseibium sp. TrichSKD4]
 gi|307771579|gb|EFO30804.1| putative apolipoprotein A1/A4/E [Roseibium sp. TrichSKD4]
          Length = 1874

 Score =  259 bits (662), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 396/1938 (20%), Positives = 817/1938 (42%), Gaps = 329/1938 (16%)

Query: 77   ANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFY--TNSPMDSFYDF 134
            AND D   I +++  + +   +     A   +L+W        I  +  T S +  F   
Sbjct: 76   AND-DRRNIGNLIYALQRRPSSAPFWGALALTLLWGGVGTSLAISSFGDTLSGLTGFGSI 134

Query: 135  AMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQ 194
            A  PE+I L  +  +VPI+ F+   +MI RA++M   ++ +  +ALRL +PE+ + E + 
Sbjct: 135  AQSPELI-LAAIAVIVPIIFFWVMAMMIWRAQEMRIVARGMTEVALRLAEPEDMAKESIL 193

Query: 195  SISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQER 254
            S+  A+R+E+  M + I+RAI+RASELE  V +E+  LE +Y  +E++I ++ + L  +R
Sbjct: 194  SVGQAIRREVAAMGDGIERAIARASELEVLVHNEVSSLERSYNDNELKIRSLIEELVSQR 253

Query: 255  EAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTR 314
            EAI+N+  ++  +I+  HES   +LS +S E    +  A D     V+ R+ ++T     
Sbjct: 254  EAIVNNADRVRETISSAHESFASQLSSSSGEFGESVDNATDKMLEAVNARVEELTSTVDD 313

Query: 315  IVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLML 374
             +     +++S  ++L+E L     V  +D+ NR+ +    L ++  S  NQ+  +  + 
Sbjct: 314  RIASLGSSLTSSGNKLVESL----TVRAEDYVNRLTTTGTDLVDNLSSTGNQM--WETLS 367

Query: 375  GNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQ---- 430
               TD ++    E + +F+   T    E++   +    ++  TL+   + LR+S++    
Sbjct: 368  SRGTD-INSRFAETADRFVDMLTVRGEEINTNLTTSTSTVVETLSQKAEELRVSMESTGN 426

Query: 431  -------EKEDSFCSNLK-----------STTDNTLREVDNRTNTLE------------- 459
                   ++ +   +NL            S T+  +  VD R  TL+             
Sbjct: 427  TVGETISQRGEEINANLSLTSGRLIDTITSRTEELIGTVDTRVTTLDASLAATGDRVVES 486

Query: 460  ---------NRITAFLKEIVETFNNSITDFSSFYKDN------------------LSEFE 492
                     N I+    EIVET ++  T+ +   +                    L E  
Sbjct: 487  ISERGQDVTNTISVKGAEIVETLSDRSTEVAEILRGTGESIVVDLSLRGGEIASKLDETA 546

Query: 493  SNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSM 552
              L   I    G  A+    + D   S I   G +LD++       L+ + N +S I   
Sbjct: 547  GTLTETITVQGGTLAEKLETISDRIYSAITVNGDSLDER-------LAARGNEMSAILEQ 599

Query: 553  NT----ERLEN-------TLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKV 601
                  E LE+       +L    N     L E   ++ S IG + + +    N +  K+
Sbjct: 600  QNIAFRETLESVSADVTASLGYQTNEFSQRLAETGTQLASLIGGRGDRIAGDINQAGDKI 659

Query: 602  SNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNST------------------- 642
               I  R +L   +LA   +  +  +      ++++    T                   
Sbjct: 660  IEAIDVRGRLLEENLATRLTELDSIVTDKGGYLIEAFDTKTLLLSESLDSRLATLDTTFS 719

Query: 643  -------NNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKN 695
                    +L D++  +   L E  + +D +L+   + +   + +  + +     E   +
Sbjct: 720  TRVDTLDASLGDRVASIDLTLDERLRLIDTTLEDRVSSIGSTMDDRISSIDTTLGERISS 779

Query: 696  IICSYNSSNNKLETIFQKHLHSF-----------NDTFNNKSDHVSGILKNSTQHIDDLF 744
            I  S  S  N L+    +   +F           +DT + ++  +S  L   T++I D+ 
Sbjct: 780  IDASLGSHINTLDLTLDQRTATFEAALEGRTQILSDTIDQRTTGISEALDEKTRNITDVL 839

Query: 745  SNNAK----RMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVN 800
            ++ +     ++ E + +    + +    I KA+N+ +D+    S ++ ++ + L   + +
Sbjct: 840  ADRSDAITVQLGERVEAAGDTLATRAEEIGKALNERVDEA---SASMVDKAEHLAQTMSD 896

Query: 801  HSDKVLSSL----KQAQELLCTTFAQRNDSFV-------NALADNQSKFENNLVNQSHLL 849
             +D++  +L    +Q  E L +   + +++FV       NAL +  S+  + L  QS  L
Sbjct: 897  GTDRIDETLDARARQISETLISRTKEISEAFVSGQNEMTNALDNRLSEAGSVLAKQSTEL 956

Query: 850  LDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFE 909
             D LS  I ++     +K  +VA +L    G +   L       LE IS + +  ++   
Sbjct: 957  TDSLSERIAEINVSLGAKVFEVAETLDARAGQLETILNER----LETISGTLSGESQKAL 1012

Query: 910  ECMSNILLSYDENRQTLDKKLSDHI-DVLRQ---NLAGS----ENKIDGAIGSASQFIRD 961
            + ++N++        T   ++ D + + + Q   +L+G     +N +DGA+  A   +  
Sbjct: 1013 DILTNVVSEAGTTLSTESTRMRDMVTEAVAQAVASLSGEGHQIKNIVDGAVTDA---VSK 1069

Query: 962  ILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQ 1021
            + DE S  +  +++ + N   + +    ++  +++     E   +L +++   + ++S  
Sbjct: 1070 LADERSKTV-GIVTGTLNDATTKISDESERMRQIILGSVGEARGMLSSESERATESISGA 1128

Query: 1022 TINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQE----LVSVIGSMSQSTTDISG 1077
                   L  + + +  +V         + D+ +T+A E        +G++++ +  ++G
Sbjct: 1129 MDLARGTLSSESEKVRELV------LSAIGDAARTMAAESENARALYVGTLAEFSGSLTG 1182

Query: 1078 KLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVI 1137
            + E           K RE  G  I      +S   E + + +++  +EI  Q+    +V+
Sbjct: 1183 ESE-----------KVREELGRTIAEISGNLSSESEQARQTLAKTLEEIRGQMSGEAEVV 1231

Query: 1138 TNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISS 1197
              ++ ++ +     + D  N     +  L  +    + A ++ S  +S+I       I +
Sbjct: 1232 RARVNNAVNEAADLLRDRGNSV---AAELLDKANNLNEAFNAQSGELSKI-------IGT 1281

Query: 1198 HTNESRSLIEQRIHE----VKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLF 1253
              NE    IE R  +    V DV S +  A+   G  V   F       +  +E   SL 
Sbjct: 1282 DGNELVEAIENRAKDLTTRVSDVHSAILDAITVKGREVSDAFA------QNGLEATRSLM 1335

Query: 1254 DKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALK 1313
            +   D ++ S  E+        SQ++ E+  S +       + +V  ++ +   AA+ L 
Sbjct: 1336 EA-GDHVVASMTEQ--------SQKAAEVMTSAN-------DRLVASLEDRSKRAADLLV 1379

Query: 1314 KLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVL 1373
              +  L +D+ +I  ++  S+  + ++I+ A  +LN+V+  L +   R  E    +D  +
Sbjct: 1380 DTKRRLETDITEILEKLDTSNTTLQSVITQAGTNLNEVEVNLGR---RAGEFRSAVDRAV 1436

Query: 1374 AESSK---LFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSL 1430
            A+++    +  +++  L  ++  +L  +  + ++   +S  L  +   L K         
Sbjct: 1437 ADTTATNSVITEQVDALRTVTETTLADIQALTNRLGDHSSALSDAARYLEK--------- 1487

Query: 1431 DKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIK 1490
                N  V+  SR+  + +  ++   ++L   + +        DT++++ T S+      
Sbjct: 1488 ---TNQTVE--SRVGERKTAIEEVAETLLSKTEAV--------DTLMRSFTASLSE---- 1530

Query: 1491 IDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTI 1550
               TL   + ++R+  R+    L+       K +   F +++  +       R+ I +  
Sbjct: 1531 ---TLETADDKAREAARM----LSAAAEAATKNVSEQFESMRMTAGMEGQKARETIRAAQ 1583

Query: 1551 PNIENIFS-TLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRD 1609
             +I +  S T+ E S++               F    S+  D     +R +  +L  +R+
Sbjct: 1584 DDIMSEMSRTVAEASER---------------FNDAASRMRD----VARDVHLELEATRN 1624

Query: 1610 ILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAAS------------ 1657
             LK+  +SL  EA+ES+  IR  + EQI  L +   ++         S            
Sbjct: 1625 ELKQGVLSLPDEAEESSAAIRKVVNEQIRALSELSDIVAKQANTLDVSRPQMQVAAAAPA 1684

Query: 1658 ---------------------------YNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEW 1690
                                        ++ + +        ++ PSGK          W
Sbjct: 1685 PAPAPQSYAPAPTPAPAPAPTEVAQREPSRPMEAPRRPAPAAEEAPSGKG---------W 1735

Query: 1691 FNKILSSSTHSKGKSSSHIDISDKD--SLSSIDSLVENISKFIDYDAFVQLWKSYTLGED 1748
             + +L  ++    + +S + ++     S  S++SL  +I++ ID++ F+ LW  Y  GE 
Sbjct: 1736 VSDLLRRASRDD-EPNSDVTVAPGPLKSFESLNSLSVDIARAIDHETFIDLWARYKQGER 1794

Query: 1749 DIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEH 1808
             +F++RLYT++GQ+ F  ++++Y  D   R+A++RY+++FE++L ++A+++ D+ L Q +
Sbjct: 1795 HVFTRRLYTLQGQQTFDEIRQKYARDPEFRSAVERYVTDFEQLLQQVARNDRDNMLGQTY 1854

Query: 1809 IMSNYGKVYTMLVHASGR 1826
            + S+ GKVYTML HASGR
Sbjct: 1855 LTSDTGKVYTMLAHASGR 1872


>gi|319783790|ref|YP_004143266.1| kinesin-like protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317169678|gb|ADV13216.1| kinesin-like protein [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 2101

 Score =  202 bits (513), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 360/1715 (20%), Positives = 683/1715 (39%), Gaps = 363/1715 (21%)

Query: 67   NKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNS 126
            N    +GF PAND        +L ++ + + N         SL W A   G     +  S
Sbjct: 96   NGAQPAGFAPANDDRQKDYKTLLHSLNRRASNTIYWVVAFVSLAWFAGAGGLANLLFGPS 155

Query: 127  --PMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLID 184
               + +   F  RPE+I L  V ++VP++LF++F  MI RA++M  A+QS+  +A RL +
Sbjct: 156  IWRIRTLDQFLARPELIGLA-VAAIVPVILFWAFAAMIRRAQEMRIAAQSMTEVAFRLTE 214

Query: 185  PEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRID 244
            PE  + +++  I  AVR+E+  M E I+R ++RA ELE  V SE+  +E +Y+++E RI 
Sbjct: 215  PENLAQDRVMMIGQAVRREVAAMGEGIERTLARAVELETLVHSEVNQIERSYSENESRIR 274

Query: 245  NITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS--------------------- 283
            ++   L  EREA++ H  ++  SI   HE+LK+E+   S                     
Sbjct: 275  SLVDGLGSEREAVVTHAERVRASITGAHETLKDEIGAASDIIRDSILNASTKLSMTITNS 334

Query: 284  -----------------------EEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESA 320
                                   + I+  LS + ++F S++D RIAK+T+ T  + +   
Sbjct: 335  GDTLIDRINESSMSIFDSVEGRLDSITDRLSTSGEAFASLLDTRIAKLTDTTDGLTRSLT 394

Query: 321  QTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDK 380
              +  +   ++ +L   +  +  +F+  +  +  TL   G++L ++       L   T K
Sbjct: 395  DLLDDRTTGMVSLLGGAARTLNSEFEASLNGIERTLAERGQALISEFQTRAEALDTGTQK 454

Query: 381  VSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN-----------DVLQSLRISL 429
            ++ AL+ +++Q  +       E+++ F+E + +++  ++           D++ S    L
Sbjct: 455  LNAALEARARQINETLVERAREIAHTFAESKDTLSAMIDQGKTQIGADMADIVTSTSSML 514

Query: 430  QEKEDSFCSNLKSTTDNTLREVDNRTNTLEN-RITAFLKEIVETFNNSITDFSSFYKDNL 488
            + +   F   +++      R  D+    L + R+   ++E VE            +   L
Sbjct: 515  EARASDFAGRMEAARHVVSRSFDSDIQRLADARVG--IEEAVEN-----------HSRKL 561

Query: 489  SEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTI--GSNLDKKTLLFEDILSKKQNNI 546
            SE    +   ++     FA+    ++    + +Q +  G +L  +  L ED+    ++  
Sbjct: 562  SESRERMAAAMEADLAKFAEGRAGIDAAVTNQVQKLAEGRSLISRA-LEEDLRKVNESRA 620

Query: 547  SQITSMNT--ERLE---NTLTNSINSLKDMLEEKRQRID----SDIGKKSEE---LCSSF 594
            +   S+ +  ERLE   N L+ ++N     L + R  ID      +GK +E    L  + 
Sbjct: 621  AIDASLGSHLERLEEGRNRLSIALNEDSGKLVQARTIIDEMVAGHVGKLAEGRNILSRAL 680

Query: 595  NSSYQKVSNVISDREKLFSNSLARVQSH-------FEETIAG-------HPQSIVD---S 637
             +   K+S+  +D + L +  + ++           E  I G       H   + +    
Sbjct: 681  EADLGKLSDSRADIDGLVAGQVEKIAEGRAVLAKALENDIVGIKSLIETHSAKLAEDRTQ 740

Query: 638  ISNSTNNLYDKIMVLA----------------------AALSESQKSLDNSLKAHATDVV 675
            +S+S +N    I  L                       A L+ES+ S+D  +       V
Sbjct: 741  LSHSLDNDLSGIRGLIESHSGRLAEDRSLLSQTLEADLAKLAESRSSIDGLVAGQ----V 796

Query: 676  HKITNAENQLVNRFDESSKNIICSYNSS--------NNKLETIFQKHLHSFNDTFNNKSD 727
             K+    + ++ R  ES  N I    SS          +L  + +  L + N      +D
Sbjct: 797  EKLAEGRD-ILKRALESDLNTIKGVISSQSEKLAEDRGQLSRVLEADLQNVNSVI---AD 852

Query: 728  HVSGI-----------------LKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAIS 770
            H++ +                 L +S   ID L +   +++ E        +ES+L+AI 
Sbjct: 853  HMNKLVQDRSALSRALEDDLAKLADSRSSIDGLVAGQVEKLSEGRDILRRALESDLNAIK 912

Query: 771  KAM----NKSIDDVETISTALKERCQELGSDLVNHSDKVL---SSLKQAQEL-------L 816
              +     K +DD    + AL+   + +   + +HS++++   S+L +A E        L
Sbjct: 913  GTIADQSQKLVDDRAQFARALEADLESVNGLVNSHSERLVQDRSTLSKALEADLENVGGL 972

Query: 817  CTTFAQR----NDSFVNALADNQSKFENN--------------LVNQSHLLLDKLSSDIQ 858
              + A+R      +   AL D+ +K   +              L     +L   L +D+ 
Sbjct: 973  VNSHAERLVQERSTLSKALEDDLAKLAESRSSIDGLVAGQVEKLAEGRDVLKRALEADLA 1032

Query: 859  KLTDIAYS--------------------KAIDV-ANSLTEIQGNVGVTLENHSQAMLEKI 897
            KL +   S                    +A++     LTE + ++   +  H    + K+
Sbjct: 1033 KLAESRSSIDGLVAGQVEKLAEGRDILKRALEADLQKLTESRSDIDDVIAGH----VGKL 1088

Query: 898  SASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQ 957
            S    ++ +  E+ +  +     E R+ +D+ LS HID +     G  + I   +    Q
Sbjct: 1089 SEGRNMLTRALEDDLGKLA----ETRKDVDRSLSGHIDQIAARSTGISDAIAADVEKIEQ 1144

Query: 958  -FIR--DILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCL 1014
             F R   I++E +  +E  LS   ++V + L +S       L+EK  E+   L  +A   
Sbjct: 1145 AFSRQTGIIEERAGTMERALSTGVDNVRAVLEKSAVFVAGALREKVLEVTSTLHEQAGAA 1204

Query: 1015 ---------------STAVSTQTINLENNLKEQEKS------------LSRVVDTSASSF 1047
                           S A+  +  ++    +E ++             L+R  DTS+S  
Sbjct: 1205 FSDADRKIAERAEQTSAALLARAEDIARTFEEADRRLHARAEDTSNALLARADDTSSSLL 1264

Query: 1048 KYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDE 1107
                ++   LA     + G+   +   ++ + + + D +  + Q       D++ A   E
Sbjct: 1265 ARAHETADQLAARANQIAGTFEAADQKLAARAQETADQLTARAQDT----ADHLAARASE 1320

Query: 1108 ISKVMEISEKRISQRTQEISQQL-LQNNDVITN----------QIIDSTSRVRGEIVDIS 1156
            I+   + +++++  R  E +Q L  +  D++ N          +I +S   +     D+ 
Sbjct: 1321 IAGTFDAADQKLVARAIETAQSLAARAGDILRNFEGADQRLGMRIGESAEALAARASDLG 1380

Query: 1157 NKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLI---------- 1206
              F    + L  R  +   AL S +  I RI  D D  + S    S + I          
Sbjct: 1381 RIFDAADQQLVSRIAEGSEALSSRASEIGRIFDDADQRLVSRIASSTTTIGEHAETIVGA 1440

Query: 1207 ----EQRI---------------HEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNME 1247
                EQR+                E++  L+  D  L S  +    + +E +   E  + 
Sbjct: 1441 FADTEQRVAERARRTGQEMAVHAREIEQALAGADERLASSAAAAAARVEEQISGVENRLA 1500

Query: 1248 -NMESLFDK------NNDSMLLSFKERSNI-----------------------------L 1271
               E++  K      N ++ L+S   R+N+                             L
Sbjct: 1501 FTAETMGQKLNEQVSNAEAQLVS---RANVIAETFTAVGQHIGQSTNDAAKTIGANTREL 1557

Query: 1272 DNILSQRSMEISD-------SISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLI---- 1320
            + +L+ RS E+S         +   F + G+ +   +++    A   L+   A L+    
Sbjct: 1558 NTMLAARSAEMSKILDETARPLVERFAQGGSELQKSMEEVTERATEKLRSENAALVDALA 1617

Query: 1321 -----------------SD-VEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRI 1362
                             SD V  +  R+T SS  +  +I  A  +L +VDERL  +T   
Sbjct: 1618 NRTAETLSAVEGARSSLSDSVADLIGRMTKSSSQLGQLIEQAAVNLGQVDERLSGSTQSF 1677

Query: 1363 TETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKA 1422
              TT       A S++L +     L E+S  +L +++ I +KFD++S++L  + D L  A
Sbjct: 1678 AATTEKAAQTFASSARLVDSNTTRLTELSSSTLREVASIATKFDEHSRLLSSASDLLSSA 1737

Query: 1423 QSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMS 1457
            QS  + +L++  ++L DL   LV KS + ++ + S
Sbjct: 1738 QSNLEHTLERQ-SSLEDLAVGLVKKSEDLERVMRS 1771



 Score =  176 bits (446), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 359/1773 (20%), Positives = 716/1773 (40%), Gaps = 365/1773 (20%)

Query: 256  AIINHG-TQLCTSIAEVHESLKEELSLTSEEISVHL-------SRAIDS-FQSIVDVRIA 306
            A+I+ G TQ+   +A++  S    L   + + +  +       SR+ DS  Q + D R+ 
Sbjct: 490  AMIDQGKTQIGADMADIVTSTSSMLEARASDFAGRMEAARHVVSRSFDSDIQRLADARVG 549

Query: 307  --KVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNT--------- 355
              +  E  +R + ES + +++ ++  L         I     N+++ L+           
Sbjct: 550  IEEAVENHSRKLSESRERMAAAMEADLAKFAEGRAGIDAAVTNQVQKLAEGRSLISRALE 609

Query: 356  -----LNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFT-------SHICEM 403
                 +N S  ++   +G++   L    +++SIAL E S + +QA T        H+ ++
Sbjct: 610  EDLRKVNESRAAIDASLGSHLERLEEGRNRLSIALNEDSGKLVQARTIIDEMVAGHVGKL 669

Query: 404  SNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRIT 463
            +    E +  ++  L   L  L  S  + +      ++   +   R V      LEN I 
Sbjct: 670  A----EGRNILSRALEADLGKLSDSRADIDGLVAGQVEKIAEG--RAV--LAKALENDIV 721

Query: 464  AFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQT 523
              +K ++ET +  + +  +    +L    S ++G I+   G  A+         LS  QT
Sbjct: 722  G-IKSLIETHSAKLAEDRTQLSHSLDNDLSGIRGLIESHSGRLAEDRS-----LLS--QT 773

Query: 524  IGSNLDKKTLLFEDILSKKQNNISQITSMNTERL-------ENTLTNSINSLKDMLEEKR 576
            + ++L K        L++ +++I  + +   E+L       +  L + +N++K ++  + 
Sbjct: 774  LEADLAK--------LAESRSSIDGLVAGQVEKLAEGRDILKRALESDLNTIKGVISSQS 825

Query: 577  QRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVD 636
            +++  D G    +L     +  Q V++VI+D                      H   +V 
Sbjct: 826  EKLAEDRG----QLSRVLEADLQNVNSVIAD----------------------HMNKLVQ 859

Query: 637  SISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNI 696
              S  +  L D +    A L++S+ S+D  +       V K++   + ++ R  ES  N 
Sbjct: 860  DRSALSRALEDDL----AKLADSRSSIDGLVAGQ----VEKLSEGRD-ILRRALESDLNA 910

Query: 697  I-CSYNSSNNKL-------ETIFQKHLHSFNDTFNNKSDHV-------SGILKNSTQHID 741
            I  +    + KL           +  L S N   N+ S+ +       S  L+   +++ 
Sbjct: 911  IKGTIADQSQKLVDDRAQFARALEADLESVNGLVNSHSERLVQDRSTLSKALEADLENVG 970

Query: 742  DLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNH 801
             L +++A+R+ +   + S  +E +L+ ++++ + SID    +     E+  E G D+   
Sbjct: 971  GLVNSHAERLVQERSTLSKALEDDLAKLAESRS-SIDG---LVAGQVEKLAE-GRDV--- 1022

Query: 802  SDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLT 861
                   LK+A E      A+   S    +A    K    L     +L   L +D+QKLT
Sbjct: 1023 -------LKRALEADLAKLAESRSSIDGLVAGQVEK----LAEGRDILKRALEADLQKLT 1071

Query: 862  DIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDE 921
            + + S   DV      I G+VG            K+S    ++ +  E+ +  +     E
Sbjct: 1072 E-SRSDIDDV------IAGHVG------------KLSEGRNMLTRALEDDLGKLA----E 1108

Query: 922  NRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQ-FIR--DILDENSSRIESLLSCSN 978
             R+ +D+ LS HID +     G  + I   +    Q F R   I++E +  +E  LS   
Sbjct: 1109 TRKDVDRSLSGHIDQIAARSTGISDAIAADVEKIEQAFSRQTGIIEERAGTMERALSTGV 1168

Query: 979  NSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCL---------------STAVSTQTI 1023
            ++V + L +S       L+EK  E+   L  +A                  S A+  +  
Sbjct: 1169 DNVRAVLEKSAVFVAGALREKVLEVTSTLHEQAGAAFSDADRKIAERAEQTSAALLARAE 1228

Query: 1024 NLENNLKEQEKSL------------SRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQS 1071
            ++    +E ++ L            +R  DTS+S      ++   LA     + G+   +
Sbjct: 1229 DIARTFEEADRRLHARAEDTSNALLARADDTSSSLLARAHETADQLAARANQIAGTFEAA 1288

Query: 1072 TTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLL 1131
               ++ + + + D +  + Q       D++ A   EI+   + +++++  R  E +Q L 
Sbjct: 1289 DQKLAARAQETADQLTARAQDT----ADHLAARASEIAGTFDAADQKLVARAIETAQSLA 1344

Query: 1132 -QNNDVITN----------QIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSF 1180
             +  D++ N          +I +S   +     D+   F    + L  R  +   AL S 
Sbjct: 1345 ARAGDILRNFEGADQRLGMRIGESAEALAARASDLGRIFDAADQQLVSRIAEGSEALSSR 1404

Query: 1181 SDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQ 1240
            +  I RI  D D  + S    S + I +    +    ++ ++ +        ++   + +
Sbjct: 1405 ASEIGRIFDDADQRLVSRIASSTTTIGEHAETIVGAFADTEQRVAERARRTGQEMAVHAR 1464

Query: 1241 CFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNV 1300
              E  +   +     +  +     +E+ + ++N L             AF  E   +   
Sbjct: 1465 EIEQALAGADERLASSAAAAAARVEEQISGVENRL-------------AFTAE--TMGQK 1509

Query: 1301 IDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTN 1360
            +++Q+ NA       EA L+S    I    T   Q +    +DA  ++      L+    
Sbjct: 1510 LNEQVSNA-------EAQLVSRANVIAETFTAVGQHIGQSTNDAAKTIGANTRELNTM-- 1560

Query: 1361 RITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVS-KFDKNSQILIKSHDSL 1419
             +   +  +  +L E+++   ++    G   + S+ +++E  + K    +  L+   D+L
Sbjct: 1561 -LAARSAEMSKILDETARPLVERFAQGGSELQKSMEEVTERATEKLRSENAALV---DAL 1616

Query: 1420 MKAQSETKLSLDKDANNL----VDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDT 1475
                +ET  +++   ++L     DL  R+   SS+  + +    V++ ++        D 
Sbjct: 1617 ANRTAETLSAVEGARSSLSDSVADLIGRMTKSSSQLGQLIEQAAVNLGQV--------DE 1668

Query: 1476 VVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHN---LADIGNKT---VKTIDSNF- 1528
             +   T S  ++  K   T ++       + RL+D N   L ++ + T   V +I + F 
Sbjct: 1669 RLSGSTQSFAATTEKAAQTFAS-------SARLVDSNTTRLTELSSSTLREVASIATKFD 1721

Query: 1529 ----------------------------------VTLKEKSYDLSNHMRQ---KICSTIP 1551
                                              V L +KS DL   MR     +  T+ 
Sbjct: 1722 EHSRLLSSASDLLSSAQSNLEHTLERQSSLEDLAVGLVKKSEDLERVMRSFENLVGQTLQ 1781

Query: 1552 NIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDIL 1611
            N E        K+ +S     +++ + VDS T++ +  ++++  T+  I  +L+ +R  L
Sbjct: 1782 NAEG-------KTMESADKIRNAITDVVDSATKRFADATEEMRRTAGSIKSELDLTRAEL 1834

Query: 1612 KRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHS------- 1664
            K+  + + +EAKES   IR A+ EQIN LK+   ++  S +    S  + L         
Sbjct: 1835 KKGVIEMPEEAKESTSAIRRAVSEQINALKELSDIVAKSGRGGEGSEPRNLRPAPQAPAA 1894

Query: 1665 --------------------------------DEYNISQVDKRPSGKKTKNNHAIKEWFN 1692
                                            D    ++   RP G  +        W  
Sbjct: 1895 RAAEPPRRAPAPQPDLRTPQAPLGGPALRGTLDLDRPTEAAPRPRGDASARTPQ-GGWVR 1953

Query: 1693 KILSSSTHSKG-------------------KSSSHIDISDKDSLSSIDSLVENISKFIDY 1733
             +L+++++ +                    +S  H+       + S++SL  +I++ ID+
Sbjct: 1954 DLLTAASNEEDLRSAAPPAAAEAPRATPAQRSPLHV-------VESLNSLSVDIARAIDH 2006

Query: 1734 DAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLS 1793
            DA ++LW  Y  GE D+F++RLYT+KGQ+ F  ++ +Y+A++  R A+DRY  +FE++L 
Sbjct: 2007 DASIELWNRYRRGERDVFTRRLYTLKGQQTFDEIRRKYQAEAEFRAAVDRYCDDFEKLLK 2066

Query: 1794 EIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            ++++++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 2067 DVSRNDRDNIMAQTYLTSDTGKVYTMLAHASGR 2099


>gi|118588752|ref|ZP_01546160.1| hypothetical protein SIAM614_18639 [Stappia aggregata IAM 12614]
 gi|118438738|gb|EAV45371.1| hypothetical protein SIAM614_18639 [Stappia aggregata IAM 12614]
          Length = 1923

 Score =  202 bits (513), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 334/1654 (20%), Positives = 678/1654 (40%), Gaps = 256/1654 (15%)

Query: 243  IDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVD 302
            ID IT   ++    + N  T L  S+AE    + E +S   + ++  +S           
Sbjct: 454  IDTITSRTEELVATVDNRVTTLDESLAETGNRVVESISEKGQAVTDTIS----------- 502

Query: 303  VRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRS 362
            +R A++ E           T+SS+  ++ E+L  T   I  D   R   +++ L+ +  S
Sbjct: 503  IRGAEIVE-----------TLSSRSTEVAEILRGTGESIVVDLSLRGGEIASKLDETAGS 551

Query: 363  LANQV----GNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTL 418
            L   +    G     L N ++++  A+     +  +   +   EM++   ++      TL
Sbjct: 552  LTQTISVRGGELAEKLDNISERIYTAISINGSELDERLAARSNEMASVLEQQTIGFRETL 611

Query: 419  NDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLE---NRITAFLKEIVETFNN 475
              V      SL ++  +    L  T       + +R + +    N+I+  + E +E    
Sbjct: 612  ESVSGEFSASLGDQTGALTQKLAETGTQLAELIGSRGDRVAGDINQISGKIAETLEVRGQ 671

Query: 476  SITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLF 535
            ++ D               L   + +L+    D  G + D F           D KTLL 
Sbjct: 672  ALQD--------------GLSSRLSELETIVTDRGGQLIDAF-----------DTKTLLL 706

Query: 536  EDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFN 595
             D L  + + +    +   + ++ +L N I ++   L+++   ID+ +  +   + +S  
Sbjct: 707  SDALDSRLSTLDTTFATRIDSMDASLGNRIAAMDASLDQRYSAIDATLNDRIAAMDASLE 766

Query: 596  SSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAA 655
              Y  +   +S+R       +A + +  E+       ++ D I+   ++L  +   + A 
Sbjct: 767  HRYTAIDTSLSER-------IAAMDATLEQRYTSIDTTLSDRIATMDSSLEHRFTTMDAT 819

Query: 656  LSESQKSLDNSLK-------AHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLE 708
            L E   ++D SL+       A  TD +  +  +  Q ++  D S    I + ++S     
Sbjct: 820  LGERIGTMDASLEQRYSLMDATLTDRISTLDTSLEQRLSSMDSSLSERISTMDAS----- 874

Query: 709  TIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSA 768
                 H+++ + T + ++      L+  TQ + D   N    + + L   + NI   L+ 
Sbjct: 875  --LGSHINTLDLTLDQRTAAFEATLEARTQILSDAIENRTTGISDALEEKTRNITDVLAD 932

Query: 769  ISKAMNKSIDD-VETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSF 827
             S A+   +   +E     L ER +E+G  L    D   S++    EL+  +     D  
Sbjct: 933  RSDAITLQLGQRIEAAGNTLAERAEEIGQSLSQRVDTATSAMADKAELISASMTSGTDRI 992

Query: 828  VNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLE 887
               L     +    L++++  +         ++T      A+D  N L E    +G   E
Sbjct: 993  DETLDARARQISETLISRTKEIAKAFVDGQDEMT-----SALD--NRLAEAGSVLGKQSE 1045

Query: 888  NHSQAMLEKISASN-TLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSEN 946
              ++++ E+I+  N +L AK FE              +TLD + +    +L + L     
Sbjct: 1046 QLTESLSERIAEINVSLGAKVFEVA------------ETLDSRATQLETLLNERL----E 1089

Query: 947  KIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQL 1006
             I G +   S+  RDIL    S   + LS  +  +   +  +     + L ++ +  +++
Sbjct: 1090 SISGTLTGESERARDILTAVISEAGATLSTESTRLRDVVQEAVTAAVQTLSDERNRTVEI 1149

Query: 1007 LDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIG 1066
            +D   S L+ A  T+ ++ E +   Q      V+ +   +   L    Q  A    +V  
Sbjct: 1150 VD---SALTQA--TEKLSGEGDRMRQ-----IVLGSVGEARGVLVGESQKAAD---AVTS 1196

Query: 1067 SMSQSTTDISGKLEISLDSVNQKIQKCREFF----GDNIVAFMDEISKVMEISEKRISQR 1122
            +M+Q+T  +SG+             K RE      GD   A   E  K   +    ++  
Sbjct: 1197 AMNQATGAMSGE-----------SGKIRELVLSAVGDAARAMAAESEKARTLYAGTLA-- 1243

Query: 1123 TQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSD 1182
              E S  L   ++ + N++        G I +IS      S   EQ        L+    
Sbjct: 1244 --EFSGSLTGESEKVRNEL-------SGLIAEISGNLSAES---EQARMTLAKTLEEIRG 1291

Query: 1183 NISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRAL---ESYGS-------TVF 1232
             +S     V   ++S   E+  L+  R +EV + L  LD+A    E++G+        V 
Sbjct: 1292 QMSSEAGMVRARVNSAVTEAADLLVGRGNEVANEL--LDKATALNEAFGARSGELAKIVG 1349

Query: 1233 KQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHK 1292
                E +   E    ++     + + ++L +   +   + +  +   ++ + S+  A   
Sbjct: 1350 TDGNELISAIELRANDLTGRLSEVHTAILEAITVKGRDVTDTFAHTGLDATRSLVEA--- 1406

Query: 1293 EGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVD 1352
             G+ +V  I+++   A   L   +  L +DV +I N+I  S+ ++  I++ A ++LN+V+
Sbjct: 1407 -GDRIVASINERSEQATALLTDTKRRLEADVTEILNKIETSNTNLQGIVATAGENLNEVE 1465

Query: 1353 ERLHQTTNRITETTGHIDTVLAES---SKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNS 1409
              L +   R  E    +D  ++E+   + L  +++ +L +++  +L  +  +  +F   S
Sbjct: 1466 GNLAR---RAGEFRSAVDRAVSETNSTTALITEQVANLRDVTDTTLADIKNLTGRFGDQS 1522

Query: 1410 QILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQA 1469
            + L K+   L            +D N  V+  SR+  + +  +    ++L   + +    
Sbjct: 1523 EELTKAARHL------------EDTNRSVE--SRVTERRTAIEDVADTLLAKTEAV---- 1564

Query: 1470 DFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFV 1529
                DT++++ T ++         TL + + ++RD   +    L+       K +   F 
Sbjct: 1565 ----DTLMRSFTSTLSE-------TLESADDKARDAANM----LSAAAEAASKQVSEQFE 1609

Query: 1530 TLKEKSYDLSNHMRQKICSTIPNI-ENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSK 1588
            +++  +       R  I S   +I   +  T+ E SD+               F    ++
Sbjct: 1610 SMRLTAGMEGQKARDAIRSAQDDIIAEMTRTVTEASDR---------------FNDAAAR 1654

Query: 1589 TSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLIT 1648
              D     +R +  +L  +R  LK+  ++L +EA+ES+  +R  + EQI  L +  +++ 
Sbjct: 1655 MRD----VAREVHRELEATRSELKQGVLNLPEEAEESSAALRKVVNEQIRALTELSEIV- 1709

Query: 1649 DSVKNNA-------------------------ASYNKGLHSDEYNISQVDKRPSGKKTKN 1683
             + ++NA                          +Y     + + +    + RP+   T+ 
Sbjct: 1710 -AKQSNALDISRPQAQAAAASAAPAPQQPAPTVTYAPATPTRQQSAPASEPRPAPVNTRR 1768

Query: 1684 NHAI---------KEWFNKILSSSTHSKGKSSSHIDISDKD--SLSSIDSLVENISKFID 1732
                         K W   +L  ++     + S  D+S     ++ S++SL  +I++ ID
Sbjct: 1769 QQPAAAESTSSGGKGWVADLLRRASRDD-DAGSDTDMSRTPLHTVESLNSLSVDIARAID 1827

Query: 1733 YDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEML 1792
            ++ FV LW  Y  GE  +F++RLYT++GQ+ F  ++++Y  D   R A++RY+++FE++L
Sbjct: 1828 HETFVDLWNRYRNGERHVFTRRLYTLQGQQTFDEIRQKYARDPEFRTAVERYVADFEQLL 1887

Query: 1793 SEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +++++++ D+ L Q ++ S+ GKVYTML HASGR
Sbjct: 1888 AQVSRNDRDNMLGQTYLTSDTGKVYTMLAHASGR 1921


>gi|182679304|ref|YP_001833450.1| hypothetical protein Bind_2348 [Beijerinckia indica subsp. indica
            ATCC 9039]
 gi|182635187|gb|ACB95961.1| hypothetical protein Bind_2348 [Beijerinckia indica subsp. indica
            ATCC 9039]
          Length = 2016

 Score =  201 bits (510), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 403/2001 (20%), Positives = 787/2001 (39%), Gaps = 356/2001 (17%)

Query: 76   PANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFA 135
            PAND D  G   +L+ +   +       A ++SL+W+   +G  +     + + S  +  
Sbjct: 120  PAND-DLHGAGEVLRALQAQTSRTPTILAAVASLVWVGL-IGAYLLLNREALLASSVN-- 175

Query: 136  MRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQS 195
            + P+   LFL+V+V PI+ FF    +  R+++M   ++S+  +A+RL +PE  ++E+M +
Sbjct: 176  LLPQA-ALFLLVAVAPIVFFFVAATLTRRSQEMRITARSMTDVAMRLAEPETVATEQMVT 234

Query: 196  ISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQERE 255
            +S  +R+EI  M + I+RA++RA ELE  VRSE+  LE +Y+ +E RI  +   L  ERE
Sbjct: 235  LSQTIRREIASMGDGIERALARAGELETLVRSEVSNLERSYSDNERRIRALIDELAHERE 294

Query: 256  AIINHGTQLCTSIAEVHESLKEE----------------------LSLTSEEISVHLSRA 293
            A++ +  ++  S+A   E+L  +                      LS   EEI   L  A
Sbjct: 295  AVMANADRVHKSLASAQETLAHDIETASGRFAESTSEAANRVTLALSGKGEEIKTALGAA 354

Query: 294  IDSFQSIVDVRIAKVTEKTTRIVQESA--------------------------------- 320
             ++  + +  R A++ ++ T   +E+                                  
Sbjct: 355  GETLITQLSARGAELLDRLTEAGREATQQITTSSEAVSQGIAVQLSDLDQRFKTIGEVFT 414

Query: 321  QTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQV---------GNYT 371
            Q +S++ ++L   L +T+  IT+    R E+LS  L  +G  L N+V         GN  
Sbjct: 415  QDLSTRGNELATRLDTTASQITETIAARGETLSARLAETGDRL-NEVVSVQGEALHGN-- 471

Query: 372  LMLGNN------TDKVSIA---LKEQSQQFMQAFTSHICEMSNFFSEK------------ 410
            LM  +N      T++ + A    +  +Q+ +  F ++   + + F +             
Sbjct: 472  LMEVSNQIADLITERTATAHDSFETATQRLVTLFDTNYARLHDQFEQDGNDLHQRFAVTT 531

Query: 411  --------------QKSITVTLNDVLQSL-----------RISLQE-------KEDSFCS 438
                          Q  I+ T+++ L +L           ++S QE         ++   
Sbjct: 532  QETATALSRHTEALQDHISTTISENLDALMGHSEQLREHMQVSAQEMLQSIGLHAETLNE 591

Query: 439  NLKSTTDNTLREVDNRTNTLENRITAFLKEIVET-FNNSITDFSSFYKDNLSEFESNLQG 497
            +L S    T   V+N    L  RI    +E + T F+ S T              ++L  
Sbjct: 592  HLSSMFGTTFSAVENHGAHLAERIETTAEETLRTLFDRSET------------LRTHLAT 639

Query: 498  NIDKLQGCFADSHGNMEDLFLSNIQT----IGSNLDKKTLLFEDILSKKQNNISQITSMN 553
             +D+      +    + +  L+  Q     +G + + +       L    N I+  +S+ 
Sbjct: 640  TLDETMSALTNQTEGLHERLLTTAQETTRLLGDHGEAQQQQLAATLDNTLNAITSHSSLM 699

Query: 554  TERLENTLTNSINSLKDMLEEKRQRIDS---DIGKKSEELCSSFNSSYQKVSNVISDREK 610
            +ERLE     ++++     E    R+ +    +  +SEEL     ++   ++  +   E 
Sbjct: 700  SERLETITQAAVSAFSGQTETLNARLGTALDTLTHQSEELNDRLITTSDHMAKALDGLET 759

Query: 611  LFSNSLARVQSHFEETIAGHPQSIVDSISNS-TNNLYDKIMVLAAALSESQKSLDNSLKA 669
                  A++ +  +ET+    Q   D +S    N  +D ++    AL    ++L   L A
Sbjct: 760  QTGALHAKLSTSLDETVTALTQH-ADQLSAKLENGRHDTVL----ALEIHGEALQARLAA 814

Query: 670  HATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHS-FNDTF------ 722
               +          QL   F+ S++  + ++ +    L      HL +   DTF      
Sbjct: 815  SLAETFAGFDQHSRQLSENFESSARLTLGTFENQTQAL----HDHLTTMLADTFSALATH 870

Query: 723  -NNKSDHV-------SGILKNSTQHIDDLFSNNAK-RMEELLHSGSANIESELSAISKAM 773
             ++ S+H+       + IL + TQ +   F   A   +    H             S+A+
Sbjct: 871  SDSMSNHLLVTAQDSAAILSDQTQALQSYFETAAHDTLAAFSHHADVLRNDFTETASEAV 930

Query: 774  NKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALAD 833
            N        I+ AL +R     +  V+    V + + +  E    T   R  +    LA 
Sbjct: 931  NAIATHGGRINEALADRLIAFETGFVDQGGAVAARVSEQAERFTATLTDRLAAIETTLAI 990

Query: 834  NQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAM 893
                  + L   +    + ++S +Q     A +KA ++  +L  +  ++  TL+  ++ +
Sbjct: 991  QGGNINDKLAVHTKEASEAVASQVQIFETQAIAKAAEIQETLNTLVAHIDQTLDERTRTL 1050

Query: 894  LEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIG 953
             E +S     +AKT  E   ++L + D   Q ++  L+     L + L      ID   G
Sbjct: 1051 NETLSTQAFDLAKTLNEGGHDVLQALDAKAQAVNASLTTQTAALTELLETKTEAIDTTFG 1110

Query: 954  SASQFIRDILDEN--------SSRIESL---LSCSNNSVNSTL----------LRSH-QK 991
            + ++ I + LD            R+ +L   +  S  SV  TL          + +H   
Sbjct: 1111 ARTRAIAETLDAQIHHFEGDILGRLGTLSEQIDASGRSVTDTLATHAASLEQAIGTHVGT 1170

Query: 992  FDRLLQEKSDELIQLLDNKASCLSTAVS------------------TQTINLENNLKEQE 1033
             +  L  ++ +L QL +  A  +  AV+                    TI +E  ++   
Sbjct: 1171 LNATLDGETGQLRQLFEGHAEAVRGAVAEANSTFDANSQQIADTLKAHTITMEEAIRAHV 1230

Query: 1034 KSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKC 1093
            ++ +  +D      + L D     AQ +  V+   S +    S ++  +L++   K+++ 
Sbjct: 1231 EAFNAALDGETGQLRQLFDG---HAQAVRGVVAEASTAFDANSHQIANTLETHAAKLEQA 1287

Query: 1094 REFFGDNIVAF-------MDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTS 1146
                G ++ A          ++ ++ E   + +     E S     N+  +T+ I    +
Sbjct: 1288 ---IGAHVGALDTALDGETGQLRQLFEGHAETVRGAIAEASTSFDANSRAVTDTINTHAA 1344

Query: 1147 RVRGEIVDISNKFIETSRVLEQREEKFHSALDS----FSDNISRILLDVDHTISSHTNES 1202
             +   I    + F   + VL     + H  L+       + +++ + D+D T++  T E 
Sbjct: 1345 TLEQAISAHVDAF---NAVLNGEGGQLHKILEGRALEIKETMAQAIEDLDTTLAGRTGEI 1401

Query: 1203 RSLIEQRIHEVKDVLS-------NLDRALESYG------------STVF-KQFKEYVQCF 1242
              ++  R++E+   L+       N  RA +S G            + VF K+  + V   
Sbjct: 1402 GQVLNGRVNEIGMTLATRLGEFENTFRA-KSQGLREIVTLCANDLAEVFDKKAADLVARI 1460

Query: 1243 ETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVID 1302
            E   E +        D +  +   R  +L    +QR  E + ++  A  +    +   +D
Sbjct: 1461 EARSETITRDMTGIGDHLAAALTGRETVLSEYFTQRQNEFAQAVDDASAQ----LRTTLD 1516

Query: 1303 QQIYN----AANALKKLEALLI-------SDVEKITNRITDSSQDVTTIISDATDSLNKV 1351
                N      N +     LL         ++  + NR+++ SQ +  I + A  +   V
Sbjct: 1517 TYAANLREAMTNGMSTSLGLLTETDQQVRGELTTLLNRLSEGSQVLRDISTTAHGNFGLV 1576

Query: 1352 DERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQI 1411
            +  L    +R+ E    +  V  E + L E     LGE                D  +  
Sbjct: 1577 ERSL---GDRLQEFGALLTNVTREVATLKEAAGTTLGEA---------------DAVTAK 1618

Query: 1412 LIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADF 1471
            L++ HD+L  + +    S +        L   L  + +  +  + S+  D K+      F
Sbjct: 1619 LVEQHDALTASAAAFAQSQET-------LDQMLAGRKTALETLIGSL--DAKRTT----F 1665

Query: 1472 LSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTL 1531
            L         DS+Q+    ++  L   ET        +  +L +      +TI + +  L
Sbjct: 1666 L---------DSMQTFATTVENALLQAETHGNT----LTASLNEATQINAETITNRYGEL 1712

Query: 1532 KEKSYDLSNHMRQKICSTIPN-IENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTS 1590
            +E    L N  R ++ + +    E   S L+   D++ + F D+        T +L   S
Sbjct: 1713 RE----LMNGERARMAAALRGAFEEAESELDRIFDRTKKQFQDA--------TGELHSMS 1760

Query: 1591 DDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS 1650
             +I        +DL  +R+ ++R ++ L +E  E A  +R  + E++  L+    +++ S
Sbjct: 1761 SEIR-------QDLEATREDMRRSAIELPRETAEQAAALRKIVNEEVKALETLTNIVSRS 1813

Query: 1651 -----VKNNAAS-----------------YNKGLHSDEYNISQVDKRPSGKK-TKNNHAI 1687
                 +   AA+                  +K L +D    S+   R +  +        
Sbjct: 1814 GRALDISEPAAARVAVSGLSNALTTVDQAADKALGTDGGAGSRSSARNAAHRLAPPALPG 1873

Query: 1688 KEWFNKILS-SSTHSKGKSSSHIDISDKDSLS-SIDSLVENISKFIDYDAFVQLWKSYTL 1745
              W + +L+ +S   +  +SS  + +     S  +D L  +I+  ID+ A V  W+ Y  
Sbjct: 1874 SGWLSDLLARASNEDETSASSQAEQATAVVPSKPLDPLFSDIANMIDHRALVDAWERYRQ 1933

Query: 1746 GEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLV 1805
            G+   F+  +Y   GQ+ F  ++ +Y+AD+A +  I+R +  FE+ L+++++        
Sbjct: 1934 GDTKAFAHSIYKGVGQQTFEAIRRRYRADAAFQATINRSVQEFEKHLAQLSRDGQGDKQQ 1993

Query: 1806 QEHIMSNYGKVYTMLVHASGR 1826
              +++S+ GKV+TML HA+GR
Sbjct: 1994 LAYLLSDTGKVHTMLAHAAGR 2014


>gi|239831967|ref|ZP_04680296.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824234|gb|EEQ95802.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 1620

 Score =  196 bits (498), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 304/1468 (20%), Positives = 607/1468 (41%), Gaps = 282/1468 (19%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 302  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 350

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L+  L+++ N ++D +    Q++ + + +  E L  S N S   ++  I    
Sbjct: 351  SGAH-EQLKEELSSASNIIRDNVLSASQQLSTLLTESGERLIGSINESGGAIAEAI---- 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                           ET  G   S + +   +  NL D  +   A L E  ++    L  
Sbjct: 406  ---------------ETRTGDIGSRITTSGEAFANLLDTRI---ATLDEQSRTVSDRLAE 447

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + +  A   +V+ FD    N+  + +     L + F+   H+        
Sbjct: 448  ALDERTTGIANLLGGATQSMVSEFDTRLANLESTLSERGRSLLSEFEARAHALDSSTEKL 507

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSID 778
            N     +S  ++  L   T+ I + FS+    +  ++      I  +L++I         
Sbjct: 508  NAALETRSRQINENLIARTREIAETFSSGRTSLSTMIDETKTKIGEDLTSIG-------- 559

Query: 779  DVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCT-------TFAQRND------ 825
              E++   L E+       L    D + +SL+   E +         T A R        
Sbjct: 560  --ESVGNILGEKADAFAGKLAESRDVLAASLEGETERVSAVIRGHADTLAARTSDIENAV 617

Query: 826  ----SFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTE---- 877
                S +N++ADN +     L  ++H L   + S    L D +++   D + SL E    
Sbjct: 618  NASASALNSVADNHAAI---LEERTHALRQTMESH-SALLDASFA---DHSRSLEERATT 670

Query: 878  ----IQGNVGVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKL 930
                I GN  +    ++  + AM +  + +  ++A+TF+E ++++     +N+ TL + L
Sbjct: 671  LHGIIAGNQAMLAQLMDERAAAMRDNFNENREVLARTFDERVNSLQALIADNQDTLARIL 730

Query: 931  SDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQ 990
             +    +  ++  S +     +G   + IR + +E +S + ++L+  NN++ S +L  H+
Sbjct: 731  DERASSMNASIGASRDTFVATLG---EHIRQV-EERTSGLHTVLNDHNNAL-SGILDGHE 785

Query: 991  KFDRLLQEKSDELIQLLDNKASCLSTAVS-------TQTINLENNLKEQEKSLSRVVDTS 1043
               R ++ ++ E+   L    + LS  +         +T NL N + +   ++SR  +  
Sbjct: 786  ---RTIETRAAEIRSTLSESTASLSQTLQDHSDILEQRTANLHNAIADSSSAISRAFE-- 840

Query: 1044 ASSFKYLSDSIQTLAQELVSVIG------SMSQSTTDISGKLE-------ISLDSVNQKI 1090
                  + +  QT+ + L   IG      ++ QS   ++G L         +L +   K 
Sbjct: 841  -GQTGIIEERTQTMEKALT--IGVDNVRRALEQSAGIVAGTLREKIGEAASTLSAEAAKA 897

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
             +  + FG+   A  +D +S     +E R+  R            D I  ++ +  SR+ 
Sbjct: 898  GEALDGFGEAFSARLIDNLSG----TEARLGDRA-----------DAIAGRLGEIESRLT 942

Query: 1150 GEI----VDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSL 1205
            GE+      I+N    TS  L    E F +   S +DN    L   +  +S   N   S 
Sbjct: 943  GELGSIEARIANTASRTSETLAGHSEAFAA---SVADN----LAGTESRLSERANAIASG 995

Query: 1206 IEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFET----NMENMESLFDKNNDSML 1261
            +E   + +   LS ++  +    S   +    + + F      N+   E+   +  D++ 
Sbjct: 996  LEAIENRLTSELSTIEARIADTASKTSETLAGHSESFSASVADNLAGTETRLAERADAI- 1054

Query: 1262 LSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLIS 1321
                  +  L +I S+ +ME+     G+       +  V D          ++L A+L +
Sbjct: 1055 ------ATRLGDIGSRITMEL-----GSVEAR---IAQVTDTTAVTLEERTRELNAVLAA 1100

Query: 1322 DVEKITNRITDSSQDVTTIISDATDSL-NKVDERLHQTTNRITETTGHIDTVLAESSKLF 1380
              ++IT  + D+++ +   ++D+   L  +++E  H  T+R+      +   LA  S+  
Sbjct: 1101 RSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRSENAALVNALA--SRTA 1158

Query: 1381 EKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDL 1440
            E           ++ +Q ++  +    N   LI   D L  +  E    +D    NL D+
Sbjct: 1159 ET----------IAAVQQAK--TGLSDNVSELI---DRLAASNGELGKLIDAATRNLTDI 1203

Query: 1441 TSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
              RLV  +S                     F+ +T         Q+S   IDG +  +  
Sbjct: 1204 DGRLVDTTS--------------------SFVENT--NRAAQMFQASTGLIDGNIGTLRA 1241

Query: 1501 RSRDTVRLIDHNLADIGNK-------------TVKTIDSNFVTLKEKSYDLSNHMRQKIC 1547
             S  T+      +ADI ++              + +  +  V+  E  +   + +   + 
Sbjct: 1242 ISDSTL----SQIADIADRFEEHGKVLSSASEMINSAQNGLVSTLEDRHQALDKLASGLV 1297

Query: 1548 STIPNIENIFSTLEE-----------KSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALT 1596
                 +E +  + EE           ++  S +   +S++  V+   QK S  +DDI  T
Sbjct: 1298 EKSEGVEKLMQSFEELVASAFQRAEGQTRSSAEKMRESVSEIVEQAAQKFSAATDDIRRT 1357

Query: 1597 SRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVK---- 1652
            +  I  +LN +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S +    
Sbjct: 1358 ASEIRNELNTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDV 1417

Query: 1653 ---------NNAASYNKGLHSDEYNISQVD------------KRPSGKKTKNNHAIKEWF 1691
                     +            +  ++Q D             +P+  +       + W 
Sbjct: 1418 GESRADRPVSRPTPAAARPAPVQAPVAQADVALRQRVYEAPKAQPASSEAAQPEKPRGWV 1477

Query: 1692 NKILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQ 1738
            + +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+
Sbjct: 1478 SDLLARASREEEEAAQPKAQPTATPRSPSHV-------VESLNSLSVDIARAIDHEASVE 1530

Query: 1739 LWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQS 1798
            LW  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A++
Sbjct: 1531 LWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARN 1590

Query: 1799 NDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            + D+ + + ++ S+ GKVYTML HASGR
Sbjct: 1591 DRDNMVTRTYLTSDTGKVYTMLAHASGR 1618



 Score =  181 bits (458), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 252/1180 (21%), Positives = 482/1180 (40%), Gaps = 205/1180 (17%)

Query: 108  SLIWLACELGF--LIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRA 165
            S++W A  +     I     S M +  DF   P  + +   V++ P+ +F+ F  ++ RA
Sbjct: 189  SVLWAAGGVALSKAINPDVFSSMQATKDFFTSPAGLGVVAGVAL-PVAMFWGFAQLVKRA 247

Query: 166  RDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTV 225
            ++MH A++S++  A+RL+ PE  S +++ ++  AVR+E+  M E I+R ++RA ELE  V
Sbjct: 248  QEMHLAARSMSEAAMRLLQPEAVSGDRVSTLGQAVRREVAAMNEGIERTLARAVELETLV 307

Query: 226  RSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS-- 283
            +SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE LKEELS  S  
Sbjct: 308  QSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLKEELSSASNI 367

Query: 284  ------------------------------------------EEISVHLSRAIDSFQSIV 301
                                                       +I   ++ + ++F +++
Sbjct: 368  IRDNVLSASQQLSTLLTESGERLIGSINESGGAIAEAIETRTGDIGSRITTSGEAFANLL 427

Query: 302  DVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGR 361
            D RIA + E++  +    A+ +  +   +  +L   +  +  +FD R+ +L +TL+  GR
Sbjct: 428  DTRIATLDEQSRTVSDRLAEALDERTTGIANLLGGATQSMVSEFDTRLANLESTLSERGR 487

Query: 362  SLANQVGNYTLMLGNNTDKVSIALKEQSQQ-----------FMQAFTSHICEMSNFFSEK 410
            SL ++       L ++T+K++ AL+ +S+Q             + F+S    +S    E 
Sbjct: 488  SLLSEFEARAHALDSSTEKLNAALETRSRQINENLIARTREIAETFSSGRTSLSTMIDET 547

Query: 411  QKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIV 470
            +  I   L  + +S+   L EK D+F   L  + D     ++  T     R++A ++   
Sbjct: 548  KTKIGEDLTSIGESVGNILGEKADAFAGKLAESRDVLAASLEGET----ERVSAVIRGHA 603

Query: 471  ETFN-----------------NSITD-FSSFYKDNLSEFESNLQGNIDKLQGCFADSHGN 512
            +T                   NS+ D  ++  ++        ++ +   L   FAD   +
Sbjct: 604  DTLAARTSDIENAVNASASALNSVADNHAAILEERTHALRQTMESHSALLDASFADHSRS 663

Query: 513  MEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDML 572
            +E+   +    I  N      L ++  +  ++N ++    N E L  T    +NSL+ ++
Sbjct: 664  LEERATTLHGIIAGNQAMLAQLMDERAAAMRDNFNE----NREVLARTFDERVNSLQALI 719

Query: 573  EEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQ 632
             + +      + +  +E  SS N+S       I      F  +L       EE  +G   
Sbjct: 720  ADNQD----TLARILDERASSMNAS-------IGASRDTFVATLGEHIRQVEERTSGL-H 767

Query: 633  SIVDSISNSTNNLYD--------KIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQ 684
            ++++  +N+ + + D        +   + + LSES  SL  +L+ H+  +  +  N  N 
Sbjct: 768  TVLNDHNNALSGILDGHERTIETRAAEIRSTLSESTASLSQTLQDHSDILEQRTANLHNA 827

Query: 685  L------VNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQ 738
            +      ++R  E    II     +  K  TI    + +        +  V+G L+    
Sbjct: 828  IADSSSAISRAFEGQTGIIEERTQTMEKALTI---GVDNVRRALEQSAGIVAGTLREKIG 884

Query: 739  HIDDLFSNNAKRMEELL----HSGSANIESELSAISKAMNKSIDDVETISTALKERCQEL 794
                  S  A +  E L     + SA +   LS     +    D       A+  R  E+
Sbjct: 885  EAASTLSAEAAKAGEALDGFGEAFSARLIDNLSGTEARLGDRAD-------AIAGRLGEI 937

Query: 795  GSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLS 854
             S L      + + +         T A  +++F  ++ADN +  E+ L  +++ +   L 
Sbjct: 938  ESRLTGELGSIEARIANTASRTSETLAGHSEAFAASVADNLAGTESRLSERANAIASGLE 997

Query: 855  SDIQKLT---DIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEEC 911
            +   +LT       ++  D A+  +E       TL  HS    E  SA            
Sbjct: 998  AIENRLTSELSTIEARIADTASKTSE-------TLAGHS----ESFSA------------ 1034

Query: 912  MSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIE 971
                  S  +N    + +L++  D +   L    ++I   +GS    I  + D  +  +E
Sbjct: 1035 ------SVADNLAGTETRLAERADAIATRLGDIGSRITMELGSVEARIAQVTDTTAVTLE 1088

Query: 972  SLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKE 1031
                     +N+ L    Q+  ++L + ++ L+Q L +    L+  +   T    + L+ 
Sbjct: 1089 E----RTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRS 1144

Query: 1032 QEKSL-----SRVVDTSAS---SFKYLSDSIQTLA-------QELVSVIGSMSQSTTDIS 1076
            +  +L     SR  +T A+   +   LSD++  L         EL  +I + +++ TDI 
Sbjct: 1145 ENAALVNALASRTAETIAAVQQAKTGLSDNVSELIDRLAASNGELGKLIDAATRNLTDID 1204

Query: 1077 GKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDV 1136
            G+L  +  S  +   +  + F                           + S  L+  N  
Sbjct: 1205 GRLVDTTSSFVENTNRAAQMF---------------------------QASTGLIDGNIG 1237

Query: 1137 ITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSA 1176
                I DST     +I DI+++F E  +VL    E  +SA
Sbjct: 1238 TLRAISDST---LSQIADIADRFEEHGKVLSSASEMINSA 1274


>gi|254689253|ref|ZP_05152507.1| hypothetical protein Babob68_03561 [Brucella abortus bv. 6 str. 870]
 gi|256257503|ref|ZP_05463039.1| hypothetical protein Babob9C_09148 [Brucella abortus bv. 9 str. C68]
 gi|297248347|ref|ZP_06932065.1| hypothetical protein BAYG_01295 [Brucella abortus bv. 5 str. B3196]
 gi|297175516|gb|EFH34863.1| hypothetical protein BAYG_01295 [Brucella abortus bv. 5 str. B3196]
          Length = 1553

 Score =  194 bits (493), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 318/1463 (21%), Positives = 607/1463 (41%), Gaps = 335/1463 (22%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ID    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLIDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1147 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1181

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1182 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1235

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1236 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1296 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1355

Query: 1651 ----VKNNAASYNKGLHSDEYNISQVD--------KRPSGKKTKNNHAIKE--WFNKILS 1696
                V   AAS    + +    ++Q D        + P+ K      A K   W + +L+
Sbjct: 1356 ADRPVSRPAASRPAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLA 1415

Query: 1697 SSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSY 1743
             ++              +  +S SH+       + S++SL  +I++ ID++A V+LW  Y
Sbjct: 1416 RASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRY 1468

Query: 1744 TLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSP 1803
              GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++ D+ 
Sbjct: 1469 RRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARNDRDNM 1528

Query: 1804 LVQEHIMSNYGKVYTMLVHASGR 1826
            + Q ++ S+ GKVYTML HASGR
Sbjct: 1529 VTQTYLTSDTGKVYTMLAHASGR 1551



 Score =  180 bits (456), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 252/1126 (22%), Positives = 480/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M DA++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQDAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKN-STQHIDDL------FSNNAKRME 752
            L  F ++F                 ++D ++G L +  ++ ID+L       ++ A +  
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLIDELGTIEARIADTAAKTS 956

Query: 753  ELLHSG----SANIESELSAISKAMNKSIDDVETISTALKER-CQELGS---DLVNHSDK 804
            E L S     SA++   L+     + +  D + T    +  R   ELGS    +   +D 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 805  VLSSLKQAQELLCTTFAQR--------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               +L++    L    A R        ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|260754759|ref|ZP_05867107.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260883779|ref|ZP_05895393.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260674867|gb|EEX61688.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873307|gb|EEX80376.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
          Length = 1578

 Score =  193 bits (490), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 318/1463 (21%), Positives = 608/1463 (41%), Gaps = 335/1463 (22%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ID    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLIDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1052 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1078

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1079 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1119

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1120 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1172 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1206

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1207 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1260

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1261 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1321 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1380

Query: 1651 ----VKNNAASYNKGLHSDEYNISQVD--------KRPSGKKTKNNHAIKE--WFNKILS 1696
                V   AAS    + +    ++Q D        + P+ K      A K   W + +L+
Sbjct: 1381 ADRPVSRPAASRPAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLA 1440

Query: 1697 SSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSY 1743
             ++              +  +S SH+       + S++SL  +I++ ID++A V+LW  Y
Sbjct: 1441 RASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRY 1493

Query: 1744 TLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSP 1803
              GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++ D+ 
Sbjct: 1494 RRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARNDRDNM 1553

Query: 1804 LVQEHIMSNYGKVYTMLVHASGR 1826
            + Q ++ S+ GKVYTML HASGR
Sbjct: 1554 VTQTYLTSDTGKVYTMLAHASGR 1576



 Score =  179 bits (453), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 252/1126 (22%), Positives = 480/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M DA++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQDAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKN-STQHIDDL------FSNNAKRME 752
            L  F ++F                 ++D ++G L +  ++ ID+L       ++ A +  
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLIDELGTIEARIADTAAKTS 981

Query: 753  ELLHSG----SANIESELSAISKAMNKSIDDVETISTALKER-CQELGS---DLVNHSDK 804
            E L S     SA++   L+     + +  D + T    +  R   ELGS    +   +D 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 805  VLSSLKQAQELLCTTFAQR--------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               +L++    L    A R        ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|82699875|ref|YP_414449.1| hypothetical protein BAB1_1043 [Brucella melitensis biovar Abortus
            2308]
 gi|189024189|ref|YP_001934957.1| hypothetical protein BAbS19_I09680 [Brucella abortus S19]
 gi|254697388|ref|ZP_05159216.1| hypothetical protein Babob28_06695 [Brucella abortus bv. 2 str.
            86/8/59]
 gi|254730286|ref|ZP_05188864.1| hypothetical protein Babob42_03604 [Brucella abortus bv. 4 str. 292]
 gi|260545305|ref|ZP_05821046.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|82615976|emb|CAJ10999.1| unnamed protein product [Brucella melitensis biovar Abortus 2308]
 gi|189019761|gb|ACD72483.1| hypothetical protein BAbS19_I09680 [Brucella abortus S19]
 gi|260096712|gb|EEW80587.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
          Length = 1553

 Score =  192 bits (487), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 317/1463 (21%), Positives = 606/1463 (41%), Gaps = 335/1463 (22%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1147 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1181

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1182 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1235

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1236 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1296 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1355

Query: 1651 ----VKNNAASYNKGLHSDEYNISQVD--------KRPSGKKTKNNHAIKE--WFNKILS 1696
                V   AAS    + +    ++Q D        + P+ K      A K   W + +L+
Sbjct: 1356 ADRPVSRPAASRPAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLA 1415

Query: 1697 SSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSY 1743
             ++              +  +S SH+       + S++SL  +I++ ID++A V+LW  Y
Sbjct: 1416 RASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRY 1468

Query: 1744 TLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSP 1803
              GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++ D+ 
Sbjct: 1469 RRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARNDRDNM 1528

Query: 1804 LVQEHIMSNYGKVYTMLVHASGR 1826
            + Q ++ S+ GKVYTML HASGR
Sbjct: 1529 VTQTYLTSDTGKVYTMLAHASGR 1551



 Score =  180 bits (456), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 245/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M DA++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQDAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|237815448|ref|ZP_04594446.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260757982|ref|ZP_05870330.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761805|ref|ZP_05874148.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|237790285|gb|EEP64495.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|260668300|gb|EEX55240.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672237|gb|EEX59058.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59]
          Length = 1578

 Score =  191 bits (484), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 317/1463 (21%), Positives = 607/1463 (41%), Gaps = 335/1463 (22%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1052 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1078

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1079 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1119

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1120 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1172 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1206

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1207 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1260

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1261 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1321 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1380

Query: 1651 ----VKNNAASYNKGLHSDEYNISQVD--------KRPSGKKTKNNHAIKE--WFNKILS 1696
                V   AAS    + +    ++Q D        + P+ K      A K   W + +L+
Sbjct: 1381 ADRPVSRPAASRPAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLA 1440

Query: 1697 SSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSY 1743
             ++              +  +S SH+       + S++SL  +I++ ID++A V+LW  Y
Sbjct: 1441 RASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRY 1493

Query: 1744 TLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSP 1803
              GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++ D+ 
Sbjct: 1494 RRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARNDRDNM 1553

Query: 1804 LVQEHIMSNYGKVYTMLVHASGR 1826
            + Q ++ S+ GKVYTML HASGR
Sbjct: 1554 VTQTYLTSDTGKVYTMLAHASGR 1576



 Score =  179 bits (453), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 245/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M DA++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQDAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|13470955|ref|NP_102524.1| kinesin-like protein [Mesorhizobium loti MAFF303099]
 gi|14021698|dbj|BAB48310.1| kinesin-like protein [Mesorhizobium loti MAFF303099]
          Length = 2124

 Score =  189 bits (479), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 314/1466 (21%), Positives = 620/1466 (42%), Gaps = 240/1466 (16%)

Query: 66   SNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTN 125
             N    +GF PAND        +L ++ + + N         SL W+A   G     +  
Sbjct: 100  GNGTQPTGFAPANDDRQKDYKTLLHSLNRRASNTVYWIVAFVSLAWIAGAGGLANLLFGP 159

Query: 126  S--PMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLI 183
            S   + +   F  RPE+I L  V ++VPI+LF++F  MI RA+DM  A+QS+  +A RL 
Sbjct: 160  SIWRIGTLDQFLARPELIGLA-VAAIVPIILFWAFAAMIRRAQDMRIAAQSMTEVAFRLT 218

Query: 184  DPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRI 243
            +PE  + +++  I  AVR+E+  M E I+R ++RA ELE  V SE+  +E +Y+++E RI
Sbjct: 219  EPENMAQDRVMMIGQAVRREVAAMGEGIERTLARAVELETLVHSEVNQIERSYSENETRI 278

Query: 244  DNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS-------------------- 283
             ++   L  EREA++ H  ++  SIA  HE+L++E+   S                    
Sbjct: 279  RSLVDGLGSEREAVVTHAERVRASIAGAHETLRDEIGAASDIIRDSILNASTKLSMTITN 338

Query: 284  ------------------------EEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQES 319
                                    + I+  LS + ++F S++D RIAK+T+ T  + +  
Sbjct: 339  SGDTLIDRINESSMSIFDSVEGRLDTITDKLSTSGEAFASLLDTRIAKLTDTTDGLTRSL 398

Query: 320  AQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTD 379
               +  +   ++ +L   +  +  +F+  +  +  TL   G++L ++       L   T 
Sbjct: 399  TDLLDDRTTGMVSLLGGAARTLNSEFEASLNGIERTLAERGQALISEFQTRAEALDTGTQ 458

Query: 380  KVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN-----------DVLQSLRIS 428
            K++ AL+ +++Q  +       E+++ F+E + ++   ++           D++ S    
Sbjct: 459  KLNAALEARARQINETLVERAREIAHTFAESKDTLAAMIDQGKTQIGADMADIVTSTSSM 518

Query: 429  LQEKEDSFCSNLKSTTDNTLREVDNRTNTLEN-RITAFLKEIVETFNNSITDFSSFYKDN 487
            L+ +   F   +++      R  D+    L + R+   ++E VE  +  +++     +D 
Sbjct: 519  LEARASDFAGRMEAARHVVSRSFDSDIQRLADARVG--IEEAVENHSRKLSE----SRDR 572

Query: 488  LSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTI--GSNLDKKTLLFEDILSKKQNN 545
            ++   + +Q +++K    FA+S   ++    + +Q +  G +L  +  L ED+    ++ 
Sbjct: 573  MA---AAMQADLEK----FAESRDGIDAAVTNQVQKLAEGRSLIARA-LEEDLRKVNESR 624

Query: 546  ISQITSMNT--ERLE---NTLTNSINSLKDMLEEKRQRID----SDIGKKSEE---LCSS 593
             +   S+ +  ERLE   N L+ ++N     L + R  ID      +GK +E    L  +
Sbjct: 625  AAIDASLGSHLERLEEGRNRLSLALNEDSGKLVQARTIIDEMVAGHVGKLAEGRNILSRA 684

Query: 594  FNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLA 653
              +   K+S+  +  + L +  +        E IA     +  ++ N    +   I V +
Sbjct: 685  LEADLGKLSDSRASIDGLVAGQV--------EKIAEGRAVLAKALENDIAGIKSLIEVHS 736

Query: 654  AALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNI---ICSYNSSNNKLETI 710
            A L E +  L  SL+   + +   + +   +L N     S+ +   +     S + ++ +
Sbjct: 737  AKLVEDRSQLGRSLEDDLSGIRGLLDDHSVKLANDRSLLSQTLEADLAKLAESRSSIDGL 796

Query: 711  FQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESEL---- 766
                +    +      D +   L++    I  + S+ ++R+ E     S  +E++L    
Sbjct: 797  VAGQVEKLAE----GRDILKRALESDLSTIKGVISSQSERLAEDRGQLSRVLEADLQNVN 852

Query: 767  SAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDS 826
            S I+  MN+ + D  T+S AL++   +L +D  +  D +++   Q ++L     A+  D 
Sbjct: 853  SVIADHMNRLVQDRSTLSKALEDDLAKL-ADSRSSIDGLVAG--QVEKL-----AEGRDI 904

Query: 827  FVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTL 886
               AL  + +  +N + +QS  L+D  +          +++A+                 
Sbjct: 905  LKRALEADLNTIKNTVADQSQKLVDDRAQ---------FARAL----------------- 938

Query: 887  ENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSEN 946
                +A LE +   N+LV    E  +        ++R TL K L   +D           
Sbjct: 939  ----EADLESV---NSLVNSHSERLV--------QDRSTLSKALEVDLD----------- 972

Query: 947  KIDGAIGS-ASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKS----- 1000
             ++G I S A + ++D      S +   L     SV S L+ SH   DRL+QE+S     
Sbjct: 973  NVNGLINSHAERLVQD-----RSTLSKALEADLESV-SGLVNSHA--DRLVQERSTLSRA 1024

Query: 1001 --DELIQLLDNKASC----------LSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFK 1048
              D+L +L ++++S           L+         LE +L +  +S S +    A   +
Sbjct: 1025 LEDDLAKLAESRSSIDGLVAGQVEKLAEGRDVLRRALEADLAKLAESRSSIDGLVAGQVE 1084

Query: 1049 YLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEI 1108
             L++    L + L + +  +S+S  DI G        +   + K  E  G N+      +
Sbjct: 1085 KLAEGRDILKRALEADLQKLSESRGDIDG-------VIAGHVGKLAE--GRNM------L 1129

Query: 1109 SKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQ 1168
            S+ +E    ++++  +++ + L  + D I  +  D ++ +  ++  I   F   + ++E+
Sbjct: 1130 SRALEDDLGKLAETRKDVDRSLSGHIDQIAARSTDISAAIAADVEKIEQAFSRQTGIIEE 1189

Query: 1169 REEKFHSALDSFSDNISRIL---------------LDVDHTISSHTNESRSLIEQRIHEV 1213
            R      AL +  DN+  +L               L+V  T+      + S  +++I E 
Sbjct: 1190 RAGTMERALSTGVDNVRSVLEKSAVFVAGALREKVLEVTSTLHEQAGAAFSDADRKIAER 1249

Query: 1214 KDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDN 1273
             +  S    AL +    + + F+E  +      E+  +      D    S   R++   +
Sbjct: 1250 AEQTSA---ALLARAEDIARTFEEADRRLHARAEDTSNALLARADDTSSSLLARAHETAD 1306

Query: 1274 ILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDS 1333
             L+ R+ EI+ S   A  K      +  DQ    A+      +A   +D +K+  R  ++
Sbjct: 1307 QLAARAGEIAGSFELADQKLAARAQDTADQLAARASEIAGTFDA---AD-QKLVARAIET 1362

Query: 1334 SQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRV 1393
            +Q +     D   +    D+RL     RI E+   +     +  ++F+   + L  +SR+
Sbjct: 1363 AQSLAARAGDILRNFESADQRLGM---RIGESAEALAARATDLGRIFDAADQQL--VSRI 1417

Query: 1394 SLL------QMSEIVSKFDKNSQILI 1413
            +        + SEI   FD+  Q L+
Sbjct: 1418 AEGSDALSNRASEIGRIFDEADQRLV 1443



 Score =  120 bits (300), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 81/108 (75%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S++SL  +I++ ID+DA ++LW  Y  GE D+F++RLYT+KGQ+ F  ++ +Y+ ++  R
Sbjct: 2015 SLNSLSVDIARAIDHDASIELWNRYRRGERDVFTRRLYTLKGQQTFDEIRRKYQGEAEFR 2074

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             A+DRY  +FE++L ++++++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 2075 AAVDRYCDDFEKLLKDVSRNDRDNIMAQTYLTSDTGKVYTMLAHASGR 2122



 Score = 85.5 bits (210), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 309/1558 (19%), Positives = 617/1558 (39%), Gaps = 309/1558 (19%)

Query: 256  AIINHG-TQLCTSIAEVHESLKEELSLTSEEISVHL-------SRAIDS-FQSIVDVRIA 306
            A+I+ G TQ+   +A++  S    L   + + +  +       SR+ DS  Q + D R+ 
Sbjct: 495  AMIDQGKTQIGADMADIVTSTSSMLEARASDFAGRMEAARHVVSRSFDSDIQRLADARVG 554

Query: 307  --KVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNT--------- 355
              +  E  +R + ES   +++ +   LE    +   I     N+++ L+           
Sbjct: 555  IEEAVENHSRKLSESRDRMAAAMQADLEKFAESRDGIDAAVTNQVQKLAEGRSLIARALE 614

Query: 356  -----LNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEK 410
                 +N S  ++   +G++   L    +++S+AL E S + +QA T  I EM      K
Sbjct: 615  EDLRKVNESRAAIDASLGSHLERLEEGRNRLSLALNEDSGKLVQARTI-IDEMVAGHVGK 673

Query: 411  QKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRT---NTLENRITAFLK 467
               +    N + ++L   L +  DS  S          +  + R      LEN I A +K
Sbjct: 674  ---LAEGRNILSRALEADLGKLSDSRASIDGLVAGQVEKIAEGRAVLAKALENDI-AGIK 729

Query: 468  EIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSN 527
             ++E  +  + +  S    +L +  S ++G +D      A+         LS  QT+ ++
Sbjct: 730  SLIEVHSAKLVEDRSQLGRSLEDDLSGIRGLLDDHSVKLANDRS-----LLS--QTLEAD 782

Query: 528  LDKKTLLFEDILSKKQNNISQITSMNTERL-------ENTLTNSINSLKDMLEEKRQRID 580
            L K        L++ +++I  + +   E+L       +  L + ++++K ++  + +R+ 
Sbjct: 783  LAK--------LAESRSSIDGLVAGQVEKLAEGRDILKRALESDLSTIKGVISSQSERLA 834

Query: 581  SDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISN 640
             D G    +L     +  Q V++VI+D                      H   +V   S 
Sbjct: 835  EDRG----QLSRVLEADLQNVNSVIAD----------------------HMNRLVQDRST 868

Query: 641  STNNLYDKIMVLAAALSESQKSLDNSLK------AHATDVVHKITNAE-NQLVNRFDESS 693
             +  L D +    A L++S+ S+D  +       A   D++ +   A+ N + N   + S
Sbjct: 869  LSKALEDDL----AKLADSRSSIDGLVAGQVEKLAEGRDILKRALEADLNTIKNTVADQS 924

Query: 694  KNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHV-------SGILKNSTQHIDDLFSN 746
            + ++         LE      L S N   N+ S+ +       S  L+    +++ L ++
Sbjct: 925  QKLVDDRAQFARALEA----DLESVNSLVNSHSERLVQDRSTLSKALEVDLDNVNGLINS 980

Query: 747  NAKRMEELLHSGSANIESELSAISKAMNKSIDDV----ETISTALKERCQELGSD----- 797
            +A+R+ +   + S  +E++L ++S  +N   D +     T+S AL++   +L        
Sbjct: 981  HAERLVQDRSTLSKALEADLESVSGLVNSHADRLVQERSTLSRALEDDLAKLAESRSSID 1040

Query: 798  --LVNHSDKVLSS---LKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDK 852
              +    +K+      L++A E      A+   S    +A    K    L     +L   
Sbjct: 1041 GLVAGQVEKLAEGRDVLRRALEADLAKLAESRSSIDGLVAGQVEK----LAEGRDILKRA 1096

Query: 853  LSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECM 912
            L +D+QKL+               E +G++   +  H    + K++    ++++  E+ +
Sbjct: 1097 LEADLQKLS---------------ESRGDIDGVIAGH----VGKLAEGRNMLSRALEDDL 1137

Query: 913  SNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIR-------DILDE 965
              +     E R+ +D+ LS HID     +A     I  AI +  + I         I++E
Sbjct: 1138 GKLA----ETRKDVDRSLSGHID----QIAARSTDISAAIAADVEKIEQAFSRQTGIIEE 1189

Query: 966  NSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCL----------- 1014
             +  +E  LS   ++V S L +S       L+EK  E+   L  +A              
Sbjct: 1190 RAGTMERALSTGVDNVRSVLEKSAVFVAGALREKVLEVTSTLHEQAGAAFSDADRKIAER 1249

Query: 1015 ----STAVSTQTINLENNLKEQEKSL-SRVVDTSASSFKYLSDSIQTLAQELVSVIGSMS 1069
                S A+  +  ++    +E ++ L +R  DTS +      D+  +L          ++
Sbjct: 1250 AEQTSAALLARAEDIARTFEEADRRLHARAEDTSNALLARADDTSSSLLARAHETADQLA 1309

Query: 1070 QSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQ 1129
                +I+G  E++    +QK+    +   D + A   EI+   + +++++  R  E +Q 
Sbjct: 1310 ARAGEIAGSFELA----DQKLAARAQDTADQLAARASEIAGTFDAADQKLVARAIETAQS 1365

Query: 1130 LL-QNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRIL 1188
            L  +  D++ N                   F    + L  R  +   AL + + ++ RI 
Sbjct: 1366 LAARAGDILRN-------------------FESADQRLGMRIGESAEALAARATDLGRIF 1406

Query: 1189 LDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMEN 1248
               D  + S           RI E  D LSN         S + + F E  Q   + + +
Sbjct: 1407 DAADQQLVS-----------RIAEGSDALSN-------RASEIGRIFDEADQRLVSRIAD 1448

Query: 1249 MESLFDKNNDSMLLSFK-------ERSNILDNILSQRSMEISDSISGAFHKEGNAVVNV- 1300
              S   ++  S++ +F        +R+      L+  + EI  +++GA  +  +      
Sbjct: 1449 SSSTIGEHAQSIVGAFASTEQKVADRARQTGQELAVHAREIEQALAGADERLASTAAAAA 1508

Query: 1301 --IDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQT 1358
              +++QI +  N L      +    +++  +++ +   + +  +   ++   V + + Q+
Sbjct: 1509 ARVEEQIASVENRLAHTTETM---GQRLNEQVSSAEAQLVSRANVIAETFTAVGQHIGQS 1565

Query: 1359 TNRITETTG----HIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIK 1414
            TN   +T G     ++T+LA  S           E+S++       +V +F +    L K
Sbjct: 1566 TNDAAKTIGANTRELNTMLAARS----------AEMSKILDETARPLVERFAQGGSELQK 1615

Query: 1415 SHDSLMKAQSETKLSLDKDA--NNLVDLTSRLVSKSSEAQKFVMSILVDV---------- 1462
            S + + +  +E KL  +  A  N L + T+  +S    A+  +   + D+          
Sbjct: 1616 SMEEVTERATE-KLRSENAALVNALANRTAETLSAVEGARSSLSDSVADLIGRMTKSSSQ 1674

Query: 1463 -KKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHN---LADIGN 1518
              +++EQA      V + +T S QS     +       +    + RL+D N   L ++ +
Sbjct: 1675 LGQLIEQAAVNLGQVDERLTGSTQSFAATTEKAAQTFAS----SARLVDSNTTRLTELSS 1730

Query: 1519 KT---VKTIDSNF-----------------------------------VTLKEKSYDLSN 1540
             T   V +I + F                                   V L +KS DL  
Sbjct: 1731 STLREVASIATKFDEHSRLLASASDLLSSAQSNLEHTLERQSSLEDLAVGLVKKSEDLER 1790

Query: 1541 HMRQ---KICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTS 1597
             MR     +  T+ N E        K+ +S     +++ + VDS T++ +  +D++  T+
Sbjct: 1791 VMRSFENLVGQTLQNAEG-------KTMESADKIRNAITDVVDSATKRFADATDEMRRTA 1843

Query: 1598 RRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNA 1655
              I  +L+ +R  LK+  + + +EAKES   IR A+ EQIN LK+   ++  S +   
Sbjct: 1844 SSIKSELDLTRAELKKGVIEMPEEAKESTSAIRRAVSEQINALKELSDIVAKSGRGGG 1901


>gi|306843897|ref|ZP_07476492.1| Hypothetical protein BIBO1_0559 [Brucella sp. BO1]
 gi|306275652|gb|EFM57376.1| Hypothetical protein BIBO1_0559 [Brucella sp. BO1]
          Length = 1557

 Score =  189 bits (479), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 316/1462 (21%), Positives = 606/1462 (41%), Gaps = 329/1462 (22%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L+  L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLKEELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AILAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHERTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTGSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLANHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 --------EAQKFVMSI-LVD-------------VKKIVEQADFLSD--TVVKNMTDSIQ 1485
                     AQ F  S  L+D             + +IV+ AD   +   V+ + +D I 
Sbjct: 1147 SFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIVDIADRFEEHGKVLSSASDMIN 1206

Query: 1486 SSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQK 1545
            S+    +G +S +E R                ++ +  + S  V   E    L       
Sbjct: 1207 SAQ---NGLVSTLEER----------------HQALDKLASGLVEKSEGVEKLMQSFEAL 1247

Query: 1546 ICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLN 1605
            + S        F   E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+
Sbjct: 1248 VASA-------FQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELD 1300

Query: 1606 NSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS--------------V 1651
             +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S              V
Sbjct: 1301 TTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPV 1360

Query: 1652 KNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSS 1697
               AAS    + +        ++Q D        + P+ K      A K   W + +L+ 
Sbjct: 1361 PRPAASRPAPVQAPVRAPIAPLAQADVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLAR 1420

Query: 1698 STH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYT 1744
            ++              +  +S SH+       + S++SL  +I++ ID++A V+LW  Y 
Sbjct: 1421 ASREEEEAAQPKVQPTATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYR 1473

Query: 1745 LGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPL 1804
             GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ +
Sbjct: 1474 RGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMV 1533

Query: 1805 VQEHIMSNYGKVYTMLVHASGR 1826
             Q ++ S+ GKVYTML HASGR
Sbjct: 1534 TQTYLTSDTGKVYTMLAHASGR 1555



 Score =  166 bits (421), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 152/626 (24%), Positives = 284/626 (45%), Gaps = 96/626 (15%)

Query: 108 SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
           S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185 SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164 RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
           RA++M +A++S+   AL+L+ PE  + +++ ++S AVR+E+  M E I+R ++RA ELE 
Sbjct: 242 RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLSQAVRREVAAMNEGIERTLARAVELET 301

Query: 224 TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
            V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE LKEELS  S
Sbjct: 302 LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLKEELSSAS 361

Query: 284 --------------------------------------------EEISVHLSRAIDSFQS 299
                                                        +I   ++ + ++F +
Sbjct: 362 NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300 IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
           ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422 LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360 GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
           GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482 GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420 DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
           D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542 DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458 LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
           L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602 LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514 EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
           E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661 EERTASLHNVIAGNQAILAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572 ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                    L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717 ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620 QSHFEETIAGHPQSIVDSISNSTNNL 645
               E TI      I  +++ ST +L
Sbjct: 777 LDGHERTIETRAAEIRSTLTGSTASL 802


>gi|110633761|ref|YP_673969.1| hypothetical protein Meso_1408 [Mesorhizobium sp. BNC1]
 gi|110284745|gb|ABG62804.1| conserved hypothetical protein [Chelativorans sp. BNC1]
          Length = 1652

 Score =  188 bits (477), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 289/1382 (20%), Positives = 574/1382 (41%), Gaps = 252/1382 (18%)

Query: 590  LCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKI 649
                 N++   V+N++++R +L S  LA       ET+AG   S + ++  S+     ++
Sbjct: 376  FAQRINTTGDSVANLLNERSELLSRQLA----TSSETLAGLLDSRISALGESSQEFIKRV 431

Query: 650  MVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLET 709
                +A S+  K L   L   A  +  +IT + + L    D     +    + +   L  
Sbjct: 432  ----SASSDGVKGL---LDERAETLSRQITTSGSGLAELLDTRIATLTERTDHATRTLSD 484

Query: 710  IFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAI 769
            +F   ++ F  +  + SD ++ +  +    I+  F++   R E LL        SE S  
Sbjct: 485  LFDDRVNGFVSSVGSASDRLNALFADRLGEIERTFTD---RGETLL--------SEFSTR 533

Query: 770  SKAMNKSIDDVET--------ISTALKERCQELGSDLVNHSDKVLSSLKQAQ-------- 813
            ++A++  I+ +E+        I+ AL ER +E+    V     V+S+++  +        
Sbjct: 534  AQALDTGIERLESALDARARSINEALVERAREIADTFVRGKQDVISAIEAGRNTIDGELS 593

Query: 814  ELLCTT----------FAQRN-----------DSFVNALADNQSKFENNLVNQSHL---- 848
            EL+ +T          FA+R            D  +      Q++ +  + NQ ++    
Sbjct: 594  ELVASTSIMLQGKAEEFAERLKEGHADLDSRLDQGLGRFHSVQARMDEAITNQINVFEQN 653

Query: 849  ---LLDKLSSDIQKLTDIAY---SKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNT 902
               L + L SDIQKL ++     S+     N L E +G     LE     + E+      
Sbjct: 654  QGRLAELLQSDIQKLDEVHANFESRVSRQINKLIETRGTFAAALEEDIAKIGEQRDGITA 713

Query: 903  LVAKTFEECMSNILLS---YDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFI 959
             +    E+  S         +E  +T++K L+  +D +RQ L  S      AI  AS  +
Sbjct: 714  AIRTDIEQINSAFAAQTGLIEERTKTMEKALTIGVDNVRQTLESS------AIVVASA-L 766

Query: 960  RDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVS 1019
            RD + E +S           S+     +  +  DR +  + +   +L  ++A  +     
Sbjct: 767  RDKVTEATS-----------SLGDETTKLLEGIDRRVAARVESTTRLFTDQAERID---- 811

Query: 1020 TQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKL 1079
                                     ++F   +D I   A+E+   +G   +       ++
Sbjct: 812  -------------------------ATFDSAADRIAARAEEVARRLGEHVE-------QI 839

Query: 1080 EISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITN 1139
            +++ D   ++     E     I   +  I   ++ +  RIS R + +S+ L      I +
Sbjct: 840  DMTFDGATERASGRVEMVAQAIAGQVSRIDSAVDAAADRISTRVEGVSRSLSDQIGQIDS 899

Query: 1140 QIIDSTSRVRGEI---VDISNKFIET--------SRVLEQREEKFHSALDSFS------- 1181
               ++  RV G +     +  + +ET        +R + +R E F S  +          
Sbjct: 900  TFDNAADRVAGRVEGAAKLLGEHVETIDLTLDSAARRIAERTESFQSGFNEIDGRVGTRI 959

Query: 1182 DNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQC 1241
            D IS +L D    ++    E+   I  R  +     ++L+  LE+  + + +Q  E    
Sbjct: 960  DEISSVLSDRADMVARTFEEADQRIVARTKQ-----TSLE--LEARAAAMVEQLAEVEGR 1012

Query: 1242 FETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVI 1301
              T   +  S       +++ S  E    L   + + ++ + +   GA  +    +    
Sbjct: 1013 LRTATGSTSS-------AIMGSVSEVERRLTESVGRTAVALEEGFGGAEER----LKTTA 1061

Query: 1302 DQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTI---ISDAT-DSLNKVDERLHQ 1357
            +Q   + +  L + +A L+S  + I        Q   TI   IS  T +++  ++ER  +
Sbjct: 1062 EQAAQHLSQQLARTQADLVSTADTI-------GQTFATINEHISRRTGETVRTLEERTRE 1114

Query: 1358 TTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSE-IVSKFDKNSQILIKSH 1416
              + +   T  I  +L E+++   ++ +  G   R  +  +++    +  + +  L+   
Sbjct: 1115 FNSVLASRTSEIARILDETARPLVERFESSGGELREGIEAITQQTAERLRQENAALV--- 1171

Query: 1417 DSLMKAQSETKLSLDKDANNLV----DLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFL 1472
            ++L    SET  ++++  NN++    DL  +L +   +    + +   ++  + E+    
Sbjct: 1172 NALASRTSETLSAMERARNNVLGNVGDLLGKLETSGEKLSGLITAATQNLSDVDEKLTGT 1231

Query: 1473 SDTVVKNMTDSIQ-----SSFIKID-GTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDS 1526
            +    +N   + +     +S I  + G L++   R+   + +I     D  +  V    S
Sbjct: 1232 THEFARNAERAAETIANSASLINANSGRLADFSERTLREISVIASRFED--HSRVLETAS 1289

Query: 1527 NFVTLKEKSYDLSNHMRQKICSTIPN-------------------IENIFSTLEEKSDQS 1567
              +   + S   S   RQ+    + N                   IEN     E ++ +S
Sbjct: 1290 ELLEKAQGSLGASLESRQRALDELANGLVEKSEHVERIMKSFEHLIENTIDGAEGRTRES 1349

Query: 1568 MQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESAD 1627
            M    +S+N  V+S T++ +  ++D+  ++R I +++  +R  +KR  V L +EAK+S  
Sbjct: 1350 MDAIRNSINEVVESATRRFAGATEDLRQSAREIRDEIEATRADVKRGIVELPEEAKQSTF 1409

Query: 1628 TIRSAIEEQINTLKDFQKLITDS-----VKNNAASYNKG---LHSDEYNISQV------- 1672
             +R AI EQIN LK+   ++  S     V  ++A    G   L     N  Q+       
Sbjct: 1410 AMRRAITEQINALKELSDIVAKSGRLHDVGGSSARAPDGGPALERVRPNSGQIVTEAGPA 1469

Query: 1673 ---------------DKRPSGKKTK----------NNHAIKEWFNKILSSSTHSKGKSSS 1707
                            +RP     +          ++ + + W   +L S++  + ++++
Sbjct: 1470 LGFSRIVEKPRPDLAPQRPRQSAPRQVVSARDEQPSSPSGEGWIRDLLRSASREE-EAAA 1528

Query: 1708 HIDISDK---DSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVF 1764
                SDK     + S++SL  +I++ ID+D  V+LW+ Y  GE ++F++RLYT+KGQ+ F
Sbjct: 1529 VEAPSDKFPAHVVESLNSLSLDIARAIDHDVSVELWERYRRGERNVFNRRLYTLKGQQTF 1588

Query: 1765 LNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHAS 1824
              +Q +Y+ D+  R A+D+Y  +FE++L+++A+S+ D+ + Q ++ S+ GKVYTML HAS
Sbjct: 1589 DEIQRKYREDAEFRKAVDQYCRDFEKLLADVARSDRDNVMSQTYLTSDTGKVYTMLAHAS 1648

Query: 1825 GR 1826
            GR
Sbjct: 1649 GR 1650



 Score =  176 bits (446), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 254/1237 (20%), Positives = 513/1237 (41%), Gaps = 167/1237 (13%)

Query: 58   LSKNFKQASNKQTYSGFYPAND----LDNGGITH-ILQNIGKNSLNIALRNAFMSSLIWL 112
            L++   Q  +        PAND     D   + H I Q   + +  IA   +    L+  
Sbjct: 124  LTRAEAQPPSTGATPALLPANDDKQTSDYLRLAHTIEQQPSRTNYWIAAALSVAWVLLGA 183

Query: 113  A-CELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDA 171
            A    GF  + +    + S  + A  P  + L   V V+P+LL + F +MI RA++M  A
Sbjct: 184  AVAHFGFGSQIWQ---IGSLSELASAPAALGLIAAV-VMPVLLIWGFAVMIRRAQEMRLA 239

Query: 172  SQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEV 231
            ++++A IA RL +PE  + E++  +  A+R+E+  M+E I+R ++RA ELE  V +E+  
Sbjct: 240  ARNMAEIAFRLTEPENLAHERVMMVGQAIRREVQAMSEGIERTLARAVELETLVHTEVNE 299

Query: 232  LENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISV--- 288
            LE  Y+++E RI  +  +L  ERE I+ H  ++  SI   HE +KEEL+  SE+I V   
Sbjct: 300  LERAYSENEARIRFLVDSLGSEREGIVGHAERVRASITGAHEVIKEELNSASEQIRVTVD 359

Query: 289  ----HLS----RAIDSFQSIVDVRIAKV-------TEKTTRIVQESAQTISSKIDQLLEV 333
                HLS    ++ D+F   ++     V       +E  +R +  S++T++  +D  +  
Sbjct: 360  GTAQHLSTILQQSGDTFAQRINTTGDSVANLLNERSELLSRQLATSSETLAGLLDSRISA 419

Query: 334  LHSTSIVITKD-----------FDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVS 382
            L  +S    K             D R E+LS  +  SG  LA  +      L   TD  +
Sbjct: 420  LGESSQEFIKRVSASSDGVKGLLDERAETLSRQITTSGSGLAELLDTRIATLTERTDHAT 479

Query: 383  IALKEQSQQFMQAFTSHICEMSN----FFSEKQKSITVTLNDVLQSLRISLQEKE---DS 435
              L +     +  F S +   S+     F+++   I  T  D  ++L      +    D+
Sbjct: 480  RTLSDLFDDRVNGFVSSVGSASDRLNALFADRLGEIERTFTDRGETLLSEFSTRAQALDT 539

Query: 436  FCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYK-------DNL 488
                L+S        +D R  ++   +    +EI +TF     D  S  +         L
Sbjct: 540  GIERLESA-------LDARARSINEALVERAREIADTFVRGKQDVISAIEAGRNTIDGEL 592

Query: 489  SEFESN----LQGNIDKLQGCFADSHGNME---DLFLSNIQTIGSNLDKKTLLFEDILSK 541
            SE  ++    LQG  ++      + H +++   D  L    ++ + +D+      ++  +
Sbjct: 593  SELVASTSIMLQGKAEEFAERLKEGHADLDSRLDQGLGRFHSVQARMDEAITNQINVFEQ 652

Query: 542  KQNNISQITSMNTERL-------ENTLTNSINSLKDMLEEKRQRIDSDIGKKSEEL---- 590
             Q  ++++   + ++L       E+ ++  IN L +        ++ DI K  E+     
Sbjct: 653  NQGRLAELLQSDIQKLDEVHANFESRVSRQINKLIETRGTFAAALEEDIAKIGEQRDGIT 712

Query: 591  ------CSSFNSSYQKVSNVISDREKLFSNSLA----RVQSHFEETIAGHPQSIVDSISN 640
                      NS++   + +I +R K    +L      V+   E +      ++ D ++ 
Sbjct: 713  AAIRTDIEQINSAFAAQTGLIEERTKTMEKALTIGVDNVRQTLESSAIVVASALRDKVTE 772

Query: 641  STNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSY 700
            +T++L D+   L        + +D  + A         T+   ++   FD ++  I    
Sbjct: 773  ATSSLGDETTKLL-------EGIDRRVAARVESTTRLFTDQAERIDATFDSAADRIAARA 825

Query: 701  NSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSA 760
                 +L     +H+   + TF+  ++  SG ++   Q I    +    R++        
Sbjct: 826  EEVARRL----GEHVEQIDMTFDGATERASGRVEMVAQAI----AGQVSRID-------- 869

Query: 761  NIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELL---- 816
                  SA+  A ++    VE +S +L ++  ++ S   N +D+V   ++ A +LL    
Sbjct: 870  ------SAVDAAADRISTRVEGVSRSLSDQIGQIDSTFDNAADRVAGRVEGAAKLLGEHV 923

Query: 817  ----------CTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYS 866
                          A+R +SF       QS F N +  +    +D++SS +    D+   
Sbjct: 924  ETIDLTLDSAARRIAERTESF-------QSGF-NEIDGRVGTRIDEISSVLSDRADMVAR 975

Query: 867  KAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTL 926
               +    +        + LE  + AM+E+++     +        S I+ S  E  + L
Sbjct: 976  TFEEADQRIVARTKQTSLELEARAAAMVEQLAEVEGRLRTATGSTSSAIMGSVSEVERRL 1035

Query: 927  DKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLL 986
             + +      L +   G+E ++      A+Q     L +  +R ++ L  + +++  T  
Sbjct: 1036 TESVGRTAVALEEGFGGAEERLKTTAEQAAQH----LSQQLARTQADLVSTADTIGQTFA 1091

Query: 987  RSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASS 1046
              ++   R    ++ E ++ L+ +    ++ ++++T  +   L E  + L    ++S   
Sbjct: 1092 TINEHISR----RTGETVRTLEERTREFNSVLASRTSEIARILDETARPLVERFESSGGE 1147

Query: 1047 FKYLSDSI-----QTLAQELVSVIGSMSQSTTDISGKLEIS----LDSVNQKIQKCREFF 1097
             +   ++I     + L QE  +++ +++  T++    +E +    L +V   + K  E  
Sbjct: 1148 LREGIEAITQQTAERLRQENAALVNALASRTSETLSAMERARNNVLGNVGDLLGKL-ETS 1206

Query: 1098 GDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITN----------QIIDSTSR 1147
            G+ +   +   ++ +   +++++  T E ++   +  + I N          ++ D + R
Sbjct: 1207 GEKLSGLITAATQNLSDVDEKLTGTTHEFARNAERAAETIANSASLINANSGRLADFSER 1266

Query: 1148 VRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNI 1184
               EI  I+++F + SRVLE   E    A  S   ++
Sbjct: 1267 TLREISVIASRFEDHSRVLETASELLEKAQGSLGASL 1303


>gi|161618975|ref|YP_001592862.1| hypothetical protein BCAN_A1038 [Brucella canis ATCC 23365]
 gi|254704316|ref|ZP_05166144.1| hypothetical protein Bsuib36_10374 [Brucella suis bv. 3 str. 686]
 gi|260566437|ref|ZP_05836907.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|161335786|gb|ABX62091.1| Hypothetical protein BCAN_A1038 [Brucella canis ATCC 23365]
 gi|260155955|gb|EEW91035.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
          Length = 1557

 Score =  188 bits (477), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 606/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGN- 881
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 882  --VGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
              +   ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     ++LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQILQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAANTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1147 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1181

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1182 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1235

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1236 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1296 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1355

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1356 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1415

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1416 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1468

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++
Sbjct: 1469 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARND 1528

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1529 RDNMVTQTYLTSDTGKVYTMLAHASGR 1555



 Score =  167 bits (424), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 242/1124 (21%), Positives = 465/1124 (41%), Gaps = 183/1124 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQILQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            ++         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAANTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTT-----------FAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIA 864
               T            A R+      L D        L +    L  +L       TD  
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 865  YSKAIDVANSLTEI---------QGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNI 915
             S+   + N+L            Q  VG++ +N S+ ++++++ASN  + K  +    N+
Sbjct: 1077 RSENAALVNALASRTAETIAAVQQAKVGLS-DNVSE-LIDRLAASNGELGKLIDAATRNL 1134

Query: 916  LLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIGSASQF-------IRDILDEN 966
                D + + +D   S  ++ +   Q    S   ID  +G+           I DI D  
Sbjct: 1135 ---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADRF 1191

Query: 967  SSRIESLLSCSN------NSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLSTA 1017
                + L S S+      N + STL   HQ  D+L   L EKS+ + +L+ +  + +++A
Sbjct: 1192 DEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVASA 1251

Query: 1018 VSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
                      + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1252 FQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|306840509|ref|ZP_07473268.1| Hypothetical protein BIBO2_0308 [Brucella sp. BO2]
 gi|306289524|gb|EFM60742.1| Hypothetical protein BIBO2_0308 [Brucella sp. BO2]
          Length = 1557

 Score =  187 bits (476), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 607/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L+  L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLKEELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVEDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTTSLHNVIAGNQ 675

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AILAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILEERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHERTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1147 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1181

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1182 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1235

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1236 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1296 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1355

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K  +   A K   W +
Sbjct: 1356 ADRPVSRPAASRPAPVQAPVRAPIAPLAQADVAVRSRPVEAPNQKPAQVASAEKPRGWVS 1415

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1416 DLLARASREEEEAAQPKVQPTATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1468

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++
Sbjct: 1469 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARND 1528

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1529 RDNMVTQTYLTSDTGKVYTMLAHASGR 1555



 Score =  179 bits (455), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 249/1126 (22%), Positives = 472/1126 (41%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++S AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLSQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE LKEELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLKEELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKS------ 413
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S      
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVE 541

Query: 414  -ITVTLNDVLQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
             I V + D L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTTSLHNVIAGNQAILAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     LEE+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILEERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHERTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|261754985|ref|ZP_05998694.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261744738|gb|EEY32664.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 1582

 Score =  187 bits (476), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 607/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     ++LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQILQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAANTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1052 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1078

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1079 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1119

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1120 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1172 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1206

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1207 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1260

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1261 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1321 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1380

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1381 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1440

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1441 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1493

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++
Sbjct: 1494 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARND 1553

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1554 RDNMVTQTYLTSDTGKVYTMLAHASGR 1580



 Score =  166 bits (421), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 150/626 (23%), Positives = 285/626 (45%), Gaps = 96/626 (15%)

Query: 108 SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
           S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210 SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164 RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
           RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267 RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224 TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
            V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327 LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284 --------------------------------------------EEISVHLSRAIDSFQS 299
                                                        +I   ++ + ++F +
Sbjct: 387 NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300 IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
           ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447 LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360 GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
           GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507 GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420 DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
           D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567 DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458 LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
           L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627 LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514 EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
           E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686 EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572 ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                    L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742 ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620 QSHFEETIAGHPQSIVDSISNSTNNL 645
               E+TI      I  ++++ST +L
Sbjct: 802 LDGHEQTIETRAAEIRSTLTDSTASL 827


>gi|23501904|ref|NP_698031.1| hypothetical protein BR1024 [Brucella suis 1330]
 gi|23347846|gb|AAN29946.1| conserved hypothetical protein [Brucella suis 1330]
          Length = 1557

 Score =  187 bits (475), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 606/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAKRVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     ++LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQILQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1147 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1181

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1182 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1235

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1236 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1296 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1355

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1356 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1415

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1416 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1468

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++
Sbjct: 1469 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARND 1528

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1529 RDNMVTQTYLTSDTGKVYTMLAHASGR 1555



 Score =  167 bits (423), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 243/1124 (21%), Positives = 465/1124 (41%), Gaps = 183/1124 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAAAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAKRVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQILQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTT-----------FAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIA 864
               T            A R+      L D        L +    L  +L       TD  
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 865  YSKAIDVANSLTEI---------QGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNI 915
             S+   + N+L            Q  VG++ +N S+ ++++++ASN  + K  +    N+
Sbjct: 1077 RSENAALVNALASRTAETIAAVQQAKVGLS-DNVSE-LIDRLAASNGELGKLIDAATRNL 1134

Query: 916  LLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIGSASQF-------IRDILDEN 966
                D + + +D   S  ++ +   Q    S   ID  +G+           I DI D  
Sbjct: 1135 ---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADRF 1191

Query: 967  SSRIESLLSCSN------NSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLSTA 1017
                + L S S+      N + STL   HQ  D+L   L EKS+ + +L+ +  + +++A
Sbjct: 1192 DEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVASA 1251

Query: 1018 VSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
                      + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1252 FQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|261317657|ref|ZP_05956854.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261296880|gb|EEY00377.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
          Length = 1582

 Score =  187 bits (474), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 316/1447 (21%), Positives = 605/1447 (41%), Gaps = 299/1447 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1052 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1078

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1079 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1119

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1120 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1450 --------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
                     AQ F  S  L+D    +     LSD  +  + D I   F +    LS+   
Sbjct: 1172 SFVENTNRAAQMFQASTGLIDSN--LGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS--- 1225

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
             + D +    + L    ++  + +D     L EKS  +   M+    S    + + F   
Sbjct: 1226 -ASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRA 1280

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  
Sbjct: 1281 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPA 1340

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE 1666
            EAKE+   +R A+ EQIN LK+  +++  S              V   AAS    + +  
Sbjct: 1341 EAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV 1400

Query: 1667 ----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH------------ 1700
                  ++Q D        + P+ K      A K   W + +L+ ++             
Sbjct: 1401 RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQP 1460

Query: 1701 -SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIK 1759
             +  +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+K
Sbjct: 1461 AATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLK 1513

Query: 1760 GQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTM 1819
            GQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTM
Sbjct: 1514 GQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTM 1573

Query: 1820 LVHASGR 1826
            L HASGR
Sbjct: 1574 LAHASGR 1580



 Score =  177 bits (450), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|260168733|ref|ZP_05755544.1| hypothetical protein BruF5_10263 [Brucella sp. F5/99]
 gi|261758211|ref|ZP_06001920.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261738195|gb|EEY26191.1| conserved hypothetical protein [Brucella sp. F5/99]
          Length = 1557

 Score =  187 bits (474), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 316/1447 (21%), Positives = 604/1447 (41%), Gaps = 299/1447 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGN- 881
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 882  --VGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
              +   ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 --------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
                     AQ F  S  L+D    +     LSD  +  + D I   F +    LS+   
Sbjct: 1147 SFVENTNRAAQMFQASTGLIDSN--LGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS--- 1200

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
             + D +    + L    ++  + +D     L EKS  +   M+    S    + + F   
Sbjct: 1201 -ASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRA 1255

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  
Sbjct: 1256 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPA 1315

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE 1666
            EAKE+   +R A+ EQIN LK+  +++  S              V   AAS    + +  
Sbjct: 1316 EAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV 1375

Query: 1667 ----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH------------ 1700
                  ++Q D        + P+ K      A K   W + +L+ ++             
Sbjct: 1376 RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQP 1435

Query: 1701 -SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIK 1759
             +  +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+K
Sbjct: 1436 AATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLK 1488

Query: 1760 GQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTM 1819
            GQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTM
Sbjct: 1489 GQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTM 1548

Query: 1820 LVHASGR 1826
            L HASGR
Sbjct: 1549 LAHASGR 1555



 Score =  177 bits (449), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|294852386|ref|ZP_06793059.1| hypothetical protein BAZG_01313 [Brucella sp. NVSL 07-0026]
 gi|294820975|gb|EFG37974.1| hypothetical protein BAZG_01313 [Brucella sp. NVSL 07-0026]
          Length = 1582

 Score =  187 bits (474), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 606/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AILAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1052 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1078

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1079 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1119

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1120 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1172 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1206

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1207 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1260

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1261 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1321 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1380

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1381 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1440

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1441 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1493

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++
Sbjct: 1494 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARND 1553

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1554 RDNMVTQTYLTSDTGKVYTMLAHASGR 1580



 Score =  177 bits (448), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAILAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|256369448|ref|YP_003106956.1| hypothetical protein BMI_I1027 [Brucella microti CCM 4915]
 gi|255999608|gb|ACU48007.1| hypothetical protein BMI_I1027 [Brucella microti CCM 4915]
          Length = 1578

 Score =  186 bits (473), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 318/1470 (21%), Positives = 606/1470 (41%), Gaps = 345/1470 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 319  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 367

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 368  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 426

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 427  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 464

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 465  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 524

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 525  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 584

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCT---TFAQRNDSFVNALADN 834
            D        L E    L + L   +++V S       ++C    T A R     NA+ D 
Sbjct: 585  DKAAAFEGKLAESRDLLAATLEGETERVSS-------VICGHADTLAARTGDIQNAI-DA 636

Query: 835  QSKFENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQ 879
             +   N + ++   +L + +S +Q+       L D +++   D A SL E        I 
Sbjct: 637  SASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIA 693

Query: 880  GNVGVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDV 936
            GN  +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    
Sbjct: 694  GNQAMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARN 753

Query: 937  LRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS---------------- 980
            + ++L    +  + A+G   + +R + +E +S ++++L+  N++                
Sbjct: 754  MAESLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRA 809

Query: 981  --VNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLEN 1027
              + STL  S     + LQ+      ++L+ + + L  A++            QT  +E 
Sbjct: 810  AEIRSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEE 865

Query: 1028 NLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVN 1087
              +  EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD   
Sbjct: 866  RTETMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG-- 920

Query: 1088 QKIQKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTS 1146
                     FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D   
Sbjct: 921  ---------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELG 963

Query: 1147 RVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLI 1206
             +   I D + K   TS  L    E F +   S +DN++                     
Sbjct: 964  TIEARIADTAAK---TSETLASHSESFSA---SVADNLAGT------------------- 998

Query: 1207 EQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKE 1266
            E R+ E  D ++     L   GS +  +             ++E+   +  D+  ++ +E
Sbjct: 999  ETRLVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEE 1044

Query: 1267 RSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKI 1326
            R+  L+ +L+ RS EI+                    +I N                E +
Sbjct: 1045 RTRELNAVLAARSQEIT--------------------KILN-------------DTAEPL 1071

Query: 1327 TNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKD 1386
              R+ DS + +   + +AT          H  T+R+      +   LA  S+  E     
Sbjct: 1072 VQRLADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET---- 1115

Query: 1387 LGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVS 1446
                  ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV 
Sbjct: 1116 ------IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVD 1164

Query: 1447 KSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTV 1506
             ++                     F+ +T         Q+S   ID  L  + T S +T+
Sbjct: 1165 STT--------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL 1202

Query: 1507 RLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEE 1562
                  +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L E
Sbjct: 1203 ----SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVE 1253

Query: 1563 KSD------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTS 1597
            KS+      QS +  +                   +S+++ V+   QK S  +D+I  T+
Sbjct: 1254 KSEGVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTA 1313

Query: 1598 RRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS------- 1650
              I  +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S       
Sbjct: 1314 SEIRAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVG 1373

Query: 1651 -------VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE-- 1689
                   V   AAS    + +        ++Q D        + P+ K      A K   
Sbjct: 1374 EGRADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRG 1433

Query: 1690 WFNKILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAF 1736
            W + +L+ ++              +  +S SH+       + S++SL  +I++ ID++A 
Sbjct: 1434 WVSDLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEAS 1486

Query: 1737 VQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIA 1796
            V+LW  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A
Sbjct: 1487 VELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVA 1546

Query: 1797 QSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1547 RNDRDNMVTQTYLTSDTGKVYTMLAHASGR 1576



 Score =  176 bits (446), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 206  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 262

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 263  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 322

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 323  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 382

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 383  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 442

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 443  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 502

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 503  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 562

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 563  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVICGHADT 622

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 623  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 681

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 682  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 737

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 738  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 797

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 798  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 857

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 858  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 917

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 918  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 977

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 978  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1037

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1038 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1097

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1098 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1153

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1154 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1210

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1211 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1270

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1271 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1316


>gi|254710108|ref|ZP_05171919.1| hypothetical protein BpinB_07501 [Brucella pinnipedialis B2/94]
          Length = 1557

 Score =  186 bits (473), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 316/1447 (21%), Positives = 604/1447 (41%), Gaps = 299/1447 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGN- 881
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 882  --VGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
              +   ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 --------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
                     AQ F  S  L+D    +     LSD  +  + D I   F +    LS+   
Sbjct: 1147 SFVENTNRAAQMFQASTGLIDSN--LGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS--- 1200

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
             + D +    + L    ++  + +D     L EKS  +   M+    S    + + F   
Sbjct: 1201 -ASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRA 1255

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  
Sbjct: 1256 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPA 1315

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE 1666
            EAKE+   +R A+ EQIN LK+  +++  S              V   AAS    + +  
Sbjct: 1316 EAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV 1375

Query: 1667 ----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH------------ 1700
                  ++Q D        + P+ K      A K   W + +L+ ++             
Sbjct: 1376 RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQP 1435

Query: 1701 -SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIK 1759
             +  +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+K
Sbjct: 1436 AATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLK 1488

Query: 1760 GQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTM 1819
            GQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTM
Sbjct: 1489 GQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTM 1548

Query: 1820 LVHASGR 1826
            L HASGR
Sbjct: 1549 LAHASGR 1555



 Score =  177 bits (449), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|62289947|ref|YP_221740.1| hypothetical protein BruAb1_1029 [Brucella abortus bv. 1 str. 9-941]
 gi|62196079|gb|AAX74379.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
          Length = 1553

 Score =  186 bits (473), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 305/1470 (20%), Positives = 604/1470 (41%), Gaps = 349/1470 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNK 725
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHA-------- 495

Query: 726  SDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVET-IS 784
                   L NST+ ++      ++++ E L + +  I    S    ++   +DD++  I 
Sbjct: 496  -------LDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIG 548

Query: 785  TALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTF---AQRNDSFVNALADNQSKFENN 841
              L    + +G+ L++ +      L ++++LL  T     +R  S +   AD  +    +
Sbjct: 549  DDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAARTGD 608

Query: 842  LVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTE-IQGNVGV---TLENHSQAMLEK- 896
            + N     +D  +S + ++TD   +   +  ++L + +  NV +   +  +H++++ E+ 
Sbjct: 609  IQNA----IDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSLEERT 664

Query: 897  ------ISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDG 950
                  I+ +  ++A+  +E  + +  +++ENR+ L +   + I  L+  +A +++ ++ 
Sbjct: 665  ASLHNVIAGNQAMLAQLMDERAAVMRENFNENREVLARTFDERIGSLQSLIAENQSALE- 723

Query: 951  AIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNK 1010
                       ILDE +  +   L    ++  + L     +  R ++E++  L  +L+N 
Sbjct: 724  ----------RILDERARNMAESLGAGRDAFETAL----GEHVRTVEERTSGLQAVLNNH 769

Query: 1011 ASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSV------ 1064
               L+  +      +E    E   +L+   D++AS  + L D  + L Q   S+      
Sbjct: 770  NDALAHVLDGHEQTIETRAAEIRSTLT---DSTASLSQTLQDHGEILEQRTTSLQNAIAN 826

Query: 1065 ------------IGSMSQSTTDISGKLEISLDSVNQKIQ--------KCRE--------- 1095
                         G + + T  +   L I +D+V + ++        K RE         
Sbjct: 827  SSAAISSAFEGQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTL 886

Query: 1096 ------------FFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQII 1142
                         FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ 
Sbjct: 887  AAEAAKAGEALDGFGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLT 938

Query: 1143 DSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNES 1202
            D    +   I D + K   TS  L    E F +   S +DN++                 
Sbjct: 939  DELGTIEARIADTAAK---TSETLASHSESFSA---SVADNLAGT--------------- 977

Query: 1203 RSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLL 1262
                E R+ E  D ++     L   GS +  +             ++E+   +  D+  +
Sbjct: 978  ----ETRLVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAV 1019

Query: 1263 SFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISD 1322
            + +ER+  L+ +L+ RS EI+                    +I N               
Sbjct: 1020 TLEERTRELNAVLAARSQEIT--------------------KILN-------------DT 1046

Query: 1323 VEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEK 1382
             E +  R+ DS + +   + +AT          H  T+R+      +   LA  S+  E 
Sbjct: 1047 AEPLVQRLADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET 1094

Query: 1383 KIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTS 1442
                      ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  
Sbjct: 1095 ----------IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDG 1139

Query: 1443 RLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRS 1502
            RLV  ++                     F+ +T         Q+S   ID  L  + T S
Sbjct: 1140 RLVDSTT--------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLS 1177

Query: 1503 RDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFS 1558
             +T+      +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S
Sbjct: 1178 DNTL----SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLAS 1228

Query: 1559 TLEEKSD------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDI 1593
             L EKS+      QS +  +                   +S+++ V+   QK S  +D+I
Sbjct: 1229 GLVEKSEGVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEI 1288

Query: 1594 ALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS--- 1650
              T+  I  +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S   
Sbjct: 1289 RRTASEIRAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRL 1348

Query: 1651 -----------VKNNAASYNKGLHSDEYNISQVD--------KRPSGKKTKNNHAIKE-- 1689
                       V   AAS    + +    ++Q D        + P+ K      A K   
Sbjct: 1349 VDVGEGRADRPVSRPAASRPAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRG 1408

Query: 1690 WFNKILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAF 1736
            W + +L+ ++              +  +S SH+       + S++SL  +I++ ID++A 
Sbjct: 1409 WVSDLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEAS 1461

Query: 1737 VQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIA 1796
            V+LW  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A
Sbjct: 1462 VELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVA 1521

Query: 1797 QSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1522 RNDRDNMVTQTYLTSDTGKVYTMLAHASGR 1551



 Score =  179 bits (454), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 239/1122 (21%), Positives = 478/1122 (42%), Gaps = 179/1122 (15%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M DA++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQDAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSN-------LDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSIN 566
            E+   S    I  N       +D++  +  +  ++ +  +++        L++ +  + +
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAVMRENFNENREVLARTFDERIGSLQSLIAENQS 720

Query: 567  SLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARVQSHF 623
            +L+ +L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V    
Sbjct: 721  ALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHVLDGH 780

Query: 624  EETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA----------TD 673
            E+TI      I  ++++ST +L   +      L +   SL N++   +          T 
Sbjct: 781  EQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFEGQTG 840

Query: 674  VVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKHLHSF 718
            ++ + T   E  L      V R  E S  ++            S+         + L  F
Sbjct: 841  IIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDGF 900

Query: 719  NDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIE 763
             ++F                 ++D ++G L +    + D       R+ +     S  + 
Sbjct: 901  GESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTSETLA 960

Query: 764  SELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTT 819
            S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  +    T
Sbjct: 961  SHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDTTAVT 1020

Query: 820  FAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKLSSDI 857
              +R                   ND+    V  LAD+       L   +H   D+L S+ 
Sbjct: 1021 LEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRSEN 1080

Query: 858  QKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILL 917
              L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    N+  
Sbjct: 1081 AALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATRNL-- 1134

Query: 918  SYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRDILDE 965
              D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D  DE
Sbjct: 1135 -ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADRFDE 1193

Query: 966  NSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLSTAVS 1019
            +   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + +++A  
Sbjct: 1194 HGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVASAFQ 1253

Query: 1020 TQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
                    + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1254 RAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|256044682|ref|ZP_05447586.1| hypothetical protein Bmelb1R_09318 [Brucella melitensis bv. 1 str.
            Rev.1]
 gi|260564028|ref|ZP_05834514.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260154044|gb|EEW89136.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
          Length = 1557

 Score =  186 bits (473), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 607/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1147 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1181

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1182 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1235

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1236 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1296 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1355

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1356 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1415

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1416 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1468

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++
Sbjct: 1469 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARND 1528

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1529 RDNMVTQTYLTSDTGKVYTMLAHASGR 1555



 Score =  176 bits (447), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 472/1126 (41%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S+ W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVAWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|163843292|ref|YP_001627696.1| hypothetical protein BSUIS_A1067 [Brucella suis ATCC 23445]
 gi|163674015|gb|ABY38126.1| Hypothetical protein BSUIS_A1067 [Brucella suis ATCC 23445]
          Length = 1552

 Score =  186 bits (473), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 606/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 293  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 341

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 342  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 400

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 401  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 438

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 439  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 498

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 499  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 558

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 559  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 613

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGN- 881
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 614  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 670

Query: 882  --VGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
              +   ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 671  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 730

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 731  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 786

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 787  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 842

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 843  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 894

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 895  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 940

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 941  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 975

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 976  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1021

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1022 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1048

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1049 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1089

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1090 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1141

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1142 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1176

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1177 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1230

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1231 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1290

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1291 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1350

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1351 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1410

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1411 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1463

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++
Sbjct: 1464 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARND 1523

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1524 RDNMVTQTYLTSDTGKVYTMLAHASGR 1550



 Score =  177 bits (450), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 180  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 236

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 237  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 296

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 297  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 356

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 357  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 416

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 417  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 476

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 477  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 536

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 537  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 596

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 597  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 655

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 656  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 711

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 712  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 771

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 772  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 831

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 832  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 891

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 892  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 951

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 952  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1011

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1012 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1071

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1072 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1127

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1128 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1184

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1185 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1244

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1245 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1290


>gi|256031604|ref|ZP_05445218.1| hypothetical protein BpinM2_13283 [Brucella pinnipedialis M292/94/1]
          Length = 1557

 Score =  186 bits (473), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 316/1447 (21%), Positives = 605/1447 (41%), Gaps = 299/1447 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGN- 881
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 882  --VGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
              +   ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 --------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
                     AQ F  S  L+D    +     LSD  +  + D I   F +    LS+   
Sbjct: 1147 SFVENTNRAAQMFQASTGLIDSN--LGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS--- 1200

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
             + D +    + L    ++  + +D     L EKS  +   M+    S    + + F   
Sbjct: 1201 -ASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRA 1255

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  
Sbjct: 1256 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPA 1315

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE 1666
            EAKE+   +R A+ EQIN LK+  +++  S              V   AAS    + +  
Sbjct: 1316 EAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV 1375

Query: 1667 ----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH------------ 1700
                  ++Q D        + P+ K      A K   W + +L+ ++             
Sbjct: 1376 RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQP 1435

Query: 1701 -SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIK 1759
             +  +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+K
Sbjct: 1436 AATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLK 1488

Query: 1760 GQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTM 1819
            GQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTM
Sbjct: 1489 GQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTM 1548

Query: 1820 LVHASGR 1826
            L HASGR
Sbjct: 1549 LAHASGR 1555



 Score =  177 bits (448), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|265994943|ref|ZP_06107500.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether]
 gi|262766056|gb|EEZ11845.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether]
          Length = 1582

 Score =  186 bits (473), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 312/1470 (21%), Positives = 597/1470 (40%), Gaps = 345/1470 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                NS+      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNSITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++ +    I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDNIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTEIQGNVGVTLENHS 890
              N + ++   +L + +S +Q+       L D +++   D A SL           E  +
Sbjct: 644  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSL-----------EERT 689

Query: 891  QAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDG 950
             ++   I+ +  ++A+  +E  + +  +++ENR+ L +   + I  L+  +A +++ ++ 
Sbjct: 690  ASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALE- 748

Query: 951  AIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNK 1010
                       ILDE +  +   L    ++   T L  H    R ++E++  L  +L+N 
Sbjct: 749  ----------RILDERARNMAESLGAGCDAFE-TALGEHV---RAVEERTSGLQAVLNNH 794

Query: 1011 ASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSV------ 1064
               L+  +      +E    E   +L+   D++AS  + L D  + L Q   S+      
Sbjct: 795  NDALAHVLDGHEQTIETRAAEIRSTLT---DSTASLSQTLQDHGEILEQRTTSLQNAIAN 851

Query: 1065 ------------IGSMSQSTTDISGKLEISLDSVNQKIQ--------KCREFFGDNIVAF 1104
                         G + + T  +   L I +D+V + ++        K RE  G+     
Sbjct: 852  SSAAISSAFEGQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTL 911

Query: 1105 MDEISKVMEI------------------SEKRISQRTQEISQQLLQNNDVITNQIIDSTS 1146
              E +K  E                   +E R+ +R   I+ +L    D I +++ D   
Sbjct: 912  AAEATKAGEALDGFGESFSARLIDNLSGTEARLGERADAIAGRL---GD-IESRLTDELG 967

Query: 1147 RVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLI 1206
             +   I D + K   TS  L    E F +   S +DN++                     
Sbjct: 968  TIEARIADTAAK---TSETLASHSESFSA---SVADNLAGT------------------- 1002

Query: 1207 EQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKE 1266
            E R+ E  D ++     L   GS +  +             ++E+   +  D+  ++ +E
Sbjct: 1003 ETRLVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEE 1048

Query: 1267 RSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKI 1326
            R+  L+ +L+ RS EI+                    +I N                E +
Sbjct: 1049 RTRELNAVLAARSQEIT--------------------KILN-------------DTAEPL 1075

Query: 1327 TNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKD 1386
              R+ DS + +   + +AT          H  T+R+      +   LA  S+  E     
Sbjct: 1076 VQRLADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET---- 1119

Query: 1387 LGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVS 1446
                  ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV 
Sbjct: 1120 ------IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVD 1168

Query: 1447 KSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTV 1506
             ++                     F+ +T         Q+S   ID  L  + T S +T+
Sbjct: 1169 STT--------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL 1206

Query: 1507 RLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEE 1562
                  +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L E
Sbjct: 1207 ----SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVE 1257

Query: 1563 KSD------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTS 1597
            KS+      QS +  +                   +S+++ V+   QK S  +D+I  T+
Sbjct: 1258 KSEGVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTA 1317

Query: 1598 RRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS------- 1650
              I  +L+ +R  LKR  + +  EAKE+  ++R A+ EQIN LK+  +++  S       
Sbjct: 1318 SEIRAELDTTRGELKRGVLDMPAEAKETTTSMRKAVSEQINALKELAEIVNKSGRLVDVG 1377

Query: 1651 -------VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE-- 1689
                   V   AAS    + +        ++Q D        + P+ K      A K   
Sbjct: 1378 EGRADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRG 1437

Query: 1690 WFNKILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAF 1736
            W + +L+ ++              +  +S SH+       + S++SL  +I++ ID++A 
Sbjct: 1438 WVSDLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEAS 1490

Query: 1737 VQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIA 1796
            V+LW  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L + A
Sbjct: 1491 VELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDAA 1550

Query: 1797 QSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1551 RNDRDNMVTQTYLTSDTGKVYTMLAHASGR 1580



 Score =  179 bits (455), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 249/1126 (22%), Positives = 479/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S+ W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVAWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELS--- 280
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS   
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 281  --------LTSEEISVHLS----RAI-----------------------------DSFQS 299
                      S+++S  L     R I                             ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNSITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKS------ 413
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S      
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 414  -ITVTLNDVLQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
             I V + D L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  NIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLE 573
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ ++ 
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 574  EKRQRIDSDIGKKSEEL-------CSSFNSSYQKVSNVISDR----EKLFSN---SLARV 619
            E +  ++  + +++  +       C +F ++  +    + +R    + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGCDAFETALGEHVRAVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+     T   + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEATKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|254714109|ref|ZP_05175920.1| hypothetical protein BcetM6_12280 [Brucella ceti M644/93/1]
 gi|254716834|ref|ZP_05178645.1| hypothetical protein BcetM_10514 [Brucella ceti M13/05/1]
          Length = 1557

 Score =  186 bits (472), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 316/1447 (21%), Positives = 605/1447 (41%), Gaps = 299/1447 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGN- 881
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 882  --VGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
              +   ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMTE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 --------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
                     AQ F  S  L+D    +     LSD  +  + D I   F +    LS+   
Sbjct: 1147 SFVENTNRAAQMFQASTGLIDSN--LGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS--- 1200

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
             + D +    + L    ++  + +D     L EKS  +   M+    S    + + F   
Sbjct: 1201 -ASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRA 1255

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  
Sbjct: 1256 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPA 1315

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE 1666
            EAKE+   +R A+ EQIN LK+  +++  S              V   AAS    + +  
Sbjct: 1316 EAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV 1375

Query: 1667 ----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH------------ 1700
                  ++Q D        + P+ K      A K   W + +L+ ++             
Sbjct: 1376 RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQP 1435

Query: 1701 -SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIK 1759
             +  +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+K
Sbjct: 1436 AATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLK 1488

Query: 1760 GQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTM 1819
            GQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTM
Sbjct: 1489 GQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTM 1548

Query: 1820 LVHASGR 1826
            L HASGR
Sbjct: 1549 LAHASGR 1555



 Score =  177 bits (448), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMTESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|225852528|ref|YP_002732761.1| hypothetical protein BMEA_A1064 [Brucella melitensis ATCC 23457]
 gi|256263982|ref|ZP_05466514.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9]
 gi|225640893|gb|ACO00807.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|263094126|gb|EEZ18048.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326409044|gb|ADZ66109.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538753|gb|ADZ86968.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 1557

 Score =  186 bits (472), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 607/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLATSNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1147 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1181

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1182 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1235

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1236 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1296 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1355

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1356 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1415

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1416 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1468

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++
Sbjct: 1469 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARND 1528

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1529 RDNMVTQTYLTSDTGKVYTMLAHASGR 1555



 Score =  174 bits (442), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 243/1126 (21%), Positives = 471/1126 (41%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S+ W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVAWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ SN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLATSNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|265988692|ref|ZP_06101249.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264660889|gb|EEZ31150.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
          Length = 1582

 Score =  186 bits (472), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 316/1447 (21%), Positives = 605/1447 (41%), Gaps = 299/1447 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1052 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1078

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1079 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1119

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1120 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1450 --------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
                     AQ F  S  L+D    +     LSD  +  + D I   F +    LS+   
Sbjct: 1172 SFVENTNRAAQMFQASTGLIDSN--LGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS--- 1225

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
             + D +    + L    ++  + +D     L EKS  +   M+    S    + + F   
Sbjct: 1226 -ASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRA 1280

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  
Sbjct: 1281 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPA 1340

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE 1666
            EAKE+   +R A+ EQIN LK+  +++  S              V   AAS    + +  
Sbjct: 1341 EAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV 1400

Query: 1667 ----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH------------ 1700
                  ++Q D        + P+ K      A K   W + +L+ ++             
Sbjct: 1401 RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQP 1460

Query: 1701 -SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIK 1759
             +  +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+K
Sbjct: 1461 AATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLK 1513

Query: 1760 GQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTM 1819
            GQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTM
Sbjct: 1514 GQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTM 1573

Query: 1820 LVHASGR 1826
            L HASGR
Sbjct: 1574 LAHASGR 1580



 Score =  177 bits (448), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|265991106|ref|ZP_06103663.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263001890|gb|EEZ14465.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1]
          Length = 1582

 Score =  186 bits (472), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 606/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1052 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1078

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1079 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1119

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1120 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1172 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1206

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1207 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1260

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1261 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1321 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1380

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1381 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1440

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1441 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1493

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++
Sbjct: 1494 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARND 1553

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1554 RDNMVTQTYLTSDTGKVYTMLAHASGR 1580



 Score =  176 bits (447), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 472/1126 (41%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S+ W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVAWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|261218636|ref|ZP_05932917.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261321866|ref|ZP_05961063.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260923725|gb|EEX90293.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294556|gb|EEX98052.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 1582

 Score =  186 bits (472), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 316/1447 (21%), Positives = 605/1447 (41%), Gaps = 299/1447 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMTE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1052 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1078

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1079 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1119

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1120 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1450 --------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
                     AQ F  S  L+D    +     LSD  +  + D I   F +    LS+   
Sbjct: 1172 SFVENTNRAAQMFQASTGLIDSN--LGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS--- 1225

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
             + D +    + L    ++  + +D     L EKS  +   M+    S    + + F   
Sbjct: 1226 -ASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRA 1280

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  
Sbjct: 1281 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPA 1340

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE 1666
            EAKE+   +R A+ EQIN LK+  +++  S              V   AAS    + +  
Sbjct: 1341 EAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV 1400

Query: 1667 ----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH------------ 1700
                  ++Q D        + P+ K      A K   W + +L+ ++             
Sbjct: 1401 RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQP 1460

Query: 1701 -SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIK 1759
             +  +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+K
Sbjct: 1461 AATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLK 1513

Query: 1760 GQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTM 1819
            GQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTM
Sbjct: 1514 GQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTM 1573

Query: 1820 LVHASGR 1826
            L HASGR
Sbjct: 1574 LAHASGR 1580



 Score =  177 bits (448), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 473/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMTESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|256113576|ref|ZP_05454396.1| hypothetical protein Bmelb3E_12497 [Brucella melitensis bv. 3 str.
            Ether]
          Length = 1557

 Score =  186 bits (471), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 312/1470 (21%), Positives = 597/1470 (40%), Gaps = 345/1470 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                NS+      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNSITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++ +    I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDNIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTEIQGNVGVTLENHS 890
              N + ++   +L + +S +Q+       L D +++   D A SL           E  +
Sbjct: 619  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSL-----------EERT 664

Query: 891  QAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDG 950
             ++   I+ +  ++A+  +E  + +  +++ENR+ L +   + I  L+  +A +++ ++ 
Sbjct: 665  ASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALE- 723

Query: 951  AIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNK 1010
                       ILDE +  +   L    ++   T L  H    R ++E++  L  +L+N 
Sbjct: 724  ----------RILDERARNMAESLGAGCDAFE-TALGEHV---RAVEERTSGLQAVLNNH 769

Query: 1011 ASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSV------ 1064
               L+  +      +E    E   +L+   D++AS  + L D  + L Q   S+      
Sbjct: 770  NDALAHVLDGHEQTIETRAAEIRSTLT---DSTASLSQTLQDHGEILEQRTTSLQNAIAN 826

Query: 1065 ------------IGSMSQSTTDISGKLEISLDSVNQKIQ--------KCREFFGDNIVAF 1104
                         G + + T  +   L I +D+V + ++        K RE  G+     
Sbjct: 827  SSAAISSAFEGQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTL 886

Query: 1105 MDEISKVMEI------------------SEKRISQRTQEISQQLLQNNDVITNQIIDSTS 1146
              E +K  E                   +E R+ +R   I+ +L    D I +++ D   
Sbjct: 887  AAEATKAGEALDGFGESFSARLIDNLSGTEARLGERADAIAGRL---GD-IESRLTDELG 942

Query: 1147 RVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLI 1206
             +   I D + K   TS  L    E F +   S +DN++                     
Sbjct: 943  TIEARIADTAAK---TSETLASHSESFSA---SVADNLAGT------------------- 977

Query: 1207 EQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKE 1266
            E R+ E  D ++     L   GS +  +             ++E+   +  D+  ++ +E
Sbjct: 978  ETRLVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEE 1023

Query: 1267 RSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKI 1326
            R+  L+ +L+ RS EI+                    +I N                E +
Sbjct: 1024 RTRELNAVLAARSQEIT--------------------KILN-------------DTAEPL 1050

Query: 1327 TNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKD 1386
              R+ DS + +   + +AT          H  T+R+      +   LA  S+  E     
Sbjct: 1051 VQRLADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET---- 1094

Query: 1387 LGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVS 1446
                  ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV 
Sbjct: 1095 ------IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVD 1143

Query: 1447 KSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTV 1506
             ++                     F+ +T         Q+S   ID  L  + T S +T+
Sbjct: 1144 STT--------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL 1181

Query: 1507 RLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEE 1562
                  +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L E
Sbjct: 1182 ----SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVE 1232

Query: 1563 KSD------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTS 1597
            KS+      QS +  +                   +S+++ V+   QK S  +D+I  T+
Sbjct: 1233 KSEGVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTA 1292

Query: 1598 RRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS------- 1650
              I  +L+ +R  LKR  + +  EAKE+  ++R A+ EQIN LK+  +++  S       
Sbjct: 1293 SEIRAELDTTRGELKRGVLDMPAEAKETTTSMRKAVSEQINALKELAEIVNKSGRLVDVG 1352

Query: 1651 -------VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE-- 1689
                   V   AAS    + +        ++Q D        + P+ K      A K   
Sbjct: 1353 EGRADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRG 1412

Query: 1690 WFNKILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAF 1736
            W + +L+ ++              +  +S SH+       + S++SL  +I++ ID++A 
Sbjct: 1413 WVSDLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEAS 1465

Query: 1737 VQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIA 1796
            V+LW  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L + A
Sbjct: 1466 VELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDAA 1525

Query: 1797 QSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1526 RNDRDNMVTQTYLTSDTGKVYTMLAHASGR 1555



 Score =  179 bits (454), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 249/1126 (22%), Positives = 479/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S+ W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVAWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELS--- 280
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS   
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 281  --------LTSEEISVHLS----RAI-----------------------------DSFQS 299
                      S+++S  L     R I                             ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNSITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKS------ 413
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S      
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 414  -ITVTLNDVLQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
             I V + D L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  NIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLE 573
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ ++ 
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 574  EKRQRIDSDIGKKSEEL-------CSSFNSSYQKVSNVISDR----EKLFSN---SLARV 619
            E +  ++  + +++  +       C +F ++  +    + +R    + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGCDAFETALGEHVRAVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+     T   + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEATKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|17987244|ref|NP_539878.1| kinesin-like protein [Brucella melitensis bv. 1 str. 16M]
 gi|17982918|gb|AAL52142.1| kinesin-like protein [Brucella melitensis bv. 1 str. 16M]
          Length = 1326

 Score =  186 bits (471), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 606/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 67   ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 115

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 116  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 174

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 175  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 212

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 213  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 272

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 273  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 332

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 333  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 387

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 388  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 444

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 445  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 504

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 505  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 560

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 561  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 616

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 617  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 668

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 669  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 714

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 715  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 749

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 750  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 795

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 796  ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 822

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 823  LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 863

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 864  ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 915

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 916  --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 950

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 951  -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1004

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1005 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1064

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1065 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1124

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1125 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1184

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1185 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1237

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++
Sbjct: 1238 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARND 1297

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1298 RDNMVTQTYLTSDTGKVYTMLAHASGR 1324



 Score =  165 bits (417), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 231/1076 (21%), Positives = 452/1076 (42%), Gaps = 180/1076 (16%)

Query: 154  LFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDR 213
            +F+ F  ++ RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R
Sbjct: 1    MFWGFAQLVKRAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIER 60

Query: 214  AISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHE 273
             ++RA ELE  V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE
Sbjct: 61   TLARAVELETLVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHE 120

Query: 274  SLKEELSLTS--------------------------------------------EEISVH 289
             L+EELS  S                                             +I   
Sbjct: 121  QLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNR 180

Query: 290  LSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRI 349
            ++ + ++F +++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+
Sbjct: 181  ITTSGEAFANLLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRL 240

Query: 350  ESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSE 409
             +L NTL++ GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS 
Sbjct: 241  ANLENTLSDRGRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSG 300

Query: 410  KQKSITVTLNDV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNT 447
             + S+   ++D+       L S+  S               L E  D   + L+  T+  
Sbjct: 301  GRNSLGAMVDDIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERV 360

Query: 448  LREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQ 503
               +    +TL  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L 
Sbjct: 361  SSVIRGHADTLAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLD 419

Query: 504  GCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTN 563
              FAD   ++E+   S    I  N      L ++  +  + N ++    N E L  T   
Sbjct: 420  ASFADHARSLEERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDE 475

Query: 564  SINSLKDM-----------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLF 612
             I SL+ +           L+E+ + +   +G   +   ++     + V    S  + + 
Sbjct: 476  RIGSLQSLIAENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVL 535

Query: 613  SN---SLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKA 669
            +N   +LA V    E+TI      I  ++++ST +L   +      L +   SL N++  
Sbjct: 536  NNHNDALAHVLDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIAN 595

Query: 670  HA----------TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSN 704
             +          T ++ + T   E  L      V R  E S  ++            S+ 
Sbjct: 596  SSAAISSAFEGQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTL 655

Query: 705  NKLETIFQKHLHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAK 749
                    + L  F ++F                 ++D ++G L +    + D       
Sbjct: 656  AAEAAKAGEALDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEA 715

Query: 750  RMEELLHSGSANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKV 805
            R+ +     S  + S   + S ++  ++   ET     + A+  R  ++GS +      V
Sbjct: 716  RIADTAAKTSETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSV 775

Query: 806  LSSLKQAQELLCTTFAQR-------------------NDS---FVNALADNQSKFENNLV 843
             + + Q  +    T  +R                   ND+    V  LAD+       L 
Sbjct: 776  EARIAQVTDTTAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLE 835

Query: 844  NQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTL 903
              +H   D+L S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  
Sbjct: 836  EATHAATDRLRSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGE 891

Query: 904  VAKTFEECMSNILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG-------- 953
            + K  +    N+    D + + +D   S  ++ +   Q    S   ID  +G        
Sbjct: 892  LGKLIDAATRNL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDN 948

Query: 954  SASQF--IRDILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQ 1005
            + SQ   I D  DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +
Sbjct: 949  TLSQIADIADRFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEK 1008

Query: 1006 LLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            L+ +  + +++A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1009 LMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1064


>gi|254701774|ref|ZP_05163602.1| hypothetical protein Bsuib55_13081 [Brucella suis bv. 5 str. 513]
          Length = 1557

 Score =  186 bits (471), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 319/1443 (22%), Positives = 604/1443 (41%), Gaps = 291/1443 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLK-QAQELLCTTFAQRN--DSFVNALADN 834
            D        L E    L + L   +++V S ++  A  L   T   +N  D+  +AL + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAARTGDIQNAIDASASALNEV 623

Query: 835  QSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTE--------IQGNVGVT- 885
              K    LV ++  L   +SS++  L D +++   D A SL          I GN  +  
Sbjct: 624  TDKHAAILVERTSALQQAMSSNV-SLLDASFA---DHARSLEGRTASLHNVIAGNQAMLA 679

Query: 886  --LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAG 943
              ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + ++L  
Sbjct: 680  QLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAESLGA 739

Query: 944  SENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------VNSTL 985
              +  + A+G   + +R + +E +S ++++L+  N++                  + STL
Sbjct: 740  GRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEIRSTL 795

Query: 986  LRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLKEQEK 1034
              S     + LQ+      ++L+ + + L  A++            QT  +E   +  EK
Sbjct: 796  TDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTETMEK 851

Query: 1035 SLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCR 1094
            +LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD          
Sbjct: 852  ALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG--------- 899

Query: 1095 EFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIV 1153
              FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    +   I 
Sbjct: 900  --FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIEARIA 949

Query: 1154 DISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEV 1213
            D + K   TS  L    E F +   S +DN++                     E R+ E 
Sbjct: 950  DTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETRLVER 984

Query: 1214 KDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDN 1273
             D ++     L   GS +  +             ++E+   +  D+  ++ +ER+  L+ 
Sbjct: 985  ADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTRELNA 1030

Query: 1274 ILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDS 1333
            +L+ RS EI+                    +I N                E +  R+ DS
Sbjct: 1031 VLAARSQEIT--------------------KILN-------------DTAEPLVQRLADS 1057

Query: 1334 SQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRV 1393
             + +   + +AT          H  T+R+      +   LA  S+  E           +
Sbjct: 1058 GRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET----------I 1095

Query: 1394 SLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS---- 1449
            + +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++    
Sbjct: 1096 AAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTTSFVE 1150

Query: 1450 ----EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRD 1504
                 AQ F  S  L+D    V     LSD  +  + D I   F +    LS+    + D
Sbjct: 1151 NTNRAAQMFQASTGLIDSN--VGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS----ASD 1203

Query: 1505 TVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKS 1564
             +    + L     +  + +D     L EKS  +   M+    S    + + F   E ++
Sbjct: 1204 MINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRAEGQT 1259

Query: 1565 DQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKE 1624
              S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  EAKE
Sbjct: 1260 RVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPAEAKE 1319

Query: 1625 SADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE---- 1666
            +   +R A+ EQIN LK+  +++  S              V   AAS    + +      
Sbjct: 1320 TTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPVRAPI 1379

Query: 1667 YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH-------------SKG 1703
              ++Q D        + P+ K      A K   W + +L+ ++              +  
Sbjct: 1380 APLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQPAATP 1439

Query: 1704 KSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKV 1763
            +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+KGQ+ 
Sbjct: 1440 RSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLKGQQT 1492

Query: 1764 FLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHA 1823
            F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTML HA
Sbjct: 1493 FDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTMLAHA 1552

Query: 1824 SGR 1826
            SGR
Sbjct: 1553 SGR 1555



 Score =  176 bits (445), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 471/1126 (41%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILVERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E    S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EGRTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNVGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|261752327|ref|ZP_05996036.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261742080|gb|EEY30006.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 1582

 Score =  185 bits (470), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 319/1443 (22%), Positives = 604/1443 (41%), Gaps = 291/1443 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLK-QAQELLCTTFAQRN--DSFVNALADN 834
            D        L E    L + L   +++V S ++  A  L   T   +N  D+  +AL + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAARTGDIQNAIDASASALNEV 648

Query: 835  QSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTE--------IQGN---VG 883
              K    LV ++  L   +SS++  L D +++   D A SL          I GN   + 
Sbjct: 649  TDKHAAILVERTSALQQAMSSNV-SLLDASFA---DHARSLEGRTASLHNVIAGNQAMLA 704

Query: 884  VTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAG 943
              ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + ++L  
Sbjct: 705  QLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAESLGA 764

Query: 944  SENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------VNSTL 985
              +  + A+G   + +R + +E +S ++++L+  N++                  + STL
Sbjct: 765  GRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEIRSTL 820

Query: 986  LRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLKEQEK 1034
              S     + LQ+      ++L+ + + L  A++            QT  +E   +  EK
Sbjct: 821  TDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTETMEK 876

Query: 1035 SLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCR 1094
            +LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD          
Sbjct: 877  ALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG--------- 924

Query: 1095 EFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIV 1153
              FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    +   I 
Sbjct: 925  --FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIEARIA 974

Query: 1154 DISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEV 1213
            D + K   TS  L    E F +   S +DN++                     E R+ E 
Sbjct: 975  DTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETRLVER 1009

Query: 1214 KDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDN 1273
             D ++     L   GS +  +             ++E+   +  D+  ++ +ER+  L+ 
Sbjct: 1010 ADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTRELNA 1055

Query: 1274 ILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDS 1333
            +L+ RS EI+                    +I N                E +  R+ DS
Sbjct: 1056 VLAARSQEIT--------------------KILN-------------DTAEPLVQRLADS 1082

Query: 1334 SQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRV 1393
             + +   + +AT          H  T+R+      +   LA  S+  E           +
Sbjct: 1083 GRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET----------I 1120

Query: 1394 SLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS---- 1449
            + +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++    
Sbjct: 1121 AAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTTSFVE 1175

Query: 1450 ----EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRD 1504
                 AQ F  S  L+D    V     LSD  +  + D I   F +    LS+    + D
Sbjct: 1176 NTNRAAQMFQASTGLIDSN--VGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS----ASD 1228

Query: 1505 TVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKS 1564
             +    + L     +  + +D     L EKS  +   M+    S    + + F   E ++
Sbjct: 1229 MINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRAEGQT 1284

Query: 1565 DQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKE 1624
              S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  EAKE
Sbjct: 1285 RVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPAEAKE 1344

Query: 1625 SADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE---- 1666
            +   +R A+ EQIN LK+  +++  S              V   AAS    + +      
Sbjct: 1345 TTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPVRAPI 1404

Query: 1667 YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH-------------SKG 1703
              ++Q D        + P+ K      A K   W + +L+ ++              +  
Sbjct: 1405 APLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQPAATP 1464

Query: 1704 KSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKV 1763
            +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+KGQ+ 
Sbjct: 1465 RSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLKGQQT 1517

Query: 1764 FLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHA 1823
            F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTML HA
Sbjct: 1518 FDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTMLAHA 1577

Query: 1824 SGR 1826
            SGR
Sbjct: 1578 SGR 1580



 Score =  176 bits (445), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 471/1126 (41%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILVERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E    S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EGRTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNVGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|153009441|ref|YP_001370656.1| hypothetical protein Oant_2111 [Ochrobactrum anthropi ATCC 49188]
 gi|151561329|gb|ABS14827.1| conserved hypothetical protein [Ochrobactrum anthropi ATCC 49188]
          Length = 1587

 Score =  185 bits (470), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 310/1458 (21%), Positives = 614/1458 (42%), Gaps = 263/1458 (18%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 270  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 318

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L+  L+++ N ++D +    Q++ + +G+  E L  S N S   ++  I    
Sbjct: 319  SGAH-EQLKEELSSASNIIRDNVLSASQQLSTLLGESGERLIGSINESGGAIAEAI---- 373

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                           ET  G   S + +   +  NL D  +   A L E  ++    L  
Sbjct: 374  ---------------ETRTGDIGSRITTSGEAFANLLDTRI---ATLDEQSRTVSDRLTE 415

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + +  A   +V+ FD    N+  + +     L + F+   H+        
Sbjct: 416  ALDERTTGIANLLGGATQSMVSEFDTRLANLESTLSERGRSLLSEFEARAHALDSSTEKL 475

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSID 778
            N     +S  ++  L   T+ I + FS+    +  ++      I  +L++I         
Sbjct: 476  NAALETRSRQINENLIARTREIAETFSSGRTSLSTMIDETKTKIGEDLTSIG-------- 527

Query: 779  DVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCT-------TFAQRNDSFVNAL 831
              E++   L E+       L    D + +SL+   E + +       T A R     NA+
Sbjct: 528  --ESVGNILGEKADAFAGKLAESRDVLAASLEGETERVSSVIRGHADTLAARTSDIENAV 585

Query: 832  ADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDV-----ANSLTE--------I 878
              N S    N V  SH  + +  ++  + T  ++S  +D      A SL E        I
Sbjct: 586  --NVSASALNTVADSHAAILEERTNALRETIASHSALLDASFADHARSLEERATTLHGVI 643

Query: 879  QGNVGVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHID 935
             GN  +    ++  + AM +  + +  ++A+TF+E ++++     +N+ TL + L +   
Sbjct: 644  AGNQAMLAQLMDERAAAMRDNFNENREVLARTFDERVNSLQALITDNQNTLARILDERAS 703

Query: 936  VLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRL 995
             +  ++    +    A+G   + +R + +E +S + ++L+  NN++ S +L  H+   R 
Sbjct: 704  SMTDSIGAGRDAFVAALG---EHVRQV-EERTSGLHNVLNDHNNAL-SGILDGHE---RT 755

Query: 996  LQEKSDELIQLLDNKASCLSTAVS-------TQTINLENNLKEQEKSLSRVVDTSASSFK 1048
            ++ ++ E+   L    + LS  +         +T NL N + +   ++SR  +       
Sbjct: 756  IETRAAEIRSTLSESTTSLSQTLQDHSDILEQRTTNLHNAIADSSSTISRAFE---GQTG 812

Query: 1049 YLSDSIQTLAQELVSVIG------SMSQSTTDISGKLE-------ISLDSVNQKIQKCRE 1095
             + +  QT+ + L   IG      ++ QS   ++G L         +L +   K  +  +
Sbjct: 813  IIEERTQTMEKALT--IGVDNVRRALEQSAGIVAGTLREKIGEAASTLSAEAAKAGEALD 870

Query: 1096 FFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEI-- 1152
             FG+   A  +D +S     +E R+  R            D I  ++ +  SR+ GE+  
Sbjct: 871  GFGEAFSARLIDNLSG----TEARLGDRA-----------DAIAGRLGEIESRLTGELGS 915

Query: 1153 --VDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRI 1210
                I+N    TS  L    E F +   S +DN++           +  NE  S I   +
Sbjct: 916  IEARIANTASRTSETLAGHSEAFAA---SVADNLA--------GTETRLNERASAIASGL 964

Query: 1211 HEVK----DVLSNLDRALESYGSTVFKQFKEYVQCFET----NMENMESLFDKNNDSMLL 1262
              ++      LS+++  +    S   +    + + F      N+   E+   +  D++  
Sbjct: 965  EAIESRLTGELSSIEARIADTASKTSETLAGHSESFSASVADNLAGTETRLAERADAI-- 1022

Query: 1263 SFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISD 1322
                 +  L +I S+ +ME+     G+       +  V D          ++L A+L + 
Sbjct: 1023 -----ATRLGDIGSRITMEL-----GSVEAR---IAQVTDTTAVTLEERTRELNAVLAAR 1069

Query: 1323 VEKITNRITDSSQDVTTIISDATDSL-NKVDERLHQTTNRITETTGHIDTVLAESSKLFE 1381
             ++IT  + D+++ +   ++D+   L  +++E  H  T+R+      +   LA  S+  E
Sbjct: 1070 SQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRSENAALVNALA--SRTAE 1127

Query: 1382 KKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLT 1441
                       ++ +Q ++  +    N   LI   D L  +  E    +D    NL D+ 
Sbjct: 1128 T----------IAAVQQAK--TGLSDNVSELI---DRLAASNGELGKLIDTATRNLTDID 1172

Query: 1442 SRLVSKSS--------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKID 1492
             RLV  +S         AQ F  S  L+D      +A  +SD+ +  + D I   F +  
Sbjct: 1173 GRLVDTTSSFVENTNRAAQMFQASTGLIDGNIGTLRA--ISDSTLSQIAD-IADRFEEHG 1229

Query: 1493 GTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN 1552
              LS+    + D +    + L        + +D     L EKS  +     +K+  +   
Sbjct: 1230 KVLSS----ASDMINTAQNGLVSTLEDRHQALDKLASGLVEKSEGV-----EKLMQSFEG 1280

Query: 1553 -IENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDIL 1611
             + + F   E ++  S +   +S++  V+   QK S  +DDI  T+  I  +LN +R  L
Sbjct: 1281 LVTSAFQRAEGQTRSSAEKMRESVSEIVEQAAQKFSAATDDIRRTASEIRNELNTTRGEL 1340

Query: 1612 KRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQ 1671
            KR  + +  EAKE+   +R A+ EQIN LK+  +++           NK     +   S+
Sbjct: 1341 KRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIV-----------NKSGRLVDVGESR 1389

Query: 1672 VDKRPSGKK--------------TKNNHAIKE----------------------WFNKIL 1695
             D RP  +                + + AI++                      W + +L
Sbjct: 1390 AD-RPVSRPAPAAARPAPVQAPVVQADVAIRQRAYEAPKAQPAPAAAQAEKPRGWVSDLL 1448

Query: 1696 SSSTHSKGKSSSHIDISDKDSLSSIDSLVENI-------SKFIDYDAFVQLWKSYTLGED 1748
            + ++  + + ++   +    +  S   +VE++       ++ ID++A V+LW  Y  GE 
Sbjct: 1449 ARASREE-EEAAQPKVQPVATPRSPSHVVESLNSLSVDIARAIDHEASVELWDRYRRGER 1507

Query: 1749 DIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEH 1808
            ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + + +
Sbjct: 1508 NVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTRTY 1567

Query: 1809 IMSNYGKVYTMLVHASGR 1826
            + S+ GKVYTML HASGR
Sbjct: 1568 LTSDTGKVYTMLAHASGR 1585



 Score =  178 bits (451), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 238/1138 (20%), Positives = 458/1138 (40%), Gaps = 201/1138 (17%)

Query: 108  SLIWLACELGF--LIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRA 165
            S++W A  +     I     S + +  DF   P  + +   V++ P+ +F+ F  ++ RA
Sbjct: 157  SVLWAAGGVALSKAINPDVFSTLQATKDFFTSPAGLGVVAGVAL-PVAMFWGFAQLVKRA 215

Query: 166  RDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTV 225
            ++MH A++S++  A+RL+ PE  S +++ ++  AVR+E+  M E I+R ++RA ELE  V
Sbjct: 216  QEMHTAARSMSEAAMRLLQPEAVSGDRVSTLGQAVRREVAAMNEGIERTLARAVELETLV 275

Query: 226  RSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS-- 283
            +SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE LKEELS  S  
Sbjct: 276  QSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLKEELSSASNI 335

Query: 284  ------------------------------------------EEISVHLSRAIDSFQSIV 301
                                                       +I   ++ + ++F +++
Sbjct: 336  IRDNVLSASQQLSTLLGESGERLIGSINESGGAIAEAIETRTGDIGSRITTSGEAFANLL 395

Query: 302  DVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGR 361
            D RIA + E++  +     + +  +   +  +L   +  +  +FD R+ +L +TL+  GR
Sbjct: 396  DTRIATLDEQSRTVSDRLTEALDERTTGIANLLGGATQSMVSEFDTRLANLESTLSERGR 455

Query: 362  SLANQVGNYTLMLGNNTDKVSIALKEQSQQ-----------FMQAFTSHICEMSNFFSEK 410
            SL ++       L ++T+K++ AL+ +S+Q             + F+S    +S    E 
Sbjct: 456  SLLSEFEARAHALDSSTEKLNAALETRSRQINENLIARTREIAETFSSGRTSLSTMIDET 515

Query: 411  QKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDN----------------- 453
            +  I   L  + +S+   L EK D+F   L  + D     ++                  
Sbjct: 516  KTKIGEDLTSIGESVGNILGEKADAFAGKLAESRDVLAASLEGETERVSSVIRGHADTLA 575

Query: 454  -RTNTLENRI--------------TAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGN 498
             RT+ +EN +               A L+E       +I   S+    + ++   +L+  
Sbjct: 576  ARTSDIENAVNVSASALNTVADSHAAILEERTNALRETIASHSALLDASFADHARSLEER 635

Query: 499  IDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLE 558
               L G  A +   +  L           +D++     D  ++ +  +++        L+
Sbjct: 636  ATTLHGVIAGNQAMLAQL-----------MDERAAAMRDNFNENREVLARTFDERVNSLQ 684

Query: 559  NTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVS-------NVISDREKL 611
              +T++ N+L  +L+E+   +   IG   +   ++     ++V        NV++D    
Sbjct: 685  ALITDNQNTLARILDERASSMTDSIGAGRDAFVAALGEHVRQVEERTSGLHNVLND---- 740

Query: 612  FSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA 671
             +N+L+ +    E TI      I  +                  LSES  SL  +L+ H+
Sbjct: 741  HNNALSGILDGHERTIETRAAEIRST------------------LSESTTSLSQTLQDHS 782

Query: 672  TDVVHKITNAENQL------VNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNK 725
              +  + TN  N +      ++R  E    II     +  K  TI    + +        
Sbjct: 783  DILEQRTTNLHNAIADSSSTISRAFEGQTGIIEERTQTMEKALTI---GVDNVRRALEQS 839

Query: 726  SDHVSGILKNSTQHIDDLFSNNAKRMEELL----HSGSANIESELSAISKAMNKSIDDVE 781
            +  V+G L+          S  A +  E L     + SA +   LS     +    D   
Sbjct: 840  AGIVAGTLREKIGEAASTLSAEAAKAGEALDGFGEAFSARLIDNLSGTEARLGDRAD--- 896

Query: 782  TISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENN 841
                A+  R  E+ S L      + + +         T A  +++F  ++ADN +  E  
Sbjct: 897  ----AIAGRLGEIESRLTGELGSIEARIANTASRTSETLAGHSEAFAASVADNLAGTETR 952

Query: 842  LVNQSHLLLDKLSSDIQKLTDIAYS---KAIDVANSLTEIQGNVGVTLENHSQAMLEKIS 898
            L  ++  +   L +   +LT    S   +  D A+  +E       TL  HS    E  S
Sbjct: 953  LNERASAIASGLEAIESRLTGELSSIEARIADTASKTSE-------TLAGHS----ESFS 1001

Query: 899  ASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQF 958
            A                  S  +N    + +L++  D +   L    ++I   +GS    
Sbjct: 1002 A------------------SVADNLAGTETRLAERADAIATRLGDIGSRITMELGSVEAR 1043

Query: 959  IRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAV 1018
            I  + D  +  +E         +N+ L    Q+  ++L + ++ L+Q L +    L+  +
Sbjct: 1044 IAQVTDTTAVTLEE----RTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQL 1099

Query: 1019 STQTINLENNLKEQEKSL-----SRVVDTSAS---SFKYLSDSIQTLA-------QELVS 1063
               T    + L+ +  +L     SR  +T A+   +   LSD++  L         EL  
Sbjct: 1100 EEATHAATDRLRSENAALVNALASRTAETIAAVQQAKTGLSDNVSELIDRLAASNGELGK 1159

Query: 1064 VIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQ 1121
            +I + +++ TDI G+L  +  S  +   +  + F  +       I  +  IS+  +SQ
Sbjct: 1160 LIDTATRNLTDIDGRLVDTTSSFVENTNRAAQMFQASTGLIDGNIGTLRAISDSTLSQ 1217


>gi|254693737|ref|ZP_05155565.1| hypothetical protein Babob3T_03564 [Brucella abortus bv. 3 str.
            Tulya]
          Length = 1557

 Score =  184 bits (467), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 606/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLACTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1027 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1053

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1054 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1094

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1095 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1147 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1181

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1182 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1235

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1236 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1296 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1355

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1356 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1415

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1416 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1468

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++
Sbjct: 1469 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARND 1528

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1529 RDNMVTQTYLTSDTGKVYTMLAHASGR 1555



 Score =  174 bits (441), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 471/1126 (41%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +      +PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGVGVV-AGVALPIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M DA++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQDAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLACTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|261214011|ref|ZP_05928292.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915618|gb|EEX82479.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
          Length = 1582

 Score =  184 bits (466), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 317/1467 (21%), Positives = 606/1467 (41%), Gaps = 339/1467 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGN- 881
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 882  --VGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
              +   ++  + AM E  + +  ++A TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AMLAQLMDERAAAMRENFNENREVLACTFDERIGSLQSLIAENQSALERILDERARNMAE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1052 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1078

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1079 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1119

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1120 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1450 EAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLI 1509
                                 F+ +T         Q+S   ID  L  + T S +T+   
Sbjct: 1172 --------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLSDNTL--- 1206

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFSTLEEKSD 1565
               +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S L EKS+
Sbjct: 1207 -SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLASGLVEKSE 1260

Query: 1566 ------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDIALTSRRI 1600
                  QS +  +                   +S+++ V+   QK S  +D+I  T+  I
Sbjct: 1261 GVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320

Query: 1601 AEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS---------- 1650
              +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S          
Sbjct: 1321 RAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGR 1380

Query: 1651 ----VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAIKE--WFN 1692
                V   AAS    + +        ++Q D        + P+ K      A K   W +
Sbjct: 1381 ADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVS 1440

Query: 1693 KILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQL 1739
             +L+ ++              +  +S SH+       + S++SL  +I++ ID++A V+L
Sbjct: 1441 DLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAIDHEASVEL 1493

Query: 1740 WKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSN 1799
            W  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+++F+ +L ++A+++
Sbjct: 1494 WDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMNDFQRLLEDVARND 1553

Query: 1800 DDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1554 RDNMVTQTYLTSDTGKVYTMLAHASGR 1580



 Score =  173 bits (439), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 244/1126 (21%), Positives = 471/1126 (41%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +      +PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGVGVV-AGVALPIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M DA++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQDAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILTERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLACTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|256159742|ref|ZP_05457489.1| hypothetical protein BcetM4_12253 [Brucella ceti M490/95/1]
 gi|256255004|ref|ZP_05460540.1| hypothetical protein BcetB_12055 [Brucella ceti B1/94]
          Length = 1561

 Score =  184 bits (466), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 315/1447 (21%), Positives = 603/1447 (41%), Gaps = 299/1447 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 302  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 350

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 351  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 409

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 410  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 447

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 448  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 507

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 508  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 567

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 568  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 622

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 623  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 679

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+ F+E + ++     EN+  L++ L +    + +
Sbjct: 680  AMLAQLMDERAAAMRENFNENREVLARNFDERIGSLQSLIAENQSALERILDERARNMAE 739

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 740  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 795

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 796  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 851

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 852  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 903

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 904  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 949

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 950  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 984

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 985  LVERADTIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1030

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1031 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1057

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1058 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1098

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1099 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1150

Query: 1450 --------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
                     AQ F  S  L+D    +     LSD  +  + D I   F +    LS+   
Sbjct: 1151 SFVENTNRAAQMFQASTGLIDSN--LGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS--- 1204

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
             + D +    + L    ++  + +D     L EKS  +   M+    S    + + F   
Sbjct: 1205 -ASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRA 1259

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  
Sbjct: 1260 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGILDMPA 1319

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE 1666
            EAKE+   +R A+ EQIN LK+  +++  S              V   AAS    + +  
Sbjct: 1320 EAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV 1379

Query: 1667 ----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH------------ 1700
                  ++Q D        + P+ K      A K   W + +L+ ++             
Sbjct: 1380 RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQP 1439

Query: 1701 -SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIK 1759
             +  +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+K
Sbjct: 1440 AATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLK 1492

Query: 1760 GQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTM 1819
            GQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTM
Sbjct: 1493 GQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTM 1552

Query: 1820 LVHASGR 1826
            L HASGR
Sbjct: 1553 LAHASGR 1559



 Score =  169 bits (428), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 244/1120 (21%), Positives = 482/1120 (43%), Gaps = 175/1120 (15%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 189  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 245

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 246  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 305

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 306  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 365

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 366  NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 425

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 426  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 485

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 486  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 545

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 546  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 605

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 606  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 664

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNIS---QITSMN-TER---LENTLTNSIN 566
            E+   S    I  N      L ++  +  + N +   ++ + N  ER   L++ +  + +
Sbjct: 665  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVLARNFDERIGSLQSLIAENQS 724

Query: 567  SLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARVQSHF 623
            +L+ +L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V    
Sbjct: 725  ALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHVLDGH 784

Query: 624  EETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA----------TD 673
            E+TI      I  ++++ST +L   +      L +   SL N++   +          T 
Sbjct: 785  EQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFEGQTG 844

Query: 674  VVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKHLHSF 718
            ++ + T   E  L      V R  E S  ++            S+         + L  F
Sbjct: 845  IIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDGF 904

Query: 719  NDTF---------------NNKSDHVSGILKNSTQHIDD-------LFSNNAKRMEELLH 756
             ++F                 ++D ++G L +    + D         ++ A +  E L 
Sbjct: 905  GESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTSETLA 964

Query: 757  SGSANIESELSA-ISKAMNKSIDDVETISTALKE----RCQELGS---DLVNHSDKVLSS 808
            S S +  + ++  ++    + ++  +TI+T L +       ELGS    +   +D    +
Sbjct: 965  SHSESFSASVADNLAGTETRLVERADTIATRLGDIGSRITMELGSVEARIAQVTDTTAVT 1024

Query: 809  LKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKA 868
            L++    L    A R+      L D        L +    L  +L       TD   S+ 
Sbjct: 1025 LEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRSEN 1084

Query: 869  IDVANSLTEI---------QGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSY 919
              + N+L            Q  VG++ +N S+ ++++++ASN  + K  +    N+    
Sbjct: 1085 AALVNALASRTAETIAAVQQAKVGLS-DNVSE-LIDRLAASNGELGKLIDAATRNL---A 1139

Query: 920  DENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRDILDENS 967
            D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D  DE+ 
Sbjct: 1140 DIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADRFDEHG 1199

Query: 968  SRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLSTAVSTQ 1021
              + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + +++A    
Sbjct: 1200 KVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVASAFQRA 1259

Query: 1022 TINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
                  + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1260 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1299


>gi|261222192|ref|ZP_05936473.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|265998156|ref|ZP_06110713.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|260920776|gb|EEX87429.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|262552624|gb|EEZ08614.1| conserved hypothetical protein [Brucella ceti M490/95/1]
          Length = 1586

 Score =  183 bits (465), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 315/1447 (21%), Positives = 603/1447 (41%), Gaps = 299/1447 (20%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 327  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 375

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 376  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 434

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 435  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 472

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 473  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 532

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 533  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 592

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++        T A R     NA+ D  + 
Sbjct: 593  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGH----ADTLAARTGDIQNAI-DASAS 647

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 648  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 704

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+ F+E + ++     EN+  L++ L +    + +
Sbjct: 705  AMLAQLMDERAAAMRENFNENREVLARNFDERIGSLQSLIAENQSALERILDERARNMAE 764

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 765  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 820

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 821  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 876

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 877  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 928

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 929  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 974

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 975  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1009

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1010 LVERADTIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1055

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
             L+ +L+ RS EI+                    +I N                E +  R
Sbjct: 1056 ELNAVLAARSQEIT--------------------KILN-------------DTAEPLVQR 1082

Query: 1330 ITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGE 1389
            + DS + +   + +AT          H  T+R+      +   LA  S+  E        
Sbjct: 1083 LADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET------- 1123

Query: 1390 ISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
               ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  RLV  ++
Sbjct: 1124 ---IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1175

Query: 1450 --------EAQKFVMSI-LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
                     AQ F  S  L+D    +     LSD  +  + D I   F +    LS+   
Sbjct: 1176 SFVENTNRAAQMFQASTGLIDSN--LGTLRTLSDNTLSQIAD-IADRFDEHGKVLSS--- 1229

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTL 1560
             + D +    + L    ++  + +D     L EKS  +   M+    S    + + F   
Sbjct: 1230 -ASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQ----SFEALVASAFQRA 1284

Query: 1561 EEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAK 1620
            E ++  S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  
Sbjct: 1285 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGILDMPA 1344

Query: 1621 EAKESADTIRSAIEEQINTLKDFQKLITDS--------------VKNNAASYNKGLHSDE 1666
            EAKE+   +R A+ EQIN LK+  +++  S              V   AAS    + +  
Sbjct: 1345 EAKETTTAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVSRPAASRPAPVQAPV 1404

Query: 1667 ----YNISQVD--------KRPSGKKTKNNHAIKE--WFNKILSSSTH------------ 1700
                  ++Q D        + P+ K      A K   W + +L+ ++             
Sbjct: 1405 RAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAEKPRGWVSDLLARASREEEEAAQPKVQP 1464

Query: 1701 -SKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIK 1759
             +  +S SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+K
Sbjct: 1465 AATPRSPSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLK 1517

Query: 1760 GQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTM 1819
            GQ+ F +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTM
Sbjct: 1518 GQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTM 1577

Query: 1820 LVHASGR 1826
            L HASGR
Sbjct: 1578 LAHASGR 1584



 Score =  169 bits (427), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 244/1120 (21%), Positives = 482/1120 (43%), Gaps = 175/1120 (15%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 214  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 270

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 271  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 330

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 331  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 390

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 391  NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 450

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 451  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 510

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 511  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 570

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 571  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 630

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 631  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 689

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNIS---QITSMN-TER---LENTLTNSIN 566
            E+   S    I  N      L ++  +  + N +   ++ + N  ER   L++ +  + +
Sbjct: 690  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVLARNFDERIGSLQSLIAENQS 749

Query: 567  SLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARVQSHF 623
            +L+ +L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V    
Sbjct: 750  ALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHVLDGH 809

Query: 624  EETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA----------TD 673
            E+TI      I  ++++ST +L   +      L +   SL N++   +          T 
Sbjct: 810  EQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFEGQTG 869

Query: 674  VVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKHLHSF 718
            ++ + T   E  L      V R  E S  ++            S+         + L  F
Sbjct: 870  IIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDGF 929

Query: 719  NDTF---------------NNKSDHVSGILKNSTQHIDD-------LFSNNAKRMEELLH 756
             ++F                 ++D ++G L +    + D         ++ A +  E L 
Sbjct: 930  GESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTSETLA 989

Query: 757  SGSANIESELSA-ISKAMNKSIDDVETISTALKE----RCQELGS---DLVNHSDKVLSS 808
            S S +  + ++  ++    + ++  +TI+T L +       ELGS    +   +D    +
Sbjct: 990  SHSESFSASVADNLAGTETRLVERADTIATRLGDIGSRITMELGSVEARIAQVTDTTAVT 1049

Query: 809  LKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKA 868
            L++    L    A R+      L D        L +    L  +L       TD   S+ 
Sbjct: 1050 LEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRSEN 1109

Query: 869  IDVANSLTEI---------QGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSY 919
              + N+L            Q  VG++ +N S+ ++++++ASN  + K  +    N+    
Sbjct: 1110 AALVNALASRTAETIAAVQQAKVGLS-DNVSE-LIDRLAASNGELGKLIDAATRNL---A 1164

Query: 920  DENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRDILDENS 967
            D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D  DE+ 
Sbjct: 1165 DIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADRFDEHG 1224

Query: 968  SRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLSTAVSTQ 1021
              + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + +++A    
Sbjct: 1225 KVLSSASDMINSAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVASAFQRA 1284

Query: 1022 TINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
                  + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1285 EGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1324


>gi|256061115|ref|ZP_05451269.1| hypothetical protein Bneo5_12217 [Brucella neotomae 5K33]
          Length = 1557

 Score =  182 bits (461), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 307/1474 (20%), Positives = 602/1474 (40%), Gaps = 353/1474 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNCITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNK 725
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANMENTLSDRGRSLLAEFEARAHA-------- 495

Query: 726  SDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVET-IS 784
                   L NST+ ++      ++++ E L + +  I    S    ++   +DD++  I 
Sbjct: 496  -------LDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIG 548

Query: 785  TALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTF---AQRNDSFVNALADNQSKFENN 841
              L    + +G+ L++ +      L ++++LL  T     +R  S +   AD  +    +
Sbjct: 549  DDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAARTGD 608

Query: 842  LVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTE-IQGNVGV---TLENHSQAMLEK- 896
            + N     +D  +S + ++TD   +   +  ++L + +  NV +   +  +H++++ E+ 
Sbjct: 609  IQNA----IDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSLEERT 664

Query: 897  ------ISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDG 950
                  I+ +  ++A+  +E  + +  +++ENR+ L +   + I  L+  +A  EN+   
Sbjct: 665  ASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIA--ENQ--- 719

Query: 951  AIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNK 1010
                    +  ILDE +  +   L    ++  + L     +  R ++E++  L  +L+N 
Sbjct: 720  ------SVLERILDERARNMAESLGAGRDAFETAL----GEHVRTVEERTSGLQAVLNNH 769

Query: 1011 ASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSV------ 1064
               L+  +      +E    E   +L+   D++AS  + L D  + L Q   S+      
Sbjct: 770  NDALAHVLDGHEQTIETRAAEIRSTLT---DSTASLSQTLQDHGEILEQRTTSLQNAIAN 826

Query: 1065 ------------IGSMSQSTTDISGKLEISLDSVNQKIQ--------KCRE--------- 1095
                         G + + T  +   L I +D+V + ++        K RE         
Sbjct: 827  SSAAISSAFEGQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTL 886

Query: 1096 ------------FFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQII 1142
                         FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ 
Sbjct: 887  AAEAAKAGEALDGFGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLT 938

Query: 1143 DSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNES 1202
            D    +   I D + K   TS  L    E F +   S +DN++                 
Sbjct: 939  DELGTIEARIADTAAK---TSETLASHSESFSA---SVADNLAGT--------------- 977

Query: 1203 RSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLL 1262
                E R+ E  D ++     L   GS +  +             ++E+   +  D+  +
Sbjct: 978  ----ETRLVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAV 1019

Query: 1263 SFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISD 1322
            + +ER+  L+ +L+ RS EI+                    +I N               
Sbjct: 1020 TLEERTRELNAVLAARSQEIT--------------------KILN-------------DT 1046

Query: 1323 VEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEK 1382
             E +  R+ DS + +   + +AT          H  T+R+      +   LA  S+  E 
Sbjct: 1047 AEPLVQRLADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET 1094

Query: 1383 KIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTS 1442
                      ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  
Sbjct: 1095 ----------IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDG 1139

Query: 1443 RLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRS 1502
            RLV  ++                     F+ +T         Q+S   ID  L  + T S
Sbjct: 1140 RLVDSTT--------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLS 1177

Query: 1503 RDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFS 1558
             +T+      +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S
Sbjct: 1178 DNTL----SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLAS 1228

Query: 1559 TLEEKSD------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDI 1593
             L EKS+      QS +  +                   +S+++ V+   QK S  +D+I
Sbjct: 1229 GLVEKSEGVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEI 1288

Query: 1594 ALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS--- 1650
              T+  I  +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S   
Sbjct: 1289 RRTASEIRAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRL 1348

Query: 1651 -----------VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAI 1687
                       V   AAS    + +        ++Q D        + P+ K      A 
Sbjct: 1349 VDVGEGRADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAE 1408

Query: 1688 KE--WFNKILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFID 1732
            K   W + +L+ ++              +  +S SH+       + S++SL  +I++ ID
Sbjct: 1409 KPRGWVSDLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAID 1461

Query: 1733 YDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEML 1792
            ++A V+LW  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L
Sbjct: 1462 HEASVELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLL 1521

Query: 1793 SEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             ++A+++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1522 EDVARNDRDNMVTQTYLTSDTGKVYTMLAHASGR 1555



 Score =  176 bits (446), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 246/1126 (21%), Positives = 475/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELS--- 280
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS   
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 281  --------LTSEEISVHLS----RAI-----------------------------DSFQS 299
                      S+++S  L     R I                             ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNCITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ ++ NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANMENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSVLERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1190 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|261325116|ref|ZP_05964313.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301096|gb|EEY04593.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 1582

 Score =  181 bits (460), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 309/1474 (20%), Positives = 602/1474 (40%), Gaps = 353/1474 (23%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNCITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNK 725
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANMENTLSDRGRSLLAEFEARAHA-------- 520

Query: 726  SDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVET-IS 784
                   L NST+ ++      ++++ E L + +  I    S    ++   +DD++  I 
Sbjct: 521  -------LDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIG 573

Query: 785  TALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTF---AQRNDSFVNALADNQSKFENN 841
              L    + +G+ L++ +      L ++++LL  T     +R  S +   AD  +    +
Sbjct: 574  DDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAARTGD 633

Query: 842  LVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTE-IQGNVGV---TLENHSQAMLEK- 896
            + N     +D  +S + ++TD   +   +  ++L + +  NV +   +  +H++++ E+ 
Sbjct: 634  IQNA----IDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSLEERT 689

Query: 897  ------ISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDG 950
                  I+ +  ++A+  +E  + +  +++ENR+ L +   + I  L+  +A  EN+   
Sbjct: 690  ASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIA--ENQ--- 744

Query: 951  AIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNK 1010
                    +  ILDE +  +   L    ++   T L  H    R ++E++  L  +L+N 
Sbjct: 745  ------SVLERILDERARNMAESLGAGRDAFE-TALGEHV---RTVEERTSGLQAVLNNH 794

Query: 1011 ASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSV------ 1064
               L+  +      +E    E   +L+   D++AS  + L D  + L Q   S+      
Sbjct: 795  NDALAHVLDGHEQTIETRAAEIRSTLT---DSTASLSQTLQDHGEILEQRTTSLQNAIAN 851

Query: 1065 ------------IGSMSQSTTDISGKLEISLDSVNQKIQ--------KCRE--------- 1095
                         G + + T  +   L I +D+V + ++        K RE         
Sbjct: 852  SSAAISSAFEGQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTL 911

Query: 1096 ------------FFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQII 1142
                         FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ 
Sbjct: 912  AAEAAKAGEALDGFGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLT 963

Query: 1143 DSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNES 1202
            D    +   I D + K   TS  L    E F +   S +DN++                 
Sbjct: 964  DELGTIEARIADTAAK---TSETLASHSESFSA---SVADNLAGT--------------- 1002

Query: 1203 RSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLL 1262
                E R+ E  D ++     L   GS +  +             ++E+   +  D+  +
Sbjct: 1003 ----ETRLVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAV 1044

Query: 1263 SFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISD 1322
            + +ER+  L+ +L+ RS EI+                    +I N               
Sbjct: 1045 TLEERTRELNAVLAARSQEIT--------------------KILN-------------DT 1071

Query: 1323 VEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEK 1382
             E +  R+ DS + +   + +AT          H  T+R+      +   LA  S+  E 
Sbjct: 1072 AEPLVQRLADSGRGLAQQLEEAT----------HAATDRLRSENAALVNALA--SRTAET 1119

Query: 1383 KIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTS 1442
                      ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+  
Sbjct: 1120 ----------IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADIDG 1164

Query: 1443 RLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRS 1502
            RLV  ++                     F+ +T         Q+S   ID  L  + T S
Sbjct: 1165 RLVDSTT--------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRTLS 1202

Query: 1503 RDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENIFS 1558
             +T+      +ADI ++     D +   L   S D+ N  +  + ST+      ++ + S
Sbjct: 1203 DNTL----SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKLAS 1253

Query: 1559 TLEEKSD------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSDDI 1593
             L EKS+      QS +  +                   +S+++ V+   QK S  +D+I
Sbjct: 1254 GLVEKSEGVEKLMQSFEALVASAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEI 1313

Query: 1594 ALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS--- 1650
              T+  I  +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S   
Sbjct: 1314 RRTASEIRAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSGRL 1373

Query: 1651 -----------VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNHAI 1687
                       V   AAS    + +        ++Q D        + P+ K      A 
Sbjct: 1374 VDVGEGRADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAASAE 1433

Query: 1688 KE--WFNKILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKFID 1732
            K   W + +L+ ++              +  +S SH+       + S++SL  +I++ ID
Sbjct: 1434 KPRGWVSDLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARAID 1486

Query: 1733 YDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEML 1792
            ++A V+LW  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ +L
Sbjct: 1487 HEASVELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQRLL 1546

Query: 1793 SEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             ++A+++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1547 EDVARNDRDNMVTQTYLTSDTGKVYTMLAHASGR 1580



 Score =  176 bits (445), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 246/1126 (21%), Positives = 475/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELS--- 280
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS   
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 281  --------LTSEEISVHLS----RAI-----------------------------DSFQS 299
                      S+++S  L     R I                             ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNCITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ ++ NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANMENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSVLERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|114707090|ref|ZP_01439989.1| hypothetical protein FP2506_03524 [Fulvimarina pelagi HTCC2506]
 gi|114537640|gb|EAU40765.1| hypothetical protein FP2506_03524 [Fulvimarina pelagi HTCC2506]
          Length = 2839

 Score =  181 bits (460), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 368/1818 (20%), Positives = 745/1818 (40%), Gaps = 297/1818 (16%)

Query: 57   TLSKNFKQASNKQTYSGFYPANDLDNGGITHILQN--IGKNSLNIALRNAFMSSLIWLAC 114
            T +    +A  +++Y G   AND +    T ++ +  + ++S  + L  A + +++WLA 
Sbjct: 112  TPTGGASEAKAERSY-GQKAANDEER--RTAVMADALLSRSSSALPLWLAGLFAILWLAG 168

Query: 115  ELGFLIKFYTNS--PMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDAS 172
                  +F+ +   P+D       +  ++ +     ++P+LL F+F +++ R+ D+   S
Sbjct: 169  TALAAYQFFGDRLFPLDQAITDPEQGTLLAMIAAAGLIPVLLVFAFAMLVRRSSDLRLMS 228

Query: 173  QSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVL 232
            +S+A +A +L +PE  +SE++ S+  AVR+E+  + E ++RA+SR  ELE  V  E+  L
Sbjct: 229  RSLAEVAFKLAEPEAVASERVASVGQAVRREVSSLGESVERALSRTMELENVVHGEVSAL 288

Query: 233  ENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHL-- 290
            E  Y  +E +I  + Q+L  ERE +++H  ++ +S+   HE L  ++   SE+I   +  
Sbjct: 289  ERAYADNEAKIRTLVQDLGSEREQMLSHAERMRSSVVGSHEQLVIDVDQASEQILQRIEE 348

Query: 291  ------------SRAI--------DSFQSIVDVR---------------IAKVT---EKT 312
                        SR +        D+  S+ D R               I ++T   E  
Sbjct: 349  ASARFTALFEDRSRTLAEDFTSRSDTMASLFDERSSEISGRLSANSEELIQRITQSGEDA 408

Query: 313  TRIVQESAQTISSKIDQLLEVLHSTS-------IVITKDFDNRIES----LSNTLNNSGR 361
            T+ ++E+ + ++ ++D  +  +   S         I +D ++RI+S    +   L +  +
Sbjct: 409  TQTLRETGENVAGQLDTRISTMSQRSDALMERLSTIGEDIESRIQSSEERIGALLESRAQ 468

Query: 362  SL---ANQVGNYTLMLGNNTDKVSIA---------------LKEQSQQFMQAFTSHICEM 403
            SL    +++      +G   ++  +A               L  ++Q+F+   T  + E 
Sbjct: 469  SLTASTDELATRLTAIGQEMEQRLVASGEAINGLLANRSATLSGENQKFLIDLTQALDER 528

Query: 404  SNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRIT 463
            SN  + +  S    L    +     L EK   F  +L    ++   E+D +T  L   I 
Sbjct: 529  SNTMTSETSSFLSGLEAAFEQRLRELAEKSGGFLGDLDRVIEHRSEELDGKTQRLITDID 588

Query: 464  AFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMED---LFLSN 520
              L      F +         +    EF+  L    + + G F    G + D    FLS+
Sbjct: 589  GRLGTRASEFEDKSGSIVDRLETQAREFDRQLMATGESMTGLFEARKGTLSDETGRFLSD 648

Query: 521  IQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLE----------NTLTNSINSLKD 570
            +  +    D++    + +  + QN ++Q+     ERL             L  SI+S + 
Sbjct: 649  MAAV---FDQR---LQGLAGEAQNFLAQLDGAFNERLREIGERDDIYIGKLGESIDSRRG 702

Query: 571  MLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGH 630
             LE+  +R  S I    EE   S     ++ +N++SD  +     L R     + T+A  
Sbjct: 703  ALEDHSERFLSSI----EE---SLTERTERAANLLSDTNEKTIGDLDRRIEAIDRTLAER 755

Query: 631  PQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVV--------------- 675
               +V+++    N + D    ++ +L +  +    +L   A ++V               
Sbjct: 756  GGGLVEALDERANVIADATQRISDSLEKRSREFAQALAERAREIVAAFEAGHQALGTGTQ 815

Query: 676  HKITNAENQLVNR------------------FDESSKNIICSYNSSNNKLETIFQKHLHS 717
              +T +E  L  R                   D  S  I  +++S N +L       +  
Sbjct: 816  ESLTESERVLDQRTSDLRALLDERLSGLNSLLDAGSGQISAAFDSGNQRLSQQGDDLIWQ 875

Query: 718  FNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKA----- 772
              + F+ + +  SGIL  ST  I     +     EE   + SA I++ L+ +S       
Sbjct: 876  TRNVFDERMEGFSGILAASTGLIASSLDDRRHEFEEKARAVSAEIDARLADLSSTLDART 935

Query: 773  --MNKSIDD--------VETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQ 822
              +N ++DD        V ++S  ++ R  +LGS +   ++++ S+    Q    +TF +
Sbjct: 936  SQLNSTLDDRRSLLEESVRSMSAEIETRLADLGSSIEVRTEQLTSTFDDRQ----STFDE 991

Query: 823  RNDSFVNALADNQSKFENNLVNQ-----SHLLLDKLSSDIQKLTDIAY---SKAIDVANS 874
            R D  + A+ D + +  + ++++     S     + S+  +K   IA    ++  D+A+ 
Sbjct: 992  RAD-VIRAVLDERLQSLSAMLDERTGQISGAFEGRQSAFEEKARGIATDLDTRLHDLASL 1050

Query: 875  LTEIQGNVGVTLENHSQAMLE-----KISASNTL--VAKTFEECMSNILLSYDENRQTLD 927
            L    G +   L+   ++ +E     +++    L  +A   +E    I  + DE R++ D
Sbjct: 1051 LDARSGQMAGILDERRESFVESADVVRMTIDEKLGDLATMLDERSGRIAGTIDERRESFD 1110

Query: 928  KKLSDHIDVLRQNLAGSENKI----DGAIGSA-----SQF------IRDILDENSSRIES 972
               +D   +L Q L G  N I     GAI         +F      +R  LDE    + S
Sbjct: 1111 VIANDLRGLLDQRLEGL-NAILAERAGAISGVFDDKQGEFDRRADSVRTYLDERLEDLGS 1169

Query: 973  LLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQ 1032
            LL   +  +          FD     K++E+  LLD + + LS+ +  +   L     E+
Sbjct: 1170 LLEARSGQMAGLFDDRRHAFD----AKAEEVRSLLDERLNSLSSLLDRRRDALGETFDEK 1225

Query: 1033 EKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQ- 1091
             ++L    D++ S    L +   T+ + L S +                +L+++ QK Q 
Sbjct: 1226 LQALD---DSTGSRIDALYERTSTIGEALASAVS---------------NLETLLQKRQA 1267

Query: 1092 KCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGE 1151
            K  E  G+         S+ +E S   ++  +Q +   L   +  I N + D+  R+   
Sbjct: 1268 KLEEALGNR--------SEDLEAS---LALNSQTLLSGLENQSGQIKNSLEDTVRRIEA- 1315

Query: 1152 IVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIH 1211
            ++ +++  +  +R +++++E     L++    I  ++     T++         ++ RI 
Sbjct: 1316 LIGMADGIM--ARGVDEKQEALAQVLEARGKAIESLVERTRDTLTGG-------LDDRIE 1366

Query: 1212 EVKDVLSN----LDRALESYGSTVFKQFKEYVQCFETNMEN----MESLFDKNNDSMLLS 1263
             +  +LS+    L+++L+S G  +    +E      +  E+    + S+ ++  + ML +
Sbjct: 1367 SIAVLLSDRSDRLNQSLQSEGVKLLSTVEERSNALRSEFEDRATILTSITEEIRERMLSA 1426

Query: 1264 FKER----SNILDNILSQRSMEIS---DSISGAFHKEGNAVVNVIDQQIYNAANALKKLE 1316
              ER    S   D++ S  + ++S   D+++ A  +   A+   ID Q     +      
Sbjct: 1427 LDERIGTLSGGFDDLASNIAADVSSRVDALASAMEEARGAIRQSIDSQTDQFRSEFDARS 1486

Query: 1317 ALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAES 1376
            +     +++  N        +  I    ++ +N +DER    T+RI       D  L+  
Sbjct: 1487 SAFSEQIDQSAN------GQIEAIERALSNVINGLDER----TDRIR------DLALSSE 1530

Query: 1377 SKLFE---KKIKDLGE--ISRVSLLQ------MSEIVSKFDKNSQILIKSHDSLMKAQSE 1425
            SKL E   ++   L +    RV L +         + S   +  ++L+   D  + A + 
Sbjct: 1531 SKLVEDLDRRASSLADQVAGRVQLAEEGLTTRAESLRSLIGEAQRLLVDGLDERLGAMA- 1589

Query: 1426 TKLSLDKDANNLVDLTSRLVSKSSE----AQKFVMSILVDVKKIVE---QADFLSDTVVK 1478
              L    +++ L  L  R  + +SE     +    +I   V  I E   QAD    ++++
Sbjct: 1590 -ALVAASESSMLTGLDERREAIASELSGGREAIAHTIEERVNAISESLMQADLKLSSILE 1648

Query: 1479 NMTDSIQSSFIKID-GTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYD 1537
            N  DSI S+  +      + +  RS +  R ID ++A +     +        L + S  
Sbjct: 1649 NRRDSIASTIEEASRAAAATLGDRSDEVRRAIDDSVASVSTTLEERRGELVAALDQGSSA 1708

Query: 1538 LSNHMRQKICSTIPNIE----NIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDI 1593
            LS  + ++  +    +E    N+  TL  ++        +++   + + T ++S+  + +
Sbjct: 1709 LSEVLDERTTAISSALERGLGNVERTLSARAGAIADTIRETIAEAMQTMTTEVSQARESL 1768

Query: 1594 ALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKN 1653
               + R+AE+L+   ++              S+D  R  IE++ N L +  + + D +  
Sbjct: 1769 QGETNRLAENLSGMEELF-----------TASSDAARRQIEDEANRLSNRLQSLADDLTA 1817

Query: 1654 NAASYNKGLHSDEYNISQ 1671
             A+     L  +   I++
Sbjct: 1818 KASEAQFSLTGESERIAE 1835



 Score =  121 bits (303), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 264/1420 (18%), Positives = 571/1420 (40%), Gaps = 207/1420 (14%)

Query: 304  RIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTL------- 356
            RI  + E+T+ I     + ++S +  L  +L      + +   NR E L  +L       
Sbjct: 1236 RIDALYERTSTI----GEALASAVSNLETLLQKRQAKLEEALGNRSEDLEASLALNSQTL 1291

Query: 357  -----NNSGR---SLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFS 408
                 N SG+   SL + V     ++G     ++  + E+ +   Q   +    + +   
Sbjct: 1292 LSGLENQSGQIKNSLEDTVRRIEALIGMADGIMARGVDEKQEALAQVLEARGKAIESLVE 1351

Query: 409  EKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTL----ENR--- 461
              + ++T  L+D ++S+ + L ++ D    +L+S     L  V+ R+N L    E+R   
Sbjct: 1352 RTRDTLTGGLDDRIESIAVLLSDRSDRLNQSLQSEGVKLLSTVEERSNALRSEFEDRATI 1411

Query: 462  ITAFLKEIVE----TFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLF 517
            +T+  +EI E      +  I   S  + D  S   +++   +D L     ++ G +    
Sbjct: 1412 LTSITEEIRERMLSALDERIGTLSGGFDDLASNIAADVSSRVDALASAMEEARGAIRQSI 1471

Query: 518  LSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQ 577
             S      S  D ++  F + + +  N   QI     E +E  L+N IN L    +E+  
Sbjct: 1472 DSQTDQFRSEFDARSSAFSEQIDQSANG--QI-----EAIERALSNVINGL----DERTD 1520

Query: 578  RIDSDIGKKSE-ELCSSFNSSYQKVSNVISDREKLFSNSLA-RVQSHFEETIAGHPQSIV 635
            RI  D+   SE +L    +     +++ ++ R +L    L  R +S    ++ G  Q ++
Sbjct: 1521 RI-RDLALSSESKLVEDLDRRASSLADQVAGRVQLAEEGLTTRAESL--RSLIGEAQRLL 1577

Query: 636  DSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKN 695
                   + L +++  +AA ++ S+ S+   L      +  +++     + +  +E    
Sbjct: 1578 ------VDGLDERLGAMAALVAASESSMLTGLDERREAIASELSGGREAIAHTIEERVNA 1631

Query: 696  IICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNST----QHIDDLFSNNAKRM 751
            I  S   ++ KL +I +    S   T    S   +  L + +    + IDD  ++ +  +
Sbjct: 1632 ISESLMQADLKLSSILENRRDSIASTIEEASRAAAATLGDRSDEVRRAIDDSVASVSTTL 1691

Query: 752  EE-------LLHSGSANIESEL----SAISKAMNKSIDDVETISTALKERCQELGSDLVN 800
            EE        L  GS+ +   L    +AIS A+ + + +VE     L  R   +      
Sbjct: 1692 EERRGELVAALDQGSSALSEVLDERTTAISSALERGLGNVERT---LSARAGAI------ 1742

Query: 801  HSDKVLSSLKQAQELLCTTFAQRNDSF---VNALADNQSKFENNLVNQSHLLLDKLSSDI 857
             +D +  ++ +A + + T  +Q  +S     N LA+N S  E      S     ++  + 
Sbjct: 1743 -ADTIRETIAEAMQTMTTEVSQARESLQGETNRLAENLSGMEELFTASSDAARRQIEDEA 1801

Query: 858  QKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILL 917
             +L++   S A D+    +E Q     +L   S+ + E I+ +   +    EE  +   +
Sbjct: 1802 NRLSNRLQSLADDLTAKASEAQ----FSLTGESERIAENITGATAALRTLSEESRNRFSV 1857

Query: 918  SYDENRQTLDKKLSD---HIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLL 974
               +  Q +     D    +  +++ LA     +  A+ + S  +    + N+ R E ++
Sbjct: 1858 EATQLSQAIAALAGDMNREVATVQEGLAAQRMSLADALSNVSVEVASEFERNTKRFEEMM 1917

Query: 975  SCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEK 1034
              +   V S+   S       ++E+++ +   + + A+ +     T  I L +N  E   
Sbjct: 1918 QEAQGRVASSSFESRDA----MREQTETITAQIVDAANRMREQAETSQIALRDNTDELAN 1973

Query: 1035 SLS----RVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
             +S    R+   + ++ K L D      +EL +V           S +LE  L S N   
Sbjct: 1974 RISGVSSRLRSETENAAKSLEDRALRFTEELSTV-----------SVQLEELLQSSN--- 2019

Query: 1091 QKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRG 1150
                   G+ +    + +   +  + + + Q    I+ +L  +   ++   +   S  R 
Sbjct: 2020 ------LGEGLREATERVRAEIANASESLRQEATTIAAELRGDVVSLSQSFVHDASEARD 2073

Query: 1151 EIV----DISNKFIETSRVL----EQREEKFHSALDSFSDNISRILLDVDHTISSHTNES 1202
            E++    D+S  F   S  +    EQ  ++   A  + +D +S  + + +  I++     
Sbjct: 2074 ELLSRSADLSGHFATISETIRSQTEQARDQLMEAAGAVADELSARMGESERQIAARGRML 2133

Query: 1203 RSLIEQRIHEVKDVLSN----LDRALES----------YG-STVFKQFKEYVQCFETNME 1247
               +++R  E+  VLS+    + R LE+           G S   +   E +Q   +++ 
Sbjct: 2134 SEDLDKRTREMATVLSSSSAEIARILETELTERLSASERGISDRARLLGEELQGRTSDLT 2193

Query: 1248 NMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYN 1307
            N   +    +  ++   +E +  L + LSQR+    D    A ++    V+   D++  +
Sbjct: 2194 N---VIGSQHTQLVRLLEEDAQPLVSQLSQRA----DETIAALNQAAEGVMGAFDERARS 2246

Query: 1308 AANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTG 1367
            AA  +  +   L  +++ +  R+  +S ++  ++ +   +L  +D  L Q+  R T    
Sbjct: 2247 AAADVSDIRERLAGELDSLLGRLGQTSGELRGLVEETASNLGAIDTTLQQSGERFTNAAE 2306

Query: 1368 HIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETK 1427
                 +A ++++ E   + L ++S  +  +++ IV +F ++   L  +   +   +   +
Sbjct: 2307 QASNQIALTARMLENNTERLDQMSMGAFSKVASIVDRFAEHGAALGDAVRQIETGEGRLR 2366

Query: 1428 LSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSS 1487
             +L+     L +L S LV++S E                             +  +IQS 
Sbjct: 2367 ETLEGGRGGLEELASTLVARSEE-----------------------------IGGTIQS- 2396

Query: 1488 FIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKIC 1547
                +G ++N+                             F   +E+S  +S+ +  ++ 
Sbjct: 2397 ---FEGLMTNL-----------------------------FDRTEERSRAISSQLSSEVS 2424

Query: 1548 STIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNS 1607
             T+ N +      EE+S  + +    ++ + V+  +Q+    +D+I   +  I E+++ +
Sbjct: 2425 GTLENADRQLGITEERSRAAAESIRQAVQSAVEEASQRFEGATDEIRRAASAIREEMSAA 2484

Query: 1608 RDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLI 1647
            R  +K+    L +E +ES   +R A+ +Q+  L+D  +++
Sbjct: 2485 RSDIKQGVFELPEETRESTAAMRRAVSDQLRALRDLSEIV 2524



 Score =  105 bits (262), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 83/141 (58%), Gaps = 4/141 (2%)

Query: 1690 WFNKILSSSTHS----KGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTL 1745
            W + +L  ++      +G+       +   S   ++ +   I + ID +    LW+ Y  
Sbjct: 2696 WVSDLLRRASRDDDGMQGRPPQQETSAGNSSGGQLEDISGEIVRAIDTNTASDLWRRYRR 2755

Query: 1746 GEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLV 1805
            GE ++F++RLYTI+GQ+ F  ++ +Y+ D+  R+A++ YIS+FE++LSE  + + D  L 
Sbjct: 2756 GETNVFNRRLYTIRGQQTFDTVRRRYQRDTEFRSAVESYISDFEQLLSEAVRHDPDIDLT 2815

Query: 1806 QEHIMSNYGKVYTMLVHASGR 1826
            Q ++ +  GKVYTML HA+G+
Sbjct: 2816 QSYLTTETGKVYTMLAHAAGK 2836



 Score = 60.1 bits (144), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 287/1532 (18%), Positives = 597/1532 (38%), Gaps = 245/1532 (15%)

Query: 301  VDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSG 360
            +D R   + + + R +    ++++ + ++   +L  T+     D D RIE++  TL   G
Sbjct: 697  IDSRRGALEDHSERFLSSIEESLTERTERAANLLSDTNEKTIGDLDRRIEAIDRTLAERG 756

Query: 361  RSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSI-TVTLN 419
              L   +     ++ + T ++S +L+++S++F QA      E+   F    +++ T T  
Sbjct: 757  GGLVEALDERANVIADATQRISDSLEKRSREFAQALAERAREIVAAFEAGHQALGTGTQE 816

Query: 420  DVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITD 479
             + +S R+      D   S+L++  D  L  +++  +    +I+A      +  +    D
Sbjct: 817  SLTESERVL-----DQRTSDLRALLDERLSGLNSLLDAGSGQISAAFDSGNQRLSQQGDD 871

Query: 480  FSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDIL 539
                 ++   E      G +    G  A S  +    F    + + + +D +     D+ 
Sbjct: 872  LIWQTRNVFDERMEGFSGILAASTGLIASSLDDRRHEFEEKARAVSAEIDAR---LADLS 928

Query: 540  SKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFN---S 596
            S      SQ+ S   +R  + L  S+ S+   +E +   + S I  ++E+L S+F+   S
Sbjct: 929  STLDARTSQLNSTLDDR-RSLLEESVRSMSAEIETRLADLGSSIEVRTEQLTSTFDDRQS 987

Query: 597  SY---------------QKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNS 641
            ++               Q +S ++ +R    S +    QS FEE   G    +   + + 
Sbjct: 988  TFDERADVIRAVLDERLQSLSAMLDERTGQISGAFEGRQSAFEEKARGIATDLDTRLHDL 1047

Query: 642  TNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAE-NQLVNRFDESSKNIIC-- 698
             + L  +   +A  L E ++S        + DVV    + +   L    DE S  I    
Sbjct: 1048 ASLLDARSGQMAGILDERRESF-----VESADVVRMTIDEKLGDLATMLDERSGRIAGTI 1102

Query: 699  -----SYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEE 753
                 S++   N L  +  + L   N     ++  +SG+  +     D    +    ++E
Sbjct: 1103 DERRESFDVIANDLRGLLDQRLEGLNAILAERAGAISGVFDDKQGEFDRRADSVRTYLDE 1162

Query: 754  LLHSGSANIESELSAISKAMNKSIDD--------VETISTALKERCQELGSDLVNHSDKV 805
             L     ++ S L A S  M    DD         E + + L ER   L S L    D +
Sbjct: 1163 RLE----DLGSLLEARSGQMAGLFDDRRHAFDAKAEEVRSLLDERLNSLSSLLDRRRDAL 1218

Query: 806  LSSLKQAQELLCTTFAQRNDSFVN-------ALAD-----------NQSKFENNLVNQSH 847
              +  +  + L  +   R D+          ALA             Q+K E  L N+S 
Sbjct: 1219 GETFDEKLQALDDSTGSRIDALYERTSTIGEALASAVSNLETLLQKRQAKLEEALGNRSE 1278

Query: 848  LLLDKLSSDIQKLTDIAYSKAIDVANSLTE----IQGNVGVT-------LENHSQAMLEK 896
             L   L+ + Q L     +++  + NSL +    I+  +G+        ++   +A+ + 
Sbjct: 1279 DLEASLALNSQTLLSGLENQSGQIKNSLEDTVRRIEALIGMADGIMARGVDEKQEALAQV 1338

Query: 897  ISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSAS 956
            + A    +    E     +    D+  +++   LSD  D L Q+L     K+   +   S
Sbjct: 1339 LEARGKAIESLVERTRDTLTGGLDDRIESIAVLLSDRSDRLNQSLQSEGVKLLSTVEERS 1398

Query: 957  QFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLST 1016
              +R   ++ ++    +L+     +   +L +       L E+   L    D+ AS ++ 
Sbjct: 1399 NALRSEFEDRAT----ILTSITEEIRERMLSA-------LDERIGTLSGGFDDLASNIAA 1447

Query: 1017 AVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDS----------------IQTLAQE 1060
             VS++   L + ++E   ++ + +D+    F+   D+                I+ + + 
Sbjct: 1448 DVSSRVDALASAMEEARGAIRQSIDSQTDQFRSEFDARSSAFSEQIDQSANGQIEAIERA 1507

Query: 1061 LVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRIS 1120
            L +VI  + + T  I   L +S +S      K  E       +  D+++  ++++E+ ++
Sbjct: 1508 LSNVINGLDERTDRIR-DLALSSES------KLVEDLDRRASSLADQVAGRVQLAEEGLT 1560

Query: 1121 QRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSF 1180
             R + +   + +   ++ + + D        +V  S   + T   L++R E   S L   
Sbjct: 1561 TRAESLRSLIGEAQRLLVDGL-DERLGAMAALVAASESSMLTG--LDERREAIASELSGG 1617

Query: 1181 SDNISRILLDVDHTISSHTNE-SRSLIEQRI-------HEVKDVLSNLDRALESYGSTVF 1232
             + I+       HTI    N  S SL++  +       +    + S ++ A  +  +T+ 
Sbjct: 1618 REAIA-------HTIEERVNAISESLMQADLKLSSILENRRDSIASTIEEASRAAAATLG 1670

Query: 1233 KQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHK 1292
             +  E  +  + ++ ++ +  ++    ++ +  + S+ L  +L +R+  IS ++      
Sbjct: 1671 DRSDEVRRAIDDSVASVSTTLEERRGELVAALDQGSSALSEVLDERTTAISSALERGL-- 1728

Query: 1293 EGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVD 1352
             GN     +++ +   A A+           + I   I ++ Q +TT +S A +SL    
Sbjct: 1729 -GN-----VERTLSARAGAI----------ADTIRETIAEAMQTMTTEVSQARESL---- 1768

Query: 1353 ERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQIL 1412
                  TNR+ E    ++ +   SS    ++I+D  E +R+S                 L
Sbjct: 1769 ---QGETNRLAENLSGMEELFTASSDAARRQIED--EANRLS---------------NRL 1808

Query: 1413 IKSHDSLMKAQSETKLSL----DKDANNLVDLTSRLVSKSSEAQ-----------KFVMS 1457
                D L    SE + SL    ++ A N+   T+ L + S E++           + + +
Sbjct: 1809 QSLADDLTAKASEAQFSLTGESERIAENITGATAALRTLSEESRNRFSVEATQLSQAIAA 1868

Query: 1458 ILVDVKKIVEQ------------ADFLSDTVVK------NMTDSIQSSFIKIDGTLSNIE 1499
            +  D+ + V              AD LS+  V+        T   +    +  G +++  
Sbjct: 1869 LAGDMNREVATVQEGLAAQRMSLADALSNVSVEVASEFERNTKRFEEMMQEAQGRVASSS 1928

Query: 1500 TRSRDTVR----LIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIEN 1555
              SRD +R     I   + D  N+  +  +++ + L++ + +L+N +           EN
Sbjct: 1929 FESRDAMREQTETITAQIVDAANRMREQAETSQIALRDNTDELANRISGVSSRLRSETEN 1988

Query: 1556 IFSTLEEKSDQ------SMQVFLDSL---NNKVDSFTQKLSKTSDDIALTSRRIAEDLNN 1606
               +LE+++ +      ++ V L+ L   +N  +   +   +   +IA  S  + ++   
Sbjct: 1989 AAKSLEDRALRFTEELSTVSVQLEELLQSSNLGEGLREATERVRAEIANASESLRQEATT 2048

Query: 1607 SRDILKRDSVSL-------AKEAKE-----SAD----------TIRSAIEEQINTLKDFQ 1644
                L+ D VSL       A EA++     SAD          TIRS  E+  + L +  
Sbjct: 2049 IAAELRGDVVSLSQSFVHDASEARDELLSRSADLSGHFATISETIRSQTEQARDQLMEAA 2108

Query: 1645 KLITDSVKNNAASYNKGLHSDEYNISQ-VDKR 1675
              + D +        + + +    +S+ +DKR
Sbjct: 2109 GAVADELSARMGESERQIAARGRMLSEDLDKR 2140


>gi|254719099|ref|ZP_05180910.1| hypothetical protein Bru83_06100 [Brucella sp. 83/13]
 gi|306838383|ref|ZP_07471228.1| Hypothetical protein BROD_1197 [Brucella sp. NF 2653]
 gi|306406523|gb|EFM62757.1| Hypothetical protein BROD_1197 [Brucella sp. NF 2653]
          Length = 1557

 Score =  178 bits (451), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 299/1441 (20%), Positives = 579/1441 (40%), Gaps = 287/1441 (19%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L+  L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLKEELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNK 725
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHA-------- 495

Query: 726  SDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETIST 785
                   L NST+ ++      ++++ E L + +  I    S    ++   +DD++    
Sbjct: 496  -------LDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKV--- 545

Query: 786  ALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQ 845
                   ++G DL + S+ V                       N L D  + FE  L   
Sbjct: 546  -------KIGDDLTSISESV----------------------GNVLIDKAAAFEGKLAES 576

Query: 846  SHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTL-------ENHSQAMLEKIS 898
              LL   L  + ++++ +    A  +A    +IQ  +  +        + H+  + E+ S
Sbjct: 577  RDLLAATLEGETERVSSVIRGHADTLAARTGDIQNAIDASASALNEVTDKHAAILAERTS 636

Query: 899  ASNTLVAKTFEECMS-NILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQ 957
            A         ++ MS NI L        LD   +DH   L +  A   N I G     +Q
Sbjct: 637  A--------LQQAMSSNISL--------LDASFADHARSLEERTASLHNVIAGNQAILAQ 680

Query: 958  FI-------RDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNK 1010
             +       R+  +EN   +         S+ S +  +    +R+L E++  + + L   
Sbjct: 681  LMDERVAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAESLGAG 740

Query: 1011 ASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSD----SIQTLAQELVSVI- 1065
                 TA+      +E    E+   L  V++    +  ++ D    +I+T A E+ S + 
Sbjct: 741  RDAFETALGEHVRTVE----ERTSGLQAVLNNHNDALAHVLDGHERTIETRAAEIRSTLT 796

Query: 1066 ---GSMSQSTTDISGKLE---ISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRI 1119
                S+SQ+  D    LE    SL +             +     ++E ++ ME   K +
Sbjct: 797  DSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTETME---KAL 853

Query: 1120 SQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDS 1179
            S     + + L Q+  V+  ++                K  E +  L     K   ALD 
Sbjct: 854  SIGVDNVRRALEQSAGVVAGKL--------------REKIGEAASTLAAEAAKAGEALDG 899

Query: 1180 FSDNISRILLDVDHTISSHTNESRSLIEQRIHEVK----DVLSNLDRALESYGSTVFKQF 1235
            F ++ S  L+D      +   E    I  R+ +++    D L  ++  +    +   +  
Sbjct: 900  FGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTSETL 959

Query: 1236 KEYVQCFET----NMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFH 1291
              + + F      N+   E+   +  D++       +  L +I S+ +ME+     G+  
Sbjct: 960  ASHSESFSASVADNLAGTETRLVERADAI-------ATRLGDIGSRITMEL-----GSVE 1007

Query: 1292 KEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSL-NK 1350
                 +  V D          ++L A+L +  ++IT  + D+++ +   ++D+   L  +
Sbjct: 1008 AR---IAQVTDTTAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQ 1064

Query: 1351 VDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQ 1410
            ++E  H  T+R+      +   LA        +  D      ++ +Q ++ V   D  S+
Sbjct: 1065 LEEATHAATDRLRSENAALVNALA-------SRTADT-----IAAVQQAK-VGLSDNVSE 1111

Query: 1411 ILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS--------EAQKFVMSI-LVD 1461
            ++    D L  +  E    +D    NL D+  RLV  ++         AQ F  S  L+D
Sbjct: 1112 LI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTTSFVENTNRAAQMFQASTGLID 1167

Query: 1462 -------------VKKIVEQADFLSD--TVVKNMTDSIQSSFIKIDGTLSNIETRSRDTV 1506
                         + +I + AD   +   V+ + +D I S+    +G +S +E R     
Sbjct: 1168 SNLGTLRTLSDNTLSQIADIADRFEEHGKVLSSASDMINSAQ---NGLVSTLEER----- 1219

Query: 1507 RLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQ 1566
                       ++ +  + S  V   E    L       + S        F   E ++  
Sbjct: 1220 -----------HQALDKLASGLVDKSEGVEKLMQSFEALVASA-------FQRAEGQTRV 1261

Query: 1567 SMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESA 1626
            S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  EAKE+ 
Sbjct: 1262 SAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPAEAKETT 1321

Query: 1627 DTIRSAIEEQINTLKDFQKLITDS--------------VKNNAAS----YNKGLHSDEYN 1668
              +R A+ EQIN LK+  +++  S              V   AAS        + +    
Sbjct: 1322 TAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVPRPAASRPVPVQAPVRAPIAP 1381

Query: 1669 ISQVD----KRP------SGKKTKNNHAIKEWFNKILSSSTH-------------SKGKS 1705
            ++Q D     RP          T +    + W + +L+ ++              +  +S
Sbjct: 1382 LAQADVAVRSRPVEAPNQKPAPTASAEKPRGWVSDLLARASREEEEAAQPKVQPAATPRS 1441

Query: 1706 SSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFL 1765
             SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+KGQ+ F 
Sbjct: 1442 PSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLKGQQTFD 1494

Query: 1766 NLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASG 1825
            +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTML HASG
Sbjct: 1495 DIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTMLAHASG 1554

Query: 1826 R 1826
            R
Sbjct: 1555 R 1555



 Score =  178 bits (451), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 247/1126 (21%), Positives = 476/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++S AVR+E+  M E I+R ++RA ELE 
Sbjct: 242  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLSQAVRREVAAMNEGIERTLARAVELET 301

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE LKEELS  S
Sbjct: 302  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLKEELSSAS 361

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 362  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     NI  L   FAD   ++
Sbjct: 602  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNISLLDASFADHARSL 660

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++ ++  + N ++    N E L  T    I SL+ +  
Sbjct: 661  EERTASLHNVIAGNQAILAQLMDERVAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 777  LDGHERTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 836

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 837  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 896

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 897  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 956

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 957  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1016

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1017 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1076

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+  D   ++   Q  VG++ +N S+ ++++++ASN  + K  +    
Sbjct: 1077 RSENAALVNALASRTADTIAAVQ--QAKVGLS-DNVSE-LIDRLAASNGELGKLIDAATR 1132

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIGSASQF-------IRDILD 964
            N+    D + + +D   S  ++ +   Q    S   ID  +G+           I DI D
Sbjct: 1133 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1189

Query: 965  --ENSSRIES----LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              E   ++ S    +++ + N + STL   HQ  D+L   L +KS+ + +L+ +  + ++
Sbjct: 1190 RFEEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVDKSEGVEKLMQSFEALVA 1249

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1250 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1295


>gi|148560166|ref|YP_001258964.1| hypothetical protein BOV_0990 [Brucella ovis ATCC 25840]
 gi|148371423|gb|ABQ61402.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
          Length = 1582

 Score =  178 bits (451), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 283/1356 (20%), Positives = 560/1356 (41%), Gaps = 255/1356 (18%)

Query: 601  VSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALS--- 657
            VS++ ++RE + S++  RV+S    +I+G  + + + +S+++N + D ++  +  LS   
Sbjct: 350  VSDLGNEREAVVSHA-ERVRS----SISGAHEQLREELSSASNIIRDNVLSASQQLSALL 404

Query: 658  ------------ESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNN 705
                        ES  ++ ++++    D+ ++IT +     N  D           + + 
Sbjct: 405  GDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFANLLD-------TRIATLDE 457

Query: 706  KLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESE 765
            +  TI  K         + ++  ++ +L ++TQ +   F      +E  L     ++ +E
Sbjct: 458  QSRTISGK----LTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGCSLLAE 513

Query: 766  LSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTT------ 819
              A + A++ S    E ++ AL+ R +++  +L+  + ++  +    +  L         
Sbjct: 514  FEARAHALDNS---TEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKV 570

Query: 820  -----FAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANS 874
                     ++S  N L D  + FE  L     LL   L  + ++++ +    A  +A  
Sbjct: 571  KIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADTLAAR 630

Query: 875  LTEIQGNVGVTL-------ENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLD 927
              +IQ  +  +        + H+  + E+ SA         ++ MS+       N   LD
Sbjct: 631  TGDIQNAIDASASALNEVTDKHAAILAERTSA--------LQQAMSS-------NVSLLD 675

Query: 928  KKLSDHIDVLRQNLAGSENKIDGAIGSASQFI-------RDILDENSSRIESLLSCSNNS 980
               +DH   L +  A   N I G     +Q +       R+  +EN   +         S
Sbjct: 676  ASFADHARSLEERTASLHNVIAGNQAMLAQLMDERAAAMRENFNENREVLARTFDERIGS 735

Query: 981  VNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVV 1040
            + S +  +    +R+L E++  + + L        TA+      +E    E+   L  V+
Sbjct: 736  LQSLIAENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVE----ERTSGLQAVL 791

Query: 1041 DTSASSFKYLSD----SIQTLAQELVSVI----GSMSQSTTDISGKLE---ISLDSVNQK 1089
            +    +  ++ D    +I+T A E+ S +     S+SQ+  D    LE    SL +    
Sbjct: 792  NNHNDALAHVLDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIAN 851

Query: 1090 IQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                     +     ++E ++ ME   K +S     + + L Q+  V+  ++        
Sbjct: 852  SSAAISSAFEGQTGIIEERTETME---KALSIGVDNVRRALEQSAGVVAGKL-------- 900

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
                    K  E +  L     K   ALD F ++ S  L+D      +   E    I  R
Sbjct: 901  ------REKIGEAASTLAAEAAKAGEALDGFGESFSARLIDNLSGTEARLGERADAIAGR 954

Query: 1210 IHEVK----DVLSNLDRALESYGSTVFKQFKEYVQCFET----NMENMESLFDKNNDSML 1261
            + +++    D L  ++  +    +   +    + + F      N+   E+   +  D++ 
Sbjct: 955  LGDIEGRLTDELGTIEARIADTAAKTSETLASHSESFSASVADNLAGTETRLVERADAI- 1013

Query: 1262 LSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLIS 1321
                  +  L +I S+ +ME+     G+       +  V D          ++L A+L +
Sbjct: 1014 ------ATRLGDIGSRITMEL-----GSVEAR---IAQVTDTTAVTLEERTRELNAVLAA 1059

Query: 1322 DVEKITNRITDSSQDVTTIISDATDSL-NKVDERLHQTTNRITETTGHIDTVLAESSKLF 1380
              ++IT  + D+++ +   ++D+   L  +++E  H  T+R+      +   LA  S+  
Sbjct: 1060 RSQEITKILNDTAEPLVQRLADSGCGLAQQLEEATHAATDRLRSENAALVNALA--SRTA 1117

Query: 1381 EKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDL 1440
            E           ++ +Q ++ V   D  S+++    D L  +  E    +D    NL D+
Sbjct: 1118 ET----------IAAVQQAK-VGLSDNVSELI----DRLAASNGELGKLIDAATRNLADI 1162

Query: 1441 TSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIET 1500
              RLV  ++                     F+ +T         Q+S   ID  L  + T
Sbjct: 1163 DGRLVDSTT--------------------SFVENT--NRAAQMFQASTGLIDSNLGTLRT 1200

Query: 1501 RSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPN----IENI 1556
             S +T+      +ADI ++     D +   L   S D+ N  +  + ST+      ++ +
Sbjct: 1201 LSDNTL----SQIADIADR----FDEHGKVLSSAS-DMINSAQNGLVSTLEERHQALDKL 1251

Query: 1557 FSTLEEKSD------QSMQVFL-------------------DSLNNKVDSFTQKLSKTSD 1591
             S L EKS+      QS +  +                   +S+++ V+   QK S  +D
Sbjct: 1252 ASGLVEKSEGVEKLMQSFEALVASSFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATD 1311

Query: 1592 DIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS- 1650
            +I  T+  I  +L+ +R  LKR  + +  EAKE+   +R A+ EQIN LK+  +++  S 
Sbjct: 1312 EIRRTASEIRAELDTTRGELKRGVLDMPAEAKETTTAMRKAVSEQINALKELAEIVNKSG 1371

Query: 1651 -------------VKNNAASYNKGLHSDE----YNISQVD--------KRPSGKKTKNNH 1685
                         V   AAS    + +        ++Q D        + P+ K      
Sbjct: 1372 RLVDVGEGRADRPVSRPAASRPAPVQAPVRAPIAPLAQTDVAVRSRPVEAPNQKPAPAAS 1431

Query: 1686 AIKE--WFNKILSSSTH-------------SKGKSSSHIDISDKDSLSSIDSLVENISKF 1730
            A K   W + +L+ ++              +  +S SH+       + S++SL  +I++ 
Sbjct: 1432 AEKPRGWVSDLLARASREEEEAAQPKVQPAATPRSPSHV-------VESLNSLSVDIARA 1484

Query: 1731 IDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEE 1790
            ID++A V+LW  Y  GE ++F++RLYT+KGQ+ F +++ +Y+ D   R A+DRY+ +F+ 
Sbjct: 1485 IDHEASVELWDRYRRGERNVFTRRLYTLKGQQTFDDIKRKYQTDGEFRRAVDRYMDDFQR 1544

Query: 1791 MLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +L ++A+++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1545 LLEDVARNDRDNMVTQTYLTSDTGKVYTMLAHASGR 1580



 Score =  171 bits (433), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 242/1126 (21%), Positives = 472/1126 (41%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMENAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            G SL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GCSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E+TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHEQTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIEGRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGCGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+    A ++  +Q    V L ++   ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASR---TAETIAAVQ-QAKVGLSDNVSELIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIG--------SASQF--IRD 961
            N+    D + + +D   S  ++ +   Q    S   ID  +G        + SQ   I D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 962  ILDENSSRIES---LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              DE+   + S   +++ + N + STL   HQ  D+L   L EKS+ + +L+ +  + ++
Sbjct: 1215 RFDEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVEKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            ++          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SSFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|265984090|ref|ZP_06096825.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|264662682|gb|EEZ32943.1| conserved hypothetical protein [Brucella sp. 83/13]
          Length = 1582

 Score =  177 bits (450), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 299/1441 (20%), Positives = 579/1441 (40%), Gaps = 287/1441 (19%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L+  L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLKEELSSASNIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNK 725
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHA-------- 520

Query: 726  SDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETIST 785
                   L NST+ ++      ++++ E L + +  I    S    ++   +DD++    
Sbjct: 521  -------LDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKV--- 570

Query: 786  ALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQ 845
                   ++G DL + S+ V                       N L D  + FE  L   
Sbjct: 571  -------KIGDDLTSISESV----------------------GNVLIDKAAAFEGKLAES 601

Query: 846  SHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTL-------ENHSQAMLEKIS 898
              LL   L  + ++++ +    A  +A    +IQ  +  +        + H+  + E+ S
Sbjct: 602  RDLLAATLEGETERVSSVIRGHADTLAARTGDIQNAIDASASALNEVTDKHAAILAERTS 661

Query: 899  ASNTLVAKTFEECMS-NILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQ 957
            A         ++ MS NI L        LD   +DH   L +  A   N I G     +Q
Sbjct: 662  A--------LQQAMSSNISL--------LDASFADHARSLEERTASLHNVIAGNQAILAQ 705

Query: 958  FI-------RDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNK 1010
             +       R+  +EN   +         S+ S +  +    +R+L E++  + + L   
Sbjct: 706  LMDERVAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAESLGAG 765

Query: 1011 ASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSD----SIQTLAQELVSVI- 1065
                 TA+      +E    E+   L  V++    +  ++ D    +I+T A E+ S + 
Sbjct: 766  RDAFETALGEHVRTVE----ERTSGLQAVLNNHNDALAHVLDGHERTIETRAAEIRSTLT 821

Query: 1066 ---GSMSQSTTDISGKLE---ISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRI 1119
                S+SQ+  D    LE    SL +             +     ++E ++ ME   K +
Sbjct: 822  DSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTETME---KAL 878

Query: 1120 SQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDS 1179
            S     + + L Q+  V+  ++                K  E +  L     K   ALD 
Sbjct: 879  SIGVDNVRRALEQSAGVVAGKL--------------REKIGEAASTLAAEAAKAGEALDG 924

Query: 1180 FSDNISRILLDVDHTISSHTNESRSLIEQRIHEVK----DVLSNLDRALESYGSTVFKQF 1235
            F ++ S  L+D      +   E    I  R+ +++    D L  ++  +    +   +  
Sbjct: 925  FGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTSETL 984

Query: 1236 KEYVQCFET----NMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFH 1291
              + + F      N+   E+   +  D++       +  L +I S+ +ME+     G+  
Sbjct: 985  ASHSESFSASVADNLAGTETRLVERADAI-------ATRLGDIGSRITMEL-----GSVE 1032

Query: 1292 KEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSL-NK 1350
                 +  V D          ++L A+L +  ++IT  + D+++ +   ++D+   L  +
Sbjct: 1033 AR---IAQVTDTTAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQ 1089

Query: 1351 VDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQ 1410
            ++E  H  T+R+      +   LA        +  D      ++ +Q ++ V   D  S+
Sbjct: 1090 LEEATHAATDRLRSENAALVNALA-------SRTADT-----IAAVQQAK-VGLSDNVSE 1136

Query: 1411 ILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSS--------EAQKFVMSI-LVD 1461
            ++    D L  +  E    +D    NL D+  RLV  ++         AQ F  S  L+D
Sbjct: 1137 LI----DRLAASNGELGKLIDAATRNLADIDGRLVDSTTSFVENTNRAAQMFQASTGLID 1192

Query: 1462 -------------VKKIVEQADFLSD--TVVKNMTDSIQSSFIKIDGTLSNIETRSRDTV 1506
                         + +I + AD   +   V+ + +D I S+    +G +S +E R     
Sbjct: 1193 SNLGTLRTLSDNTLSQIADIADRFEEHGKVLSSASDMINSAQ---NGLVSTLEER----- 1244

Query: 1507 RLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQ 1566
                       ++ +  + S  V   E    L       + S        F   E ++  
Sbjct: 1245 -----------HQALDKLASGLVDKSEGVEKLMQSFEALVASA-------FQRAEGQTRV 1286

Query: 1567 SMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESA 1626
            S +   +S+++ V+   QK S  +D+I  T+  I  +L+ +R  LKR  + +  EAKE+ 
Sbjct: 1287 SAEKMRESVSDIVEQAAQKFSAATDEIRRTASEIRAELDTTRGELKRGVLDMPAEAKETT 1346

Query: 1627 DTIRSAIEEQINTLKDFQKLITDS--------------VKNNAAS----YNKGLHSDEYN 1668
              +R A+ EQIN LK+  +++  S              V   AAS        + +    
Sbjct: 1347 TAMRKAVSEQINALKELAEIVNKSGRLVDVGEGRADRPVPRPAASRPVPVQAPVRAPIAP 1406

Query: 1669 ISQVD----KRP------SGKKTKNNHAIKEWFNKILSSSTH-------------SKGKS 1705
            ++Q D     RP          T +    + W + +L+ ++              +  +S
Sbjct: 1407 LAQADVAVRSRPVEAPNQKPAPTASAEKPRGWVSDLLARASREEEEAAQPKVQPAATPRS 1466

Query: 1706 SSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFL 1765
             SH+       + S++SL  +I++ ID++A V+LW  Y  GE ++F++RLYT+KGQ+ F 
Sbjct: 1467 PSHV-------VESLNSLSVDIARAIDHEASVELWDRYRRGERNVFTRRLYTLKGQQTFD 1519

Query: 1766 NLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASG 1825
            +++ +Y+ D   R A+DRY+ +F+ +L ++A+++ D+ + Q ++ S+ GKVYTML HASG
Sbjct: 1520 DIKRKYQTDGEFRRAVDRYMDDFQRLLEDVARNDRDNMVTQTYLTSDTGKVYTMLAHASG 1579

Query: 1826 R 1826
            R
Sbjct: 1580 R 1580



 Score =  177 bits (450), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 247/1126 (21%), Positives = 476/1126 (42%), Gaps = 187/1126 (16%)

Query: 108  SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
            S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210  SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164  RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
            RA++M +A++S+   AL+L+ PE  + +++ ++S AVR+E+  M E I+R ++RA ELE 
Sbjct: 267  RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLSQAVRREVAAMNEGIERTLARAVELET 326

Query: 224  TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
             V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE LKEELS  S
Sbjct: 327  LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLKEELSSAS 386

Query: 284  --------------------------------------------EEISVHLSRAIDSFQS 299
                                                         +I   ++ + ++F +
Sbjct: 387  NIIRDNVLSASQQLSALLGDSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
            ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447  LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
            GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507  GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420  DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567  DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
            L  R T  ++  ++   +++ + +  +   L+E  S LQ     NI  L   FAD   ++
Sbjct: 627  LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNISLLDASFADHARSL 685

Query: 514  EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
            E+   S    I  N      L ++ ++  + N ++    N E L  T    I SL+ +  
Sbjct: 686  EERTASLHNVIAGNQAILAQLMDERVAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572  ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                     L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742  ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620  QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHA-------- 671
                E TI      I  ++++ST +L   +      L +   SL N++   +        
Sbjct: 802  LDGHERTIETRAAEIRSTLTDSTASLSQTLQDHGEILEQRTTSLQNAIANSSAAISSAFE 861

Query: 672  --TDVVHKITNA-ENQL------VNRFDESSKNIICS--------YNSSNNKLETIFQKH 714
              T ++ + T   E  L      V R  E S  ++            S+         + 
Sbjct: 862  GQTGIIEERTETMEKALSIGVDNVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEA 921

Query: 715  LHSFNDTF---------------NNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
            L  F ++F                 ++D ++G L +    + D       R+ +     S
Sbjct: 922  LDGFGESFSARLIDNLSGTEARLGERADAIAGRLGDIESRLTDELGTIEARIADTAAKTS 981

Query: 760  ANIESELSAISKAMNKSIDDVET----ISTALKERCQELGSDLVNHSDKVLSSLKQAQEL 815
              + S   + S ++  ++   ET     + A+  R  ++GS +      V + + Q  + 
Sbjct: 982  ETLASHSESFSASVADNLAGTETRLVERADAIATRLGDIGSRITMELGSVEARIAQVTDT 1041

Query: 816  LCTTFAQR-------------------NDS---FVNALADNQSKFENNLVNQSHLLLDKL 853
               T  +R                   ND+    V  LAD+       L   +H   D+L
Sbjct: 1042 TAVTLEERTRELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRL 1101

Query: 854  SSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMS 913
             S+   L +   S+  D   ++   Q  VG++ +N S+ ++++++ASN  + K  +    
Sbjct: 1102 RSENAALVNALASRTADTIAAVQ--QAKVGLS-DNVSE-LIDRLAASNGELGKLIDAATR 1157

Query: 914  NILLSYDENRQTLDKKLS--DHIDVLRQNLAGSENKIDGAIGSASQF-------IRDILD 964
            N+    D + + +D   S  ++ +   Q    S   ID  +G+           I DI D
Sbjct: 1158 NL---ADIDGRLVDSTTSFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIAD 1214

Query: 965  --ENSSRIES----LLSCSNNSVNSTLLRSHQKFDRL---LQEKSDELIQLLDNKASCLS 1015
              E   ++ S    +++ + N + STL   HQ  D+L   L +KS+ + +L+ +  + ++
Sbjct: 1215 RFEEHGKVLSSASDMINSAQNGLVSTLEERHQALDKLASGLVDKSEGVEKLMQSFEALVA 1274

Query: 1016 TAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQEL 1061
            +A          + ++  +S+S +V+ +A  F   +D I+  A E+
Sbjct: 1275 SAFQRAEGQTRVSAEKMRESVSDIVEQAAQKFSAATDEIRRTASEI 1320


>gi|323137835|ref|ZP_08072910.1| hypothetical protein Met49242DRAFT_2298 [Methylocystis sp. ATCC
            49242]
 gi|322396838|gb|EFX99364.1| hypothetical protein Met49242DRAFT_2298 [Methylocystis sp. ATCC
            49242]
          Length = 2510

 Score =  177 bits (450), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 286/1478 (19%), Positives = 577/1478 (39%), Gaps = 257/1478 (17%)

Query: 76   PANDLDN--GGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYD 133
            PAND     G +   LQ I  N   +A+   F S  +W  C     + F+    +D+   
Sbjct: 73   PANDDRRTVGELRAALQ-IPPNRTIMAM--TFASIALWAVC-WTLYVYFHQGEILDADGS 128

Query: 134  FAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKM 193
                  V+TL  +V+  PI+  F   +M  RA +M   + S+  +A+RLI+PE  ++E++
Sbjct: 129  LLAPKPVLTLAALVA--PIVFLFITGLMARRAHEMRLIANSMTEVAIRLIEPETIATEQV 186

Query: 194  QSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQE 253
             S+S A+R+E   M + I+RA++RA ELE  VR+E+  LE +YT++E RI  +   L +E
Sbjct: 187  VSLSQAIRREAASMGDGIERALARAGELEVIVRTEVTNLERSYTENERRIRLLIDELTRE 246

Query: 254  REAIINHGTQLCTSIAEVHESLKEELSLTS----------------------EEISVHLS 291
            REAI+ +     T++    ++L +EL+ TS                      EEI + L 
Sbjct: 247  REAIVVNADNARTALFGARDALSQELAATSVHLAETVSEAGARVTSSLGSKGEEIKLALE 306

Query: 292  RAIDSFQS--------IVDV----------RIAKVTEKTTRIVQESAQTISSKIDQLLEV 333
            +A D+F++        ++ V          +IA  ++  TR   E  Q + SK+    E 
Sbjct: 307  KAGDTFEATLSSHGEKVIGVLSQTGDAVAQKIAGASDDVTRRFTEGVQEVGSKLQTAGEA 366

Query: 334  LHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFM 393
            L       + DF  R   +       G S A  +       G+  D++ + L E      
Sbjct: 367  L-------SVDFGVRGAGILERFEELGSSFAQSI-------GDQGDRLVVRLAETGGVIH 412

Query: 394  QAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDN 453
            +   +H   +    +E  + +   + + +++ + + +  E      +++T      E + 
Sbjct: 413  ETIATHGGALDRSLAETTERLAARVGEQIENAKATFESAETRITGLMETTHRKAHDEFEL 472

Query: 454  RTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNM 513
            R   L++ +T  L +        +      +    SE  S +  + D++    AD   N 
Sbjct: 473  RGQALQDALTRSLNQTSAALVEQVDAMQDRFVSVASEAVSAIGTHSDRVNETLADRLQNF 532

Query: 514  EDLFLSNIQTIG-----------SNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLT 562
            E L L+  + I            + L ++   FED + +   + +   + + +R+   LT
Sbjct: 533  ERLVLNRGEEIAERVTERGGQIEATLSERLAAFEDAVVRNSADAAMRVAEHGDRISTALT 592

Query: 563  NSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSH 622
              + + ++             G++ EE+ +       + +  +S+R   F +   R    
Sbjct: 593  EGLAAFEETF-----------GRQGEEVAARVVEHGDRAATTLSERLAAFEDVFTRKSEA 641

Query: 623  FEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAE 682
               ++A H      ++S    +  + +      +  + + +++  +A AT V  ++   E
Sbjct: 642  VASSVAEHGDRAAATVSARLADFEETMARRGEEV--AARVVEHGDRA-ATKVTEQLAAFE 698

Query: 683  NQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDD 742
            + +    DE +  ++       ++      +HL +F D+   +++ V             
Sbjct: 699  STVAAHGDELAARVV----EHGDRAAAFLTEHLVAFEDSVTRQTEEV------------- 741

Query: 743  LFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDV--------ETISTAL------- 787
                 A R+ +     ++ +  +++A    + +  DD+        E ++T L       
Sbjct: 742  -----ATRVAQHGERATSELSRQIAAFETTVARHGDDIAAKVAEQGERVTTVLTDRLSVF 796

Query: 788  ----KERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFV-----------NALA 832
                 +R  E+ S +  H D+  + + +       T A+  D               AL+
Sbjct: 797  EDIFTQRGHEVASRVSEHGDRAATKVAEQLAAFEQTVAEHGDELAARVSEHSERATTALS 856

Query: 833  DNQSKFENNLVNQSHLLLDKLSSDIQKLTD------IAYSKAI-----DVANSLTEIQGN 881
            +  + FE  +   S  L  ++S   ++ T        A+ +++     ++A  L+E QG+
Sbjct: 857  EQLAAFEQTVAAHSDELAARVSEHGERATTTLTEQLAAFGQSVASHGDELATRLSE-QGD 915

Query: 882  VGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNL 941
                    + A+ EK++A    VA+  +E  + +    +    TL +KL+       Q +
Sbjct: 916  ------RAAAAVTEKLAAFEQTVAQRSDELAARVSEQGERATTTLTEKLA----AFEQTV 965

Query: 942  AGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSD 1001
                N++   +    +     L E  +  E  +   ++++ +               +SD
Sbjct: 966  TQRSNQVAARVAQQGERAATTLSEKLAAFEQTVVERSDAIVA---------------RSD 1010

Query: 1002 ELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSL-SRVVDTSASSFKYLSDSIQTLAQE 1060
            E+   ++      +T ++ Q    E  +      L +RVV+    +   LSD +      
Sbjct: 1011 EIATRVNEHGERAATTITEQLAAFEQRVAAHSDELAARVVEHGERATATLSDGLALFED- 1069

Query: 1061 LVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRIS 1120
              S++G   +  T ++ + E +  +++Q+           I AF   +++    + K IS
Sbjct: 1070 --SILGKSEEVATRVAQQGEQAATTLSQR-----------IAAFTQAVARHSGDAAKLIS 1116

Query: 1121 QRTQEISQQLLQN-----------NDVITNQIIDSTSRVRGEIVDISNKFIET------- 1162
             + +E++    Q             D I+ +++D T+ V GE +       ET       
Sbjct: 1117 TKGEEVNAAFAQGLAAFEDTFVRQGDEISKRVVDQTT-VTGEELTARLAAFETAVQRANE 1175

Query: 1163 ---SRVLEQRE---EKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDV 1216
               +RV E+     E   S + SF D + R    V   +S H      L+++R+  ++  
Sbjct: 1176 ETAARVSEEGRRMAEALSSGVGSFEDAVKRHSESVSAVVSEHAKRVDDLLDERMTALETA 1235

Query: 1217 LSNLDRALESYGSTVFKQFKEYVQCFETNM------------ENMESLFDK---NNDSML 1261
               + + +E+      ++F+ + +    N+            EN E++ D+        +
Sbjct: 1236 GMQVAKTMETTRERALQEFEAHGEALRANLQESVTAAAAALAENSETMHDRFTTTATDAV 1295

Query: 1262 LSFKERSNILDNILSQRSMEISDS---------ISGAFHKEGNAVVNVIDQQIYNAANAL 1312
            L+   +   L   L +R     +S         +S A H  G  +   + QQ       L
Sbjct: 1296 LAIATQGERLTEFLGERLAAFENSMLEQGKDVVVSLADH--GERIATTLGQQ-------L 1346

Query: 1313 KKLEALLISDVEKITNRITDS----SQDVTTIISDATDSLNKVDERLHQTTNRITETTGH 1368
             + E  L+ D   I +R+       S+DV   ++   D +    E L Q   RI   T  
Sbjct: 1347 GQFERALLRDGGAIADRVAQHAARLSEDVAERLTVVEDVIGGHGEELVQ---RIAAQTQD 1403

Query: 1369 IDTVLAESSKLFEKKIKD-LGEISRVSLLQMSEIVSKF 1405
             D  ++  ++ F   + D L  I +    Q  E+V K 
Sbjct: 1404 ADARISAQAQKFVASVDDRLNAIDQTLTTQGGELVGKL 1441



 Score =  157 bits (397), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 326/1791 (18%), Positives = 698/1791 (38%), Gaps = 314/1791 (17%)

Query: 257  IINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIV 316
            +  HG +  T +AE   + ++ ++   +E++                R+++ +E+ T  +
Sbjct: 811  VSEHGDRAATKVAEQLAAFEQTVAEHGDELAA---------------RVSEHSERATTAL 855

Query: 317  QES----AQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTL 372
             E      QT+++  D+L       +  +++  +    +L+  L   G+S+A+       
Sbjct: 856  SEQLAAFEQTVAAHSDEL-------AARVSEHGERATTTLTEQLAAFGQSVASHGDELAT 908

Query: 373  MLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEK 432
             L    D+ + A+ E+   F Q       E++   SE+ +  T TL + L +   ++ ++
Sbjct: 909  RLSEQGDRAAAAVTEKLAAFEQTVAQRSDELAARVSEQGERATTTLTEKLAAFEQTVTQR 968

Query: 433  EDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVET--------------FNNSIT 478
             +   + +    +           TL  ++ AF + +VE                N    
Sbjct: 969  SNQVAARVAQQGERA-------ATTLSEKLAAFEQTVVERSDAIVARSDEIATRVNEHGE 1021

Query: 479  DFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGN------------MEDLFLSNIQTIGS 526
              ++   + L+ FE  +  + D+L     + HG              ED  L   + + +
Sbjct: 1022 RAATTITEQLAAFEQRVAAHSDELAARVVE-HGERATATLSDGLALFEDSILGKSEEVAT 1080

Query: 527  -----------NLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDML--- 572
                        L ++   F   +++   + +++ S   E +       + + +D     
Sbjct: 1081 RVAQQGEQAATTLSQRIAAFTQAVARHSGDAAKLISTKGEEVNAAFAQGLAAFEDTFVRQ 1140

Query: 573  -EEKRQRIDSDIGKKSEELCS---SFNSSYQKV----SNVISDREKLFSNSLARVQSHFE 624
             +E  +R+        EEL +   +F ++ Q+     +  +S+  +  + +L+     FE
Sbjct: 1141 GDEISKRVVDQTTVTGEELTARLAAFETAVQRANEETAARVSEEGRRMAEALSSGVGSFE 1200

Query: 625  ETIAGHPQSIVDSISNSTNNLYD----KIMVLAAALSESQKSLDNS-------LKAHA-- 671
            + +  H +S+   +S     + D    ++  L  A  +  K+++ +        +AH   
Sbjct: 1201 DAVKRHSESVSAVVSEHAKRVDDLLDERMTALETAGMQVAKTMETTRERALQEFEAHGEA 1260

Query: 672  --TDVVHKIT--------NAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDT 721
               ++   +T        N+E  + +RF  ++ + + +  +   +L     + L +F ++
Sbjct: 1261 LRANLQESVTAAAAALAENSET-MHDRFTTTATDAVLAIATQGERLTEFLGERLAAFENS 1319

Query: 722  FNNKSDHVSGILKNSTQHIDDLFSNNAKRMEE-LLHSGSANIESELSAISKAMNKSIDDV 780
               +   V   L +  + I         + E  LL  G A  +     +++   +  +DV
Sbjct: 1320 MLEQGKDVVVSLADHGERIATTLGQQLGQFERALLRDGGAIADR----VAQHAARLSEDV 1375

Query: 781  ETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFEN 840
                T +++     G +LV      +++  Q  +   +  AQ+   FV ++ D  +  + 
Sbjct: 1376 AERLTVVEDVIGGHGEELVQR----IAAQTQDADARISAQAQK---FVASVDDRLNAIDQ 1428

Query: 841  NLVNQSHLLLDKLSSDI----QKLTDIA--YSKAIDVA-NSLTEIQGNVGVTLENHSQAM 893
             L  Q   L+ KLS+ +     ++ D +  +++ ID   ++L E       T+     A+
Sbjct: 1429 TLTTQGGELVGKLSAQVDYFSSRIGDNSKHFAEEIDARLSALDE-------TMTTKGGAL 1481

Query: 894  LEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIG 953
            +++ISA   L A    +   +     D     LD+ ++ H   + + LA   +     +G
Sbjct: 1482 VDRISAQADLYASRIGDNSKHFADEIDARLNALDEVMTKHGGAIVERLAAQASDYAARVG 1541

Query: 954  SASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASC 1013
             +S+ +   ++E    ++  ++  + ++   L      +   + E S +L + +D+K   
Sbjct: 1542 QSSKQLAAEIEEKVGALDQAMTTQSGALVEKLTAQADDYAARIGETSKQLAEQIDSKMGA 1601

Query: 1014 LSTAVSTQTINLENNLKEQEKSLS-RVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQST 1072
            +  AV+TQ   L N L +Q    + R+  TS    K L++ I T        +G++ Q+ 
Sbjct: 1602 IDQAVTTQGGALVNRLAQQVNQFAARIGATS----KQLTEEIDTR-------LGAIDQAM 1650

Query: 1073 TDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQ 1132
                G L   +D +  ++ +     GDN   F  EI   +E  ++ IS R  ++  +L  
Sbjct: 1651 NTQGGAL---VDRIATQVDQVVGRIGDNSKHFASEIDAKLETIDQAISVRGGKLVSELDA 1707

Query: 1133 NNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVD 1192
                  +++ +   R+     D+S K     R +  +  +    L + +        D+ 
Sbjct: 1708 TTVAAFSRLGEQAERLSS---DVSAKLDAIDRTIGAKGGELVEKLGARA-------ADIA 1757

Query: 1193 HTISSHTNESRSLIEQRIHEVKD----VLSNLDRALESYGS----TVFKQFKEYVQCFET 1244
             T+SS      S+ E R  E  D    ++ ++D  L + G     ++ K   +  +    
Sbjct: 1758 ATMSSKIETFESVSETRTKETADRIEALVKHMDAGLGAGGQKLQESLAKHALDVARVMGD 1817

Query: 1245 NMENMESLFD---KNNDSMLLSFKERSNILDNILSQRSMEISDSISGA------------ 1289
                +    D   K+ DS+LLS   RS+ L   L+ ++ EI+D++ G             
Sbjct: 1818 GGREIVGSLDAKLKDVDSVLLS---RSSELAQTLAAKATEINDTLGGRAKELENTLDGRI 1874

Query: 1290 --FHK---------------EGNAVVNVIDQQIYNA----ANALKKLEALLISDVEKITN 1328
              F K                G  V+  I  ++ +     A A ++L+A L +    +  
Sbjct: 1875 ELFEKNVVDRLGAVSTEIDQRGRQVIETIGARLEDINQTLAGARRELDATLHARTGDLGK 1934

Query: 1329 RITDSSQDVTTIISDA-TDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDL 1387
             +T+   +++  + +  T     +DERL    + + E  G +   L    +L  K I+  
Sbjct: 1935 TLTERVMEISGALDERLTQIQGALDERLENIKSTLGERGGDVTRELTSVGELVAKAIESR 1994

Query: 1388 GEI------------------SRVSLLQ---------MSEIVSKFDKNSQILIKSHDSLM 1420
            G                    SR +L Q         +S +++  DK    L    D L 
Sbjct: 1995 GAAIVRHLGDKREELTQALDQSREALSQTLDAGAQSSISALIAMNDKIRSELPPVLDKLG 2054

Query: 1421 KAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKN- 1479
            +  +  +  +DK   NLV+L   L  + SE  + +     DV   V+Q   +S   +++ 
Sbjct: 2055 QTNTSLQAIIDKTGGNLVNLERELGKRLSEFNEAIN----DVSGQVQQLSAVSGGTMRDA 2110

Query: 1480 -------------MTDSIQ---SSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKT--- 1520
                         +T S Q    S   +D      +    + V ++D   A+        
Sbjct: 2111 HVIVDALEERQQALTQSAQKLAESQKALDAAFDERQRSLEELVSMLDGKRAEFERGMSGF 2170

Query: 1521 VKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSD-------QSMQVFLD 1573
             + ++  F  ++ +S D+   + +    T   +E  F+ + E ++       ++MQ    
Sbjct: 2171 SEMMEEAFHAIEARSRDIGGVLTETTQQTAHIVEERFAQVREAAEGERQQTAEAMQAAFA 2230

Query: 1574 SLNNKVDSF----TQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTI 1629
              N+++       T K    + +I   SR I  ++  +R+ ++R +  L +E  E A  +
Sbjct: 2231 QANSEMSRLFSEATAKFQAAASEIRGLSREIHREIEETREEVRRGATELPRETAEQAAAL 2290

Query: 1630 RSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKKT-------- 1681
            R  + +Q+  L +   ++  S +              Y+I++     + ++T        
Sbjct: 2291 RRVVGDQVKALNELTDIVARSGRV-------------YDIAEQAPPVAPRRTFEAAPRVE 2337

Query: 1682 --------------------KNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDS----- 1716
                                    A   W + +L+ ++  +  +S     +         
Sbjct: 2338 PPKPRVAPPPSPAPVQRASEPQRDAQGGWLSDLLARASREEAPASQAAPQAPARPARQPN 2397

Query: 1717 LSSIDSLVENISKFIDYDAFVQLWKSYTLGE-DDIFSKRLYTIKGQKVFLNLQEQYKADS 1775
              ++D+L  +I++ +D  A  +LW+ Y  GE   +F +RLYT +G + F  ++ +Y+ D 
Sbjct: 2398 AGALDNLTLDIARMVDGPAVTELWRRYQRGEKGGLFGRRLYTAQGHQTFEEIRRRYRVDP 2457

Query: 1776 ALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
              R  +D YI +FE++L E ++ + D     + +  + GKV+TML HA+GR
Sbjct: 2458 EFRATVDHYIRHFEDLLVETSRGDRDGTKALDLLTGDAGKVFTMLGHAAGR 2508


>gi|315122600|ref|YP_004063089.1| chemotaxis sensory transducer [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496002|gb|ADR52601.1| chemotaxis sensory transducer [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 168

 Score =  177 bits (449), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 88/167 (52%), Positives = 115/167 (68%), Gaps = 9/167 (5%)

Query: 1   MSNKKENKATYRDSLKEFEEQSTSDSHENKKRHHSRKKHKYSRRDDSIESKDRQQTTLS- 59
           M+NKK++K  YR SLKE EE S     ++KK + ++  +  +++++ +  KD Q T+ S 
Sbjct: 1   MNNKKQSKTAYRKSLKEHEELSMLKPDKDKKNYQAKDTYDRNQKNNHLPDKDIQSTSGSE 60

Query: 60  --------KNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIW 111
                   K FK+ SNK   SG  PANDL +GGITHILQNIGKNSL+IALRNAF+SSL+W
Sbjct: 61  DMKNTNAEKTFKRISNKYLSSGLSPANDLSSGGITHILQNIGKNSLSIALRNAFISSLVW 120

Query: 112 LACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSF 158
            ACELGF++K Y NS M SFYDFA+R E I  F  ++ +PILLFF F
Sbjct: 121 FACELGFIVKSYANSSMPSFYDFAIRTEAIIFFSAITFIPILLFFRF 167


>gi|260459101|ref|ZP_05807356.1| kinesin-like protein [Mesorhizobium opportunistum WSM2075]
 gi|259034655|gb|EEW35911.1| kinesin-like protein [Mesorhizobium opportunistum WSM2075]
          Length = 873

 Score =  173 bits (439), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 125/511 (24%), Positives = 240/511 (46%), Gaps = 72/511 (14%)

Query: 53  RQQTTLSKNFKQASNKQT-YSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIW 111
           R   T + N  QA+   T  +GF PAND        +L ++ + + N         SL W
Sbjct: 87  RPVETRNGNGTQATGFGTQATGFAPANDDRQKDYKTLLHSLNRRASNTVYWVIAFVSLAW 146

Query: 112 LACELG-----FLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRAR 166
           +A   G     F    +    +D F+    RPE+I L  V ++VP++LF++F  MI RA+
Sbjct: 147 IAGAGGLANLLFGPSIWRIRTLDQFF---ARPELIGLA-VAAIVPVILFWAFAAMIRRAQ 202

Query: 167 DMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVR 226
           DM  A+QS+  +A RL +PE  + +++  I  AVR+E+  M E I+R ++RA ELE  V 
Sbjct: 203 DMRIAAQSMTEVAFRLTEPENLAQDRVMMIGQAVRREVAAMGEGIERTLARAVELETLVH 262

Query: 227 SEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS--- 283
           SE+  +E +Y+++E RI ++   L  EREA++ H  ++  SI+  HE+LKEE+   S   
Sbjct: 263 SEVNQIERSYSENETRIRSLVDGLGSEREAVVTHAERVRASISGAHETLKEEIGAASDII 322

Query: 284 -----------------------------------------EEISVHLSRAIDSFQSIVD 302
                                                    + I+  LS + ++F S++D
Sbjct: 323 RDSILNASTKLSMTITNSGDTLIDRINESSMSIFDSVEGRLDTITDRLSTSGEAFASLLD 382

Query: 303 VRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRS 362
            RIAK+T+ T  + +     +  +   ++ +L   +  +  +F+  +  +  TL   G++
Sbjct: 383 TRIAKLTDTTDGLTRSLTDLLDDRTTGMVSLLGGAARTLNSEFEASLNGIERTLAERGQA 442

Query: 363 LANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN--- 419
           L ++       L   T K++ AL+ +++Q  +       E+++ F+E + +++  ++   
Sbjct: 443 LISEFQTRAEALDTGTQKLNAALEARARQINETLVERAREIAHTFAESKDTLSAMIDQGK 502

Query: 420 --------DVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLEN-RITAFLKEIV 470
                   D++ S    L+ +   F   +++      R  D+    L + R+   ++E V
Sbjct: 503 TQIGADMADIVNSTSTMLEARASDFAGRMEAARHVVSRSFDSDIQRLSDARVG--IEEAV 560

Query: 471 ETFNNSITD----FSSFYKDNLSEFESNLQG 497
           E  +  +++     ++  + +L++F+ +  G
Sbjct: 561 ENHSRKLSESRERMAAAMEADLAKFDESRAG 591


>gi|158423842|ref|YP_001525134.1| putative transmembrane protein [Azorhizobium caulinodans ORS 571]
 gi|158330731|dbj|BAF88216.1| putative transmembrane protein [Azorhizobium caulinodans ORS 571]
          Length = 2385

 Score =  173 bits (439), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 272/1411 (19%), Positives = 569/1411 (40%), Gaps = 199/1411 (14%)

Query: 77   ANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTN----SPMDSFY 132
            AND D   I  +L  + + S       A + S++W+   +G  +   T     S + S  
Sbjct: 84   AND-DRQTIGQLLAALQRRSSPAPYWWALIGSVVWMG--IGVALALATQRAAISDISSLQ 140

Query: 133  DFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEK 192
                 P ++ +   + ++P + FF    ++ R RD+   ++++  +ALRL  PE   +E 
Sbjct: 141  GVIESPLLLAIIAGI-ILPPVGFFGTASVVRRTRDLQLIARAMTEVALRLAQPEAIGTEA 199

Query: 193  MQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQ 252
            + S+  AVR+E+  M E +DR I+RA+ELE  VRSE+ +LE  Y ++E+RI N+   L+ 
Sbjct: 200  VVSVGQAVRREVAAMGEGVDRTIARAAELETVVRSEVSLLERAYEENELRIRNLIDELQA 259

Query: 253  EREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKT 312
            ER+ I+ H  +L   I +  + L  ++   +E ++  +S A D   S+ + R A +T + 
Sbjct: 260  ERQNILIHSERLREGIVDADKLLAHDVKDIAERVNASVSGAADRITSLFEERSAAITGEL 319

Query: 313  TRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTL 372
            +RI +     IS+K  +L++ L +T   I  D                            
Sbjct: 320  SRIGETVIGAISAKGSELIDRLETTGAEIRGD---------------------------- 351

Query: 373  MLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEK 432
             L  ++D VS ALK ++    Q   +   E++       + + V  +   ++L  +L E 
Sbjct: 352  -LTRSSDAVSAALKSRTDDLAQNLAASTAEVTELVGRWSEDVRVNADTARETLIQALVE- 409

Query: 433  EDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFE 492
                 S L                 + + +T    E+  TF ++         +   E  
Sbjct: 410  ----SSAL-----------------VHDELTVRAAEVNSTFRSTAESVVYELSNRGGELI 448

Query: 493  SNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSM 552
              +Q   +++    A   G++ D     I+  GS + +   +  ++L ++ ++ +     
Sbjct: 449  RKVQDTGERVAETIAQRGGDIAD----RIEITGSRIHEDVTVRGEVLQQQLSDTA----- 499

Query: 553  NTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLF 612
              ER+   L  +  ++ D L  K   I + + + + E+   F+     V+NV+  + + F
Sbjct: 500  --ERVAEALERTSAAVTDALAVKGDEIAASLTQTANEMSERFDGIASDVNNVMGSQGEAF 557

Query: 613  SNS-----------LARVQSHFEETIAGHPQSIVDSISNSTNNLYDKI----MVLAAALS 657
            +N+           L       E+ +     ++ ++IS     L D++     ++A A+ 
Sbjct: 558  NNAFRLNADQMVATLGTNSEALEQMLTSRLSALDEAISVRGFALADRVGQDSALVAKAIH 617

Query: 658  ESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICS-------YNSSNNKLETI 710
            +S  + D S++  A ++V        QL +R +  S+ +            ++   + T+
Sbjct: 618  DSITAFDASIREDAPELVA-------QLADRIEAVSETLGTKLSDLDSRLGATGETVATV 670

Query: 711  FQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLH--SGS--------- 759
            F   +    +T + +S  ++ +++       ++ S   +   E L   SG+         
Sbjct: 671  FDTRIAKVEETLSGRSGDLAALIEQRATEFAEVMSEGTRVATEALEQTSGALSSTLDERL 730

Query: 760  ANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSS-----LKQAQE 814
            A IE  LS     +  +I+      TA         ++ +  +   LSS     L   ++
Sbjct: 731  AKIEETLSVRGGELTATIERQAADFTAAMSDGTRAATEALEQTSGALSSTLDERLAGIED 790

Query: 815  LLCT-------TFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSK 867
            LL T          QR   F  A+++        L + S  L   L   + ++ +   ++
Sbjct: 791  LLSTRGSELTAAIEQRATDFTAAMSEGTRAATEALEHTSGALSVALDERLSQVEETLAAR 850

Query: 868  AIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLD 927
            + ++  ++ +        +   ++A  E +  ++  ++ T +E +S I L+     + + 
Sbjct: 851  SGELTAAIEQRAAEFAQAMSEGTRAATEALEQTSDALSSTLDERLSRIELALTAGTEAVA 910

Query: 928  KKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLR 987
            + +    D   Q +A        A    ++ I + +D+   RIE  L     S+   L  
Sbjct: 911  QSIDGRADAFVQAVAEGTRVSQDAFDQTAETIVNAIDQRLVRIEETLDERARSLTEALQE 970

Query: 988  SHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSF 1047
                FDR++ E +     L +  +  ++ AV  +  +LE            V+DT A   
Sbjct: 971  RAMDFDRVVSEATSSATTLFEQTSGTVANAVEQRLAHLEQ-----------VIDTRA--- 1016

Query: 1048 KYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDE 1107
            + L++++   AQ+      S+S++T  +S   E +  SV   I    E  G  I    DE
Sbjct: 1017 RTLTEALHARAQDFNR---SVSEATGSVSEVFEQNSTSVAALID---ERLG-QIEQLFDE 1069

Query: 1108 ISKVMEISE----KRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETS 1163
             ++ +E       K +++ T+E +    +  +++T                I  +     
Sbjct: 1070 RTQGLETRAQDFTKAMTESTREAATAFEETGELVTTV--------------IQERLAHVE 1115

Query: 1164 RVLEQREEKFHSALD----SFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLS- 1218
            +VL +R +   S LD    +F++ +     D +      +    + I +R+ +++ VL  
Sbjct: 1116 QVLSERTDSLTSTLDGRASAFAEAVENSTRDANAAFEQTSQAVANAIGERLGQIEQVLDE 1175

Query: 1219 ---NLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNIL 1275
               +L + +E+ G       + + +    +     S F++ ++++  +  E+   ++ +L
Sbjct: 1176 RTVSLTQMIETRG-------EAFARAVADSSREANSAFEQTSNAVAAAIGEKLGQIEQVL 1228

Query: 1276 SQRS------------------MEISDSISGAFHKEGNAVVNVIDQQIYNAANAL----K 1313
             +R+                   E S   + AF +  NAV   I  ++      L    K
Sbjct: 1229 DERTHSLTQMIETRGEAFARAVAESSREANSAFEQTSNAVAAAIGDRLTQIEQVLDERAK 1288

Query: 1314 KLEALLISDVEKITNRITDSSQDVTTIISDATDSLNK-VDERLHQTTNRITETTGHIDTV 1372
             L   L S   +    +T+S+Q+ T       ++++  +D+RL +    + E   ++   
Sbjct: 1289 SLTGALESRASEFARVVTESTQNATHTFEQTGEAVSASIDQRLGEIERTLDERARNLTET 1348

Query: 1373 LAESSKLFEKKIKDLGEISRVSLLQMSEIVS 1403
            L   +  F + + +   ++  +  Q SE V+
Sbjct: 1349 LETRAADFTRAVSEGTRLASEAFEQTSEAVT 1379



 Score =  118 bits (295), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 78/110 (70%)

Query: 1717 LSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSA 1776
            + S+DSL  +I++ ID+DA V+LW+ Y  GE ++F++RLYT++GQ+ F  L+ +Y+ D+ 
Sbjct: 2274 IESLDSLSVDIARMIDHDAAVELWERYKRGERNVFTRRLYTMQGQQAFEELRRKYRTDAE 2333

Query: 1777 LRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
                +DRYI+ F+ +L ++A  +  + L + ++ S+ GKVYTML HA+GR
Sbjct: 2334 FHETVDRYIAEFDRLLEQVAADDRGNVLTKTYLTSDTGKVYTMLAHAAGR 2383



 Score = 58.9 bits (141), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 222/1278 (17%), Positives = 489/1278 (38%), Gaps = 185/1278 (14%)

Query: 321  QTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRS------LANQVGNYTLML 374
            +T+ +K+  L   L +T   +   FD RI  +  TL  SGRS      +  +   +  ++
Sbjct: 647  ETLGTKLSDLDSRLGATGETVATVFDTRIAKVEETL--SGRSGDLAALIEQRATEFAEVM 704

Query: 375  GNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKED 434
               T   + AL++ S          + ++    S +   +T T+         ++ +   
Sbjct: 705  SEGTRVATEALEQTSGALSSTLDERLAKIEETLSVRGGELTATIERQAADFTAAMSDGTR 764

Query: 435  SFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESN 494
            +    L+ T+      +D R   +E+ ++    E+        TDF++   +        
Sbjct: 765  AATEALEQTSGALSSTLDERLAGIEDLLSTRGSELTAAIEQRATDFTAAMSEGTRAATEA 824

Query: 495  LQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNT 554
            L+     L     +    +E+   +    + + ++++   F   +S+        T   T
Sbjct: 825  LEHTSGALSVALDERLSQVEETLAARSGELTAAIEQRAAEFAQAMSEG-------TRAAT 877

Query: 555  ERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN 614
            E LE T     ++L   L+E+  RI         EL     +  + V+  I  R   F  
Sbjct: 878  EALEQT----SDALSSTLDERLSRI---------ELA--LTAGTEAVAQSIDGRADAFVQ 922

Query: 615  SLA---RV-QSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAH 670
            ++A   RV Q  F++T     ++IV++I         +++ +   L E  +SL  +L+  
Sbjct: 923  AVAEGTRVSQDAFDQTA----ETIVNAIDQ-------RLVRIEETLDERARSLTEALQER 971

Query: 671  ATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVS 730
            A D    ++ A +     F+++S  +  +       LE +      +  +  + ++   +
Sbjct: 972  AMDFDRVVSEATSSATTLFEQTSGTVANAVEQRLAHLEQVIDTRARTLTEALHARAQDFN 1031

Query: 731  GILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKER 790
              +  +T  + ++F  N+  +  L       I+  L  I +  ++    +ET       R
Sbjct: 1032 RSVSEATGSVSEVFEQNSTSVAAL-------IDERLGQIEQLFDERTQGLET-------R 1077

Query: 791  CQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLL 850
             Q+    +   + +  ++ ++  EL+ T   +R                  L +   +L 
Sbjct: 1078 AQDFTKAMTESTREAATAFEETGELVTTVIQER------------------LAHVEQVLS 1119

Query: 851  DKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEE 910
            ++  S    L   A + A  V NS      +     E  SQA           VA    E
Sbjct: 1120 ERTDSLTSTLDGRASAFAEAVENSTR----DANAAFEQTSQA-----------VANAIGE 1164

Query: 911  CMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRI 970
             +  I    DE   +L + +    +   + +A S  + + A    S  +   + E   +I
Sbjct: 1165 RLGQIEQVLDERTVSLTQMIETRGEAFARAVADSSREANSAFEQTSNAVAAAIGEKLGQI 1224

Query: 971  ESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLK 1030
            E +L    +S+   +    + F R + E S E     +  ++ ++ A+  +   +E  L 
Sbjct: 1225 EQVLDERTHSLTQMIETRGEAFARAVAESSREANSAFEQTSNAVAAAIGDRLTQIEQVLD 1284

Query: 1031 EQEKSLSRVVDTSASSF-KYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQK 1089
            E+ KSL+  +++ AS F + +++S Q           ++S S     G++E +LD   + 
Sbjct: 1285 ERAKSLTGALESRASEFARVVTESTQNATHTFEQTGEAVSASIDQRLGEIERTLDERARN 1344

Query: 1090 IQKCREFFGDNIVAFMDEISKVM-----EISEK---RISQRTQEISQQLLQNNDVITNQI 1141
            + +  E    +    + E +++      + SE     + QR   I Q L Q    IT  +
Sbjct: 1345 LTETLETRAADFTRAVSEGTRLASEAFEQTSEAVTITLDQRLGRIEQTLEQRTQSITETL 1404

Query: 1142 IDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLD--------VDH 1193
             + T       VD++    + S+ + Q  +   S LD++  + S+ + +        V  
Sbjct: 1405 ANRT-------VDLARAITDGSQSVSQALDHSMSTLDTYFASRSKAIGELIASRAESVSE 1457

Query: 1194 TISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLF 1253
             I +  N+  + ++ R+  ++D+++                            EN+  L 
Sbjct: 1458 AIGARANDIAATLDGRVQRIEDLVTG-------------------------RFENISGLI 1492

Query: 1254 DKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALK 1313
            ++   S+  +   R   +   L   + EI  S++G     G      ++ Q    A  L+
Sbjct: 1493 EERGLSVADTLATRIEAVTGQLRTGADEIEQSLNGLADNVGR----TLNAQAEGVAATLR 1548

Query: 1314 ----KLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHI 1369
                ++E  L +  E +   +T  ++ VT  +   T + ++++  L    +++  T G  
Sbjct: 1549 TSAGQVEFSLTNLSENVGRALTSQAEQVTGTL---TTNASEMERSLTTLADQVGRTIGTK 1605

Query: 1370 DTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSK--FDKNSQILIKSHDSLMKAQSETK 1427
                AE+ K    +I+        S+  +++ V +    K +Q    + ++L  + SE +
Sbjct: 1606 AAQAAETLKTSSSEIEQ-------SIGSLADSVGRTIGTKAAQ----AAETLKTSSSEIE 1654

Query: 1428 LSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSS 1487
             S+     +L D   R  S  ++A+   +++     ++ ++ +  +D V + ++   +++
Sbjct: 1655 QSI----GSLADTIGR--SIGTQAELVTIALRSGAGEVEDRINAAADNVTRALSTRAEAA 1708

Query: 1488 FIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKIC 1547
               +     +++ R       I   L D  ++ + T+      ++E+   L         
Sbjct: 1709 VAVLQNGTGDLDGRLSALAEQITRTLTDRTDRAITTLRIGASDVEERVERL--------- 1759

Query: 1548 STIPNIENIFSTLEEKSD 1565
                 I+N+ ST+  ++D
Sbjct: 1760 -----IQNVASTMTGQAD 1772


>gi|261314249|ref|ZP_05953446.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261303275|gb|EEY06772.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
          Length = 1393

 Score =  166 bits (421), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 150/626 (23%), Positives = 285/626 (45%), Gaps = 96/626 (15%)

Query: 108 SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
           S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 210 SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 266

Query: 164 RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
           RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 267 RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 326

Query: 224 TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
            V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 327 LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 386

Query: 284 --------------------------------------------EEISVHLSRAIDSFQS 299
                                                        +I   ++ + ++F +
Sbjct: 387 NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 446

Query: 300 IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
           ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 447 LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 506

Query: 360 GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
           GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 507 GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 566

Query: 420 DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
           D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 567 DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 626

Query: 458 LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
           L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 627 LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 685

Query: 514 EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
           E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 686 EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 741

Query: 572 ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                    L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 742 ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 801

Query: 620 QSHFEETIAGHPQSIVDSISNSTNNL 645
               E+TI      I  ++++ST +L
Sbjct: 802 LDGHEQTIETRAAEIRSTLTDSTASL 827



 Score = 93.2 bits (230), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 224/1084 (20%), Positives = 447/1084 (41%), Gaps = 200/1084 (18%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 323  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 371

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 372  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 430

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 431  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 468

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 469  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 528

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 529  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 588

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 589  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 643

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 644  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 700

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 701  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 760

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 761  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 816

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 817  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 872

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 873  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 924

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 925  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 970

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 971  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 1005

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 1006 LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1051

Query: 1270 ILDNILSQRSMEI---------------SDSISG-------AFHK-------EGNAVVNV 1300
             L+ +L+ RS EI               +DS  G       A H        E  A+VN 
Sbjct: 1052 ELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRSENAALVNA 1111

Query: 1301 IDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTN 1360
            +  +      A+++ +  L  +V ++ +R+  S+ ++  +I  AT +L  +D RL  +T 
Sbjct: 1112 LASRTAETIAAVQQAKVGLSDNVSELIDRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1171

Query: 1361 RITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLM 1420
               E T     +   S+ L +  +  L  +S  +L Q+++I  +FD++ ++L  + D + 
Sbjct: 1172 SFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADRFDEHGKVLSSASDMIN 1231

Query: 1421 KAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNM 1480
             AQ+    +LD+    L  L S LV KS   +K + S    V    ++A+  +    + M
Sbjct: 1232 SAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVASAFQRAEGQTRVSAEKM 1291

Query: 1481 TDSI 1484
             +S+
Sbjct: 1292 RESV 1295


>gi|254706782|ref|ZP_05168610.1| hypothetical protein BpinM_07290 [Brucella pinnipedialis
           M163/99/10]
          Length = 1368

 Score =  166 bits (421), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 150/626 (23%), Positives = 285/626 (45%), Gaps = 96/626 (15%)

Query: 108 SLIWLACELGFLIKFYTN----SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMIS 163
           S++W A   G  I    N    S + +  DF   P  + +   V++ PI +F+ F  ++ 
Sbjct: 185 SVLWAAG--GVAISKAINPEVFSSLQATKDFFTAPAGLGVVAGVAL-PIAMFWGFAQLVK 241

Query: 164 RARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEK 223
           RA++M +A++S+   AL+L+ PE  + +++ ++  AVR+E+  M E I+R ++RA ELE 
Sbjct: 242 RAQEMQNAARSMTDAALKLLQPEAVAGDRVSTLGQAVRREVAAMNEGIERTLARAVELET 301

Query: 224 TVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS 283
            V+SE+  LE  Y+ +E+RI ++  +L  EREA+++H  ++ +SI+  HE L+EELS  S
Sbjct: 302 LVQSEVNQLERAYSDNEVRIRSLVSDLGNEREAVVSHAERVRSSISGAHEQLREELSSAS 361

Query: 284 --------------------------------------------EEISVHLSRAIDSFQS 299
                                                        +I   ++ + ++F +
Sbjct: 362 NIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRTGDIGNRITTSGEAFAN 421

Query: 300 IVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNS 359
           ++D RIA + E++  I  +  Q +  +   +  VL S +  +  +FD R+ +L NTL++ 
Sbjct: 422 LLDTRIATLDEQSRTISGKLTQALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDR 481

Query: 360 GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN 419
           GRSL  +       L N+T+K++ AL+ +S+Q  +   +   E++  FS  + S+   ++
Sbjct: 482 GRSLLAEFEARAHALDNSTEKLNAALETRSRQINENLIARTREIAETFSGGRNSLGAMVD 541

Query: 420 DV-------LQSLRIS---------------LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
           D+       L S+  S               L E  D   + L+  T+     +    +T
Sbjct: 542 DIKVKIGDDLTSISESVGNVLIDKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHADT 601

Query: 458 LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQ----GNIDKLQGCFADSHGNM 513
           L  R T  ++  ++   +++ + +  +   L+E  S LQ     N+  L   FAD   ++
Sbjct: 602 LAAR-TGDIQNAIDASASALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFADHARSL 660

Query: 514 EDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM-- 571
           E+   S    I  N      L ++  +  + N ++    N E L  T    I SL+ +  
Sbjct: 661 EERTASLHNVIAGNQAMLAQLMDERAAAMRENFNE----NREVLARTFDERIGSLQSLIA 716

Query: 572 ---------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSN---SLARV 619
                    L+E+ + +   +G   +   ++     + V    S  + + +N   +LA V
Sbjct: 717 ENQSALERILDERARNMAESLGAGRDAFETALGEHVRTVEERTSGLQAVLNNHNDALAHV 776

Query: 620 QSHFEETIAGHPQSIVDSISNSTNNL 645
               E+TI      I  ++++ST +L
Sbjct: 777 LDGHEQTIETRAAEIRSTLTDSTASL 802



 Score = 92.0 bits (227), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 224/1084 (20%), Positives = 447/1084 (41%), Gaps = 200/1084 (18%)

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            E E+ +Q  +++L+  ++D+           I+++ S+L  +    E ++S  +   S I
Sbjct: 298  ELETLVQSEVNQLERAYSDNE--------VRIRSLVSDLGNER---EAVVSHAERVRSSI 346

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
            +  + E+L   L+++ N ++D +    Q++ + +G   E L S+ N S   +++ I  R 
Sbjct: 347  SGAH-EQLREELSSASNIIRDNVLSASQQLSALLGGSGERLISNINESGGAIADAIEKRT 405

Query: 610  KLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKS----LDN 665
                N +      F                    NL D  +   A L E  ++    L  
Sbjct: 406  GDIGNRITTSGEAFA-------------------NLLDTRI---ATLDEQSRTISGKLTQ 443

Query: 666  SLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSF------- 718
            +L    T + + + +A   +V+ FD    N+  + +     L   F+   H+        
Sbjct: 444  ALDERTTGIANVLGSATQTMVSEFDTRLANLENTLSDRGRSLLAEFEARAHALDNSTEKL 503

Query: 719  NDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-NKSI 777
            N     +S  ++  L   T+ I + FS     +  ++      I  +L++IS+++ N  I
Sbjct: 504  NAALETRSRQINENLIARTREIAETFSGGRNSLGAMVDDIKVKIGDDLTSISESVGNVLI 563

Query: 778  DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSK 837
            D        L E    L + L   +++V S ++   +    T A R     NA+ D  + 
Sbjct: 564  DKAAAFEGKLAESRDLLAATLEGETERVSSVIRGHAD----TLAARTGDIQNAI-DASAS 618

Query: 838  FENNLVNQSHLLLDKLSSDIQK-------LTDIAYSKAIDVANSLTE--------IQGNV 882
              N + ++   +L + +S +Q+       L D +++   D A SL E        I GN 
Sbjct: 619  ALNEVTDKHAAILAERTSALQQAMSSNVSLLDASFA---DHARSLEERTASLHNVIAGNQ 675

Query: 883  GVT---LENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQ 939
             +    ++  + AM E  + +  ++A+TF+E + ++     EN+  L++ L +    + +
Sbjct: 676  AMLAQLMDERAAAMRENFNENREVLARTFDERIGSLQSLIAENQSALERILDERARNMAE 735

Query: 940  NLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS------------------V 981
            +L    +  + A+G   + +R + +E +S ++++L+  N++                  +
Sbjct: 736  SLGAGRDAFETALG---EHVRTV-EERTSGLQAVLNNHNDALAHVLDGHEQTIETRAAEI 791

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVST-----------QTINLENNLK 1030
             STL  S     + LQ+      ++L+ + + L  A++            QT  +E   +
Sbjct: 792  RSTLTDSTASLSQTLQDHG----EILEQRTTSLQNAIANSSAAISSAFEGQTGIIEERTE 847

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
              EK+LS  VD   +  + L  S   +A +L   IG  + +    + K   +LD      
Sbjct: 848  TMEKALSIGVD---NVRRALEQSAGVVAGKLREKIGEAASTLAAEAAKAGEALDG----- 899

Query: 1091 QKCREFFGDNIVA-FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
                  FG++  A  +D +S     +E R+ +R   I+ +L    D I +++ D    + 
Sbjct: 900  ------FGESFSARLIDNLSG----TEARLGERADAIAGRL---GD-IESRLTDELGTIE 945

Query: 1150 GEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQR 1209
              I D + K   TS  L    E F +   S +DN++                     E R
Sbjct: 946  ARIADTAAK---TSETLASHSESFSA---SVADNLAGT-------------------ETR 980

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + E  D ++     L   GS +  +             ++E+   +  D+  ++ +ER+ 
Sbjct: 981  LVERADAIATR---LGDIGSRITMELG-----------SVEARIAQVTDTTAVTLEERTR 1026

Query: 1270 ILDNILSQRSMEI---------------SDSISG-------AFHK-------EGNAVVNV 1300
             L+ +L+ RS EI               +DS  G       A H        E  A+VN 
Sbjct: 1027 ELNAVLAARSQEITKILNDTAEPLVQRLADSGRGLAQQLEEATHAATDRLRSENAALVNA 1086

Query: 1301 IDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTN 1360
            +  +      A+++ +  L  +V ++ +R+  S+ ++  +I  AT +L  +D RL  +T 
Sbjct: 1087 LASRTAETIAAVQQAKVGLSDNVSELIDRLAASNGELGKLIDAATRNLADIDGRLVDSTT 1146

Query: 1361 RITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLM 1420
               E T     +   S+ L +  +  L  +S  +L Q+++I  +FD++ ++L  + D + 
Sbjct: 1147 SFVENTNRAAQMFQASTGLIDSNLGTLRTLSDNTLSQIADIADRFDEHGKVLSSASDMIN 1206

Query: 1421 KAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNM 1480
             AQ+    +LD+    L  L S LV KS   +K + S    V    ++A+  +    + M
Sbjct: 1207 SAQNGLVSTLDERHQALDKLASGLVEKSEGVEKLMQSFEALVASAFQRAEGQTRVSAEKM 1266

Query: 1481 TDSI 1484
             +S+
Sbjct: 1267 RESV 1270


>gi|218674159|ref|ZP_03523828.1| hypothetical protein RetlG_22822 [Rhizobium etli GR56]
          Length = 604

 Score =  165 bits (417), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 105/361 (29%), Positives = 192/361 (53%)

Query: 1290 FHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLN 1349
               E  A+ + +  +  NAANA+  +E  L+ +V  +  R+++SS  +  +++ A + L 
Sbjct: 4    LRTENEALASAVAARTENAANAVSAIENSLVGNVNGLVQRMSESSAAMAMMMNRAVEQLT 63

Query: 1350 KVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNS 1409
             VD RL +TT R  ++T     ++  S++L E K+  L +IS  +L Q+  I+ +FD++S
Sbjct: 64   SVDSRLGETTTRFADSTTKAAEMVNASTRLLEGKVDRLSDISGQTLSQVGGIIGRFDEHS 123

Query: 1410 QILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQA 1469
            ++L ++   L  AQS    +L++    L  L+  LV +S E +K +  +   ++ + E+A
Sbjct: 124  KVLTQASQLLGAAQSNLASTLEEREGALQALSVSLVQRSDEIEKTMRGLGGMIETVFERA 183

Query: 1470 DFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFV 1529
            +  S+ V  N+   +QSSF  I   L+  E R+++    +   +   G +   TID  F 
Sbjct: 184  EQRSNQVTGNLRQGVQSSFADIGRILTETEKRAQEAAETMREAITRAGEEANTTIDGTFA 243

Query: 1530 TLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKT 1589
             ++ +S DLSN +R  + +++  +E +       SD + Q   +SL   ++    + S  
Sbjct: 244  NVERRSGDLSNRIRGGLTASLSEVERMLGEAGRASDGAAQHMRESLREAIEDAVGRFSGA 303

Query: 1590 SDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITD 1649
            +DDI  ++  I  +L+ +R  LKR +  L +EAKESA  +R A+ EQI  L+D  +L+  
Sbjct: 304  TDDIRRSAADIRSELDATRAELKRGAFDLPEEAKESASAMRRAVAEQIKALQDISQLVGR 363

Query: 1650 S 1650
            S
Sbjct: 364  S 364



 Score =  122 bits (307), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 81/110 (73%)

Query: 1717 LSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSA 1776
            + S++SL  +I++ ID+DA V LW+ Y  GE D+F++RLYT+KGQ+ F  ++ +Y  +  
Sbjct: 493  VESLNSLSVDIARAIDHDASVDLWRRYQRGERDVFTRRLYTLKGQQTFDEIKRKYDREPE 552

Query: 1777 LRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             R A+DRYI +FE++L+++A+++ +  + Q ++ S+ GKVYTML HA+GR
Sbjct: 553  FRTAVDRYIGDFEKLLADVARTDPNQTVTQSYLTSDTGKVYTMLAHAAGR 602


>gi|218680147|ref|ZP_03528044.1| Apolipoprotein A1/A4/E [Rhizobium etli CIAT 894]
          Length = 209

 Score =  162 bits (409), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 88/206 (42%), Positives = 133/206 (64%), Gaps = 3/206 (1%)

Query: 88  ILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNS--PMDSFYDFAMRPEVITLFL 145
           IL++    S   A+R A + S++W+   LG +   Y      + S  D    P VI   L
Sbjct: 2   ILKSFDGASSRSAVRTATLFSVLWVMAGLGLMSLLYAPEIWQIRSLADLVALPGVIA-GL 60

Query: 146 VVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIV 205
           V  ++P+++F++F IMI+RA+DM +A++S+A +ALRL +PE  +SE++ ++  AVR+E+ 
Sbjct: 61  VGIIIPVMMFYAFAIMIARAQDMRNAARSMAEVALRLAEPETIASERIMTVGQAVRREVS 120

Query: 206 LMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLC 265
            M E I+R I+RASELE  V SE+  LE +Y  +E+R+  +   L  EREAI+NH  ++ 
Sbjct: 121 AMNEGIERTIARASELETLVHSEVNALERSYADNELRVRGLVHELGSEREAIVNHADRIR 180

Query: 266 TSIAEVHESLKEELSLTSEEISVHLS 291
           TSI  VH+ LKEELSL +EEI+V LS
Sbjct: 181 TSIGSVHDQLKEELSLATEEIAVRLS 206


>gi|304391712|ref|ZP_07373654.1| chemotaxis sensory transducer [Ahrensia sp. R2A130]
 gi|303295941|gb|EFL90299.1| chemotaxis sensory transducer [Ahrensia sp. R2A130]
          Length = 1723

 Score =  160 bits (405), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 303/1484 (20%), Positives = 598/1484 (40%), Gaps = 234/1484 (15%)

Query: 49   ESKDRQQTTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSS 108
            E+   QQT+  +  +Q           PAND    G   +   + K   +     A + S
Sbjct: 43   EADPYQQTSEPEPAQQQQRSVVSPRNRPANDDTRAGTARLRAALAKKPSSSPFWFATLLS 102

Query: 109  LIWLACELGFLIKFYTNSPMD--SFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRAR 166
            ++W+   L    +       D  S+     RPE++ L   V +VP+L  +++ +M+ R+ 
Sbjct: 103  ILWIGASLWAGFQQLGEEIFDPRSWASIVTRPELVYLAGAV-LVPLLFIWAYALMLRRSA 161

Query: 167  DMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVR 226
            ++  A++S+   A RLI+PE  S+  ++++  AVR E+V +TE I+RA+ RA ELE  V 
Sbjct: 162  ELKLAARSMTEAAYRLIEPETESANAIRTVGQAVRGEVVSLTEGIERAMQRAGELETLVH 221

Query: 227  SEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEI 286
            SE+  LE +Y+ +E+R+  + Q L  EREAI++H  ++ +SIA   E L+E+L+ ++ +I
Sbjct: 222  SEVATLEGSYSDNELRMRGLVQELASEREAIVSHTERVRSSIAGASEVLQEDLTNSARQI 281

Query: 287  SVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFD 346
                                             A T+S+   +    L +++        
Sbjct: 282  ---------------------------------ADTVSATQQEFAASLAASN-------- 300

Query: 347  NRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNF 406
               ES+  +L++SG +L  Q+G     +G N +++   +  Q    +    S   E    
Sbjct: 301  ---ESMRVSLSDSGIALLEQLGTAGSEIGTNIEQLGHGIVRQ----LDGSASRATE---- 349

Query: 407  FSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFL 466
                      T+ +V  SL          F S       N + E+D R   +  R+T+  
Sbjct: 350  ----------TMENVQASL---------GFVSQ------NMISELDGRAEEMSGRLTSAS 384

Query: 467  KEIVETFN-------NSITDFSS---FYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDL 516
            + ++           NS+ D  +   F  +NL+E    L    ++L     DS   + D 
Sbjct: 385  ESVIAKLMSAGTSTVNSVEDVQASLGFVSENLNEL---LTTKSEELVQRIGDSAAGLVDS 441

Query: 517  FLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKR 576
              S+     + ++ +T    D +S    ++++        L+  L     +L D L ++ 
Sbjct: 442  ITSSGTATVAEMEIRTKDMTDRVSFLTGDVTEKLESQFAALDERLNTRGTALVDSLGQRS 501

Query: 577  QRIDSDIGKKSEELCSSFNSSYQKVSNVISD-----REKLFSNSL-------ARVQSHFE 624
              + + + +++ E  + F++  ++++  I       +E+L S +L       ARV+    
Sbjct: 502  VELSNALEQRTSEAAAVFDNGRRQLAGEIGQALSDTQEQLDSKALELSMSLAARVE-QIN 560

Query: 625  ETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQ 684
            + ++ H  +I   ++    +  D+    A  + +  + LD  + A A+    ++T   + 
Sbjct: 561  QNVSEHVDTIDAKLAQRVLSFADET---AGRIEDVDRRLDEKVNAFASMSATRLTEIRDG 617

Query: 685  LVNR---FDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHID 741
            +  +   F + S+  + S +           +H   F +    +   +   +   T   D
Sbjct: 618  IAGQVASFADMSQAEMASVSER-------LGQHAVGFEEAARARIAELDDAIAGRTMDFD 670

Query: 742  DLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNH 801
               ++    +EE L    AN  +EL+ ++ A  + ID      T L  R +++ + +   
Sbjct: 671  LAAASRLSEVEEKL----ANRTAELANVASAQTEQID------TRLAARIEDIEARVSAR 720

Query: 802  SDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLT 861
              ++  +L +          QR  S        +  F+  L                   
Sbjct: 721  MGEIDRTLAEGTAAADRILEQRAGSL-------KDSFDEQLGG----------------V 757

Query: 862  DIAYSKAID-VANSLTEIQGNVGVTLENHSQAML----EKISASNTLVAKTFEEC----- 911
            DIA    ID +  +LT    N    LE  +QA+     E+I  +   +    EE      
Sbjct: 758  DIALGARIDQIDETLTGGAANAARILEERTQALKATFEEQIGTAEFAIGSRIEEAKDVLG 817

Query: 912  -----MSNILLSY-DENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDE 965
                  + IL    DE R  ++++L     VL + +A ++N I G    A++ ++  +D 
Sbjct: 818  SQSTEAARILAERTDELRSGVEEQLGLANTVLGRRVAEAQNAISGGAEKANELLQGQVD- 876

Query: 966  NSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINL 1025
                          ++  TL+      D++L +++ EL   +   A      ++ +T  L
Sbjct: 877  --------------ALQKTLVEDVSVADQMLAQRTAELSATISGGADAAERILAERTAAL 922

Query: 1026 ENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDS 1085
            +  L     + SR +    +  K   D+ +  A+ L   +G+ + +   I   LE +   
Sbjct: 923  DQTLSGGADAASRALTEHTTILK---DTFEEQAEVLALTLGTRTDA---IGASLEEAATR 976

Query: 1086 VNQKI-QKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDS 1144
            VN  + QK  +  G  +   M+ +++ + ++E   ++R    + + L+   +      D+
Sbjct: 977  VNDTLTQKAADLAG-ALDVNMNGVTEAL-VAEAERAERQLRAAVESLEGTMIAQVAAADA 1034

Query: 1145 TSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILL-DVDHTISSHTNESR 1203
                R E V +S         L QR  + ++ L + S  +S++L  D    + +   E +
Sbjct: 1035 ALDARSEQVSMS---------LAQRTAELNTTLAARSRELSQLLTRDTLPMLQNFQGEGQ 1085

Query: 1204 SLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNM----ENME--------- 1250
             + E   +   D+ ++L   L      +           ET +    E ME         
Sbjct: 1086 KVAEILANRTDDIATSLSERLVVTSDALKAAADAAAAKLETALIASNERMEGSAQAAAED 1145

Query: 1251 ------SLFDKNND---SMLLSFKERSNILDNI----------LSQRSMEISDSISGAFH 1291
                  +L D+  D    +  S +  S +++N           ++Q+  +++  +S    
Sbjct: 1146 LSARYVALEDRTTDLIGKLARSSQGLSEVVENQSGQLIATGEQVTQKIGDVTREVSERVQ 1205

Query: 1292 KEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKV 1351
             E  A+VN I  +      AL      L +D+  +  R+  S+ +++ +I+ A + L   
Sbjct: 1206 AENAALVNTITAKSTETMEALSSTNDRLRNDIGALLARLDGSTGELSEVITSADERLTGA 1265

Query: 1352 DERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQI 1411
             + L  TT             L +S++  E     L +IS   L+++SEI  +F++  + 
Sbjct: 1266 QQMLSGTTQGFRRAVDQASADLGKSTETIETNYLGLKDISSTVLVEISEIAERFEQQGRS 1325

Query: 1412 LIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFV 1455
            L      L + QS   +SLD   + +  LTS LVSKS + ++ +
Sbjct: 1326 LDSVSRLLDQTQSNIAVSLDDRRDAIETLTSGLVSKSEDLRQLM 1369



 Score =  103 bits (258), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 74/108 (68%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S+  L ++I++ I++D  V +W  Y  G+ ++F + +YT KGQ+ F  + ++Y  D   R
Sbjct: 1614 SLSGLSQDIAQAIEHDTAVSIWDRYQRGDRNVFDRSIYTSKGQRTFDEISDKYGRDEGFR 1673

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             ++DRY+ +FE +++++A+++ D+ + Q ++ S+ GKVYTML HA+GR
Sbjct: 1674 TSVDRYVDDFERLIADVARNDRDNIMTQTYLTSDTGKVYTMLAHAAGR 1721



 Score = 44.7 bits (104), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 237/1284 (18%), Positives = 499/1284 (38%), Gaps = 192/1284 (14%)

Query: 471  ETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDK 530
            E   NS    +        EF ++L  + + ++   +DS   + +   +    IG+N+++
Sbjct: 272  EDLTNSARQIADTVSATQQEFAASLAASNESMRVSLSDSGIALLEQLGTAGSEIGTNIEQ 331

Query: 531  KTLLFEDILSKKQNNISQITSMNTERLENTLT-------NSINSLKDMLEEKRQRIDSDI 583
               L   I+ +   + S+ T    E +EN          N I+ L    EE   R+ S  
Sbjct: 332  ---LGHGIVRQLDGSASRAT----ETMENVQASLGFVSQNMISELDGRAEEMSGRLTS-- 382

Query: 584  GKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTN 643
               SE + +   S+     N + D       SL  V  +  E +    + +V  I +S  
Sbjct: 383  --ASESVIAKLMSAGTSTVNSVED----VQASLGFVSENLNELLTTKSEELVQRIGDSAA 436

Query: 644  NLYDKIM----VLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICS 699
             L D I        A +    K + + +     DV  K+ +    L  R +     ++ S
Sbjct: 437  GLVDSITSSGTATVAEMEIRTKDMTDRVSFLTGDVTEKLESQFAALDERLNTRGTALVDS 496

Query: 700  YNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGS 759
                + +L    ++        F+N    ++G        I    S+     +E L S +
Sbjct: 497  LGQRSVELSNALEQRTSEAAAVFDNGRRQLAG-------EIGQALSDT----QEQLDSKA 545

Query: 760  ANIESELSAISKAMNKSIDD-VETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCT 818
              +   L+A  + +N+++ + V+TI   L +R      +     + V   L +      +
Sbjct: 546  LELSMSLAARVEQINQNVSEHVDTIDAKLAQRVLSFADETAGRIEDVDRRLDEKVNAFAS 605

Query: 819  TFAQRNDSFVNALADNQSKFENNLVNQSHL--LLDKLS-----------SDIQKLTDIAY 865
              A R     + +A   + F +  ++Q+ +  + ++L            + I +L D   
Sbjct: 606  MSATRLTEIRDGIAGQVASFAD--MSQAEMASVSERLGQHAVGFEEAARARIAELDDAIA 663

Query: 866  SKAID----VANSLTEIQ---GNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLS 918
             + +D     A+ L+E++    N    L N + A  E+I   +T +A   E+  + +   
Sbjct: 664  GRTMDFDLAAASRLSEVEEKLANRTAELANVASAQTEQI---DTRLAARIEDIEARVSAR 720

Query: 919  YDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSN 978
              E  +TL +  +    +L Q  AGS              ++D  DE    ++  L    
Sbjct: 721  MGEIDRTLAEGTAAADRILEQR-AGS--------------LKDSFDEQLGGVDIALGARI 765

Query: 979  NSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSR 1038
            + ++ TL        R+L+E++  L    + +      A+ ++    ++ L  Q    +R
Sbjct: 766  DQIDETLTGGAANAARILEERTQALKATFEEQIGTAEFAIGSRIEEAKDVLGSQSTEAAR 825

Query: 1039 VVDTSASSFKYLSDSIQTLAQELVSVIGS-MSQSTTDISGKLEISLDSVNQKIQKCREFF 1097
            ++       +   +    LA    +V+G  ++++   ISG  E           K  E  
Sbjct: 826  ILAERTDELRSGVEEQLGLAN---TVLGRRVAEAQNAISGGAE-----------KANELL 871

Query: 1098 GDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVD--I 1155
               + A    + + + ++++ ++QRT E+S  +    D     + + T+      +D  +
Sbjct: 872  QGQVDALQKTLVEDVSVADQMLAQRTAELSATISGGADAAERILAERTA-----ALDQTL 926

Query: 1156 SNKFIETSRVLEQREEKFHSAL--DSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEV 1213
            S      SR L +     H+ +  D+F +    + L    T+ + T+   + +E+    V
Sbjct: 927  SGGADAASRALTE-----HTTILKDTFEEQAEVLAL----TLGTRTDAIGASLEEAATRV 977

Query: 1214 KDVLS---------------NLDRALESYGSTVFKQFKEYVQCFETNM----ENMESLFD 1254
             D L+                +  AL +      +Q +  V+  E  M       ++  D
Sbjct: 978  NDTLTQKAADLAGALDVNMNGVTEALVAEAERAERQLRAAVESLEGTMIAQVAAADAALD 1037

Query: 1255 KNNDSMLLSFKERSNILDNILSQRSMEIS-----DSISGA--FHKEGNAVVNVIDQQIYN 1307
              ++ + +S  +R+  L+  L+ RS E+S     D++     F  EG  V  ++  +  +
Sbjct: 1038 ARSEQVSMSLAQRTAELNTTLAARSRELSQLLTRDTLPMLQNFQGEGQKVAEILANRTDD 1097

Query: 1308 AANALKK-------------------LEALLISDVEKITNRITDSSQDVTTIISDATDSL 1348
             A +L +                   LE  LI+  E++      +++D++       D  
Sbjct: 1098 IATSLSERLVVTSDALKAAADAAAAKLETALIASNERMEGSAQAAAEDLSARYVALEDRT 1157

Query: 1349 NKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLG-EIS-RV---SLLQMSEIVS 1403
              +  +L +++  ++E   +    L  + +   +KI D+  E+S RV   +   ++ I +
Sbjct: 1158 TDLIGKLARSSQGLSEVVENQSGQLIATGEQVTQKIGDVTREVSERVQAENAALVNTITA 1217

Query: 1404 KFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVK 1463
            K  +  + L  ++D L          LD     L ++ +    + + AQ+ +       +
Sbjct: 1218 KSTETMEALSSTNDRLRNDIGALLARLDGSTGELSEVITSADERLTGAQQMLSGTTQGFR 1277

Query: 1464 KIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNI-------------ETRSRDTV-RLI 1509
            + V+QA   +D  +   T++I+++++ +    S +             + RS D+V RL+
Sbjct: 1278 RAVDQAS--AD--LGKSTETIETNYLGLKDISSTVLVEISEIAERFEQQGRSLDSVSRLL 1333

Query: 1510 DHNLADIG------NKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEK 1563
            D   ++I          ++T+ S  V+  E    L +     +   + N E   + L   
Sbjct: 1334 DQTQSNIAVSLDDRRDAIETLTSGLVSKSEDLRQLMDSFNGIMAQAVMNAEGRATELTRG 1393

Query: 1564 SDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAK 1623
              +++ +  +    +  S TQ++ + +   AL +     DL ++RD L++  + L +E K
Sbjct: 1394 LAENVGLAANDATERFASATQEMREAAQ--ALRA-----DLASTRDDLRKSVIDLPEETK 1446

Query: 1624 ESADTIRSAIEEQINTLKDFQKLI 1647
            ES   +R  + +QI  LKD   ++
Sbjct: 1447 ESTTAMRRVVSDQIKALKDLNDIV 1470


>gi|296445036|ref|ZP_06886997.1| Apolipoprotein A1/A4/E [Methylosinus trichosporium OB3b]
 gi|296257457|gb|EFH04523.1| Apolipoprotein A1/A4/E [Methylosinus trichosporium OB3b]
          Length = 2539

 Score =  158 bits (399), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 259/1428 (18%), Positives = 564/1428 (39%), Gaps = 193/1428 (13%)

Query: 462  ITAFLKEIVETFNNSIT-------DFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNME 514
            +TAF + +V   + ++T       +  +F    L+ FE+ +  + D++    A+ H +  
Sbjct: 1240 LTAFEERVVARSDETVTRLVERGDEIGAFLSQGLAAFETTVVRHGDEVATRVAE-HSD-- 1296

Query: 515  DLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEE 574
                     I S L ++   FE+ +S++   ++   +   E+++  LT  +++L+   +E
Sbjct: 1297 --------KIASVLSERLTAFEEQVSRQTGEVTAAVAEQAEKVDGALTVRLDALERATQE 1348

Query: 575  KRQRIDSDIGKKSEELCSSFNSSYQ-KVSNVISDREKLFSNSLARVQSHFEETIAGHPQS 633
              + + S+  K++EE+ +S  +  +  +   ++D     +++LA   S  +E  A     
Sbjct: 1349 ASRSL-SEAQKRAEEVFASGGAELRAGLGQGVAD----VADALAEQSSALQERFALTAGE 1403

Query: 634  IVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVN------ 687
             V +IS     + +       AL+E   + ++++  H  +V   +    +Q+        
Sbjct: 1404 AVLAISTQGERIEE-------ALAERIAAFESTVIGHGGEVAAALAAGGDQIARGVSDQI 1456

Query: 688  -----RFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDD 742
                    +  + I     + + +L       L + + T       +   L   ++ +  
Sbjct: 1457 AAFETALQQEGEQIAARIGAESQRLTEQLGNKLIAVDRTIVEGGGALVSRLDERSEALGA 1516

Query: 743  LFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHS 802
                 A+R+ E       +IE +LS + + +   ++    +   L E+ + L + LV  +
Sbjct: 1517 RLVEQAQRLSE-------DIERQLSEVDRMI---VEGGGALVARLAEQSETLAARLVEQA 1566

Query: 803  DKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTD 862
             ++   +++       T  +     V  LA+        L  Q+  L +++   +     
Sbjct: 1567 QRLSEEMERQLATADRTIGEGGGELVARLAEQSEALAARLGEQAQRLSEEVERQLATADR 1626

Query: 863  IAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDEN 922
                    +   L E    +   L   SQ + E I      V +   E    ++    E 
Sbjct: 1627 TIGEGGGALVARLAEQSEALAARLGEQSQRLSEDIERQLGAVERAVGEGGGELVARLAEQ 1686

Query: 923  RQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVN 982
             +TL  +L +    L + +      ++ A+G     +   + E +  +   L+  + ++ 
Sbjct: 1687 SETLAGRLGEQSQRLSEEVEQRFATVERALGEGGGELVGRIAEQADAVAGRLAEQSKTLT 1746

Query: 983  STLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLE----NNLKEQEKSLSR 1038
              + R     D+ + +    L+ LL  +A  ++ A++++    E       +E    +  
Sbjct: 1747 DHVKRQLVAIDKSVSKDGAALVDLLGARAEEIAGAMASKIETFEAVSNERTREAVDRMDG 1806

Query: 1039 VVDTSASSFKYLSDSIQ-TLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFF 1097
            +V+   +     S S Q TL++  V V  SM     ++       + S+++K+++     
Sbjct: 1807 LVERIDAGLGSASQSFQETLSRHAVEVARSMGDGGREV-------IRSLDEKVKEIDAVL 1859

Query: 1098 GDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISN 1157
             +      + +S   E     +  R +EI+  L     V  N ++       G +  +SN
Sbjct: 1860 LERSSQLSETLSTKAEEINATLGGRAEEIAGTLDNRIGVFENNVV-------GRLDAVSN 1912

Query: 1158 KFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVL 1217
            +  E SR++    E   + +   +  +S    ++D T+ + T +    + +R+ E+    
Sbjct: 1913 EIGERSRLVV---ETIGARISEINATLSSAKRELDATLHARTGDLGEALTKRVDEIS--- 1966

Query: 1218 SNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQ 1277
            + LD  L   G+T+ ++  E  +     + ++  L  K  +S       R + +   L +
Sbjct: 1967 ATLDERLTQIGTTLGERGGEVTR----ELADVGELVAKTIES-------RGSSIVQHLGE 2015

Query: 1278 RSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDV 1337
            +  EI+ SI+    +    +   ++     +  AL  +   L  ++  + +R+  ++  +
Sbjct: 2016 KRAEIAASIA----ESAQELKTALESGSEGSVRALLSVNEKLRKELPDVLDRLGATNASL 2071

Query: 1338 TTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQ 1397
             TII  A  +L  ++ +L   T R+ E  G I  V          +I +LG++S  ++ +
Sbjct: 2072 QTIIEHAGANLEGLETQL---TGRLHEFQGAISDV--------SSQIAELGKLSDGTIGE 2120

Query: 1398 MSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMS 1457
              EIV   + + Q L +S D L + Q +   +LD    +L  L                 
Sbjct: 2121 AQEIVGAMESHRQTLTQSVDRLAETQEQLDSALDARRRSLEGLVG--------------- 2165

Query: 1458 ILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIG 1517
             LV+ K+     DF  +  V   +  ++ SF +++           +  R +   LA+  
Sbjct: 2166 -LVEGKR----KDF--EGAVAAFSGLVEDSFRRVE-----------ERARAVGGLLAEST 2207

Query: 1518 NKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNN 1577
              T   +D  F  ++               + +   E   + L    DQ+       L+ 
Sbjct: 2208 RDTADLVDERFAAVR--------------GAALRESEQTSAALRAACDQAS----GDLDR 2249

Query: 1578 KVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQI 1637
                 T+K +  + ++   S  I  +L  +R  ++R +  L +E  E A  +R  I EQ+
Sbjct: 2250 IFGEATEKFNAAAAEMRGMSLEIQRELEATRVEVRRGAQELPRETAEQAAALRRVIGEQV 2309

Query: 1638 NTLKDFQKLITDSVK-------------------------NNAASYNKGLHSDEYNISQV 1672
              L +   ++  S +                           A +  + L        + 
Sbjct: 2310 KALNELTDIVARSGRVYDIAEPAAVAAPPPPAPPRRTFEPAPAPTPARSLEPSWSAPQRP 2369

Query: 1673 DKRPSGK-------------KTKNNHAIKEWFNKILSSSTHSKGKSSSHIDISDKDSLS- 1718
             + P  +              +  +     W + +L+ ++  +  +    ++  ++  S 
Sbjct: 2370 REEPRARAPQQPPAMPPQPAPSARDPGESGWLSDLLARASRDEPPAPRANNVPGRNKPSG 2429

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            ++DSL  +I++ +D  A   LW+ +  GE   F +RLYT +GQ+ F  ++ + + D+  R
Sbjct: 2430 ALDSLTLDIARMVDQAAVTDLWERFQRGEKAPFGRRLYTQQGQQTFEEIRRRCRVDAEFR 2489

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
              +D YI  FE +L E  +++ D  L + +++S+ GKVYTML HASGR
Sbjct: 2490 ATVDHYIQEFERLLMETGRNDRDGALTRGYLISDAGKVYTMLGHASGR 2537



 Score =  145 bits (366), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 294/1495 (19%), Positives = 601/1495 (40%), Gaps = 234/1495 (15%)

Query: 85   ITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLF 144
            +  + Q +     N  L   F S + W A      + F     +D+     + P+ + L 
Sbjct: 131  VGRLRQALQARPSNAILAYTFASIVAW-ALLWTLFVYFNQGEIIDAERGSFLAPKPV-LA 188

Query: 145  LVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEI 204
            L+    PI+  F   +M  RA +M   + S+A +A+RLI+PE  ++E++ ++S A+R+E 
Sbjct: 189  LLALAGPIVFIFVTGVMARRAHEMKQVANSMAEVAIRLIEPETIATEQVVTLSQAIRREA 248

Query: 205  VLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQL 264
              M + I+RA++RASELE  VR+E+  LE +Y+++E RI  +   L +EREAI+ +    
Sbjct: 249  ASMGDGIERALARASELEIIVRTEVSNLERSYSENERRIRLLIDELTREREAILVNADNA 308

Query: 265  CTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTIS 324
             T++    ESL +EL  T    S HL+                V++   R+       + 
Sbjct: 309  RTALLGARESLSQELQST----STHLAE--------------TVSDAGGRVT----AALG 346

Query: 325  SKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNN-TDKVSI 383
            SK +++   L            +R E +   L  +G S+ + +G+ T  +     D VS 
Sbjct: 347  SKGEEIRLALERVGDGFNTTLSSRGEDMVKRLAAAGESITSGLGDATEDVTRRFADGVSE 406

Query: 384  A---LKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNL 440
            A   LKE+ +            ++   +++  SI   L+++  +L  ++ E+ DS    L
Sbjct: 407  ADRRLKERGET-----------LAADLAQRSASIVERLDELGTALANNVGERGDSLVERL 455

Query: 441  KST---TDNTL--------REVDNRTNTLE------------------NRITAFLKEIVE 471
              T    D+ +        R +   T+TL                   +RI A L+   E
Sbjct: 456  AETGSRVDDAIVTHGGALERALAEATDTLAAEMAAKAAATEAAFGAAGDRIAALLE---E 512

Query: 472  TFNNSITDFSSF-------YKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTI 524
            T   + +DF +        + +NL+E    L    D LQ  FA   G        +   +
Sbjct: 513  TRKRAASDFEAHGEALHARFVENLAESAGALSAQTDSLQERFAALAGEAVAAIAMHGDRV 572

Query: 525  GSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIG 584
            G  L ++   FE+ +++     +   + ++ RL  T+T S+   +  +  + +  +  +G
Sbjct: 573  GETLAERLAAFEESVARHGGAAAARVAEDSARLGETVTKSLAEFEARVAAQGEETEQRLG 632

Query: 585  KKSEELCSSFNSSYQKVSNVISDREKLFSNSLA-------RVQSHFEETIAGHPQSIVDS 637
               E+L +      Q+  +++    +L  ++ A       R+ +   + +A   + +V  
Sbjct: 633  AHGEKLGAVMTQGVQQFEDIVL---RLGEDAAARLIEQGERIGAAVSDGVASFEERVVAP 689

Query: 638  ISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQ----LVNRFDESS 693
               + + L  +   + AAL++   + +  +  H+ +V  ++    +     L + F +  
Sbjct: 690  SEEAASRLRLQGEAVGAALADGLAAFEERVVGHSDEVASRLVAHGDAIGAGLTDGFVDFE 749

Query: 694  KNIICSYNSSNNKL----ETI---FQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSN 746
            KN+I     + ++L    E I     K L SF    + + + ++  L    + + +  S 
Sbjct: 750  KNVIDRGEKAVSRLVAQGEAIGAAVAKGLESFERRVHAEGEQLAARLATQGETVGEAVSG 809

Query: 747  NAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERC----QELGSDLVNHS 802
                 EE +   S    + L A  +A+   +   E +ST  +ER     +   S L+ H 
Sbjct: 810  GLAAFEERVAGQSEEAANRLVAHGEAIGAMV--AEGLST-FEERVLGESEAAASRLLKHG 866

Query: 803  DKVLSSLKQA-----------QELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLD 851
              + +S+ +             E +        D+   AL+D    FE  +V  S  + +
Sbjct: 867  QTIGASVAEGLAAFERRVVSQSEQVSARLTAHGDAIGAALSDGLGAFEERVVGHSDEVAN 926

Query: 852  KL---SSDIQKL-TD--IAYSKAI-----DVANSLTEIQGNVGVTLENHSQAMLEKIS-- 898
            +L      I  L TD  +A+ + +     D+A  +     ++G  +EN      E+++  
Sbjct: 927  RLVAHGDAIGSLVTDGFVAFEERVVAHSEDIATRIAAQAESLGSLVENGFAKFEERVAGR 986

Query: 899  ---ASNTLVAK--TFEECMSNILLSYD----ENRQTLDKKLSDHID----VLRQNLAGSE 945
               A+  L A+     E ++  L ++     +  + + +KL+ H +    V+ +  A  E
Sbjct: 987  GEEATARLAAQGEAIGEAVAQGLAAFQSRVSDQSEDIAEKLAAHGEIIGKVVSEGFAKFE 1046

Query: 946  NKIDGAIGSAS-----------QFIRDILDENSSR-------IESLLSCSNNSVNSTLLR 987
            +++  + G A+             + D L     R       + + L    +++ S +  
Sbjct: 1047 SRVSESSGEAAARLAARGDAIGALLSDGLAAFEERVVVHGDEVAARLVEHGDAIGSAVSE 1106

Query: 988  SHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENN-LKEQEKSLSRVVDTSASS 1046
                F+  + + S+ ++  +      L  AVS      E+  L+  E   +R+VD     
Sbjct: 1107 GLAAFETRVLDHSERVVGQIVAHGDALGAAVSDGLAAFEDQVLRRGEDLATRLVDEGERV 1166

Query: 1047 FKYLSDSIQT----LAQELVSVIGSMSQS----TTDISGKLEISLDSVNQKIQKCREFF- 1097
               +SD + T    +AQ+  + +  +++     T  ++G+     + ++++ ++  +   
Sbjct: 1167 GAAVSDGVATFERRVAQQSEAAVARLAEHGARLTVSVAGEFAALGEQISRQGEETAQRLA 1226

Query: 1098 --GDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDI 1155
              GD I A M   S+ +   E+R+  R+ E   +L++  D I   +    +     +V  
Sbjct: 1227 EGGDRIGAAM---SEGLTAFEERVVARSDETVTRLVERGDEIGAFLSQGLAAFETTVVRH 1283

Query: 1156 SNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKD 1215
             ++    +RV E      HS  D  +  +S  L   +  +S  T E  + + ++  +V  
Sbjct: 1284 GDEV--ATRVAE------HS--DKIASVLSERLTAFEEQVSRQTGEVTAAVAEQAEKVDG 1333

Query: 1216 VLS----NLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNIL 1271
             L+     L+RA +    ++ +  K   + F +    + +   +    +  +  E+S+ L
Sbjct: 1334 ALTVRLDALERATQEASRSLSEAQKRAEEVFASGGAELRAGLGQGVADVADALAEQSSAL 1393

Query: 1272 ----------------------DNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAA 1309
                                  +  L++R      ++ G   +   A+    DQ     +
Sbjct: 1394 QERFALTAGEAVLAISTQGERIEEALAERIAAFESTVIGHGGEVAAALAAGGDQIARGVS 1453

Query: 1310 NALKKLEALLISDVEKITNRITDSSQDVT------------TIISDATDSLNKVDERLHQ 1357
            + +   E  L  + E+I  RI   SQ +T            TI+      ++++DER   
Sbjct: 1454 DQIAAFETALQQEGEQIAARIGAESQRLTEQLGNKLIAVDRTIVEGGGALVSRLDERSEA 1513

Query: 1358 TTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQIL 1412
               R+ E          ++ +L E   + L E+ R+ +     +V++  + S+ L
Sbjct: 1514 LGARLVE----------QAQRLSEDIERQLSEVDRMIVEGGGALVARLAEQSETL 1558



 Score = 64.3 bits (155), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 185/1036 (17%), Positives = 412/1036 (39%), Gaps = 112/1036 (10%)

Query: 246  ITQNLKQEREAIINHGTQLCTSIAE--------VHESL---KEELSLTSEEISVHLSRAI 294
            ++Q L      ++ HG ++ T +AE        + E L   +E++S  + E++  ++   
Sbjct: 1269 LSQGLAAFETTVVRHGDEVATRVAEHSDKIASVLSERLTAFEEQVSRQTGEVTAAVAEQA 1328

Query: 295  DSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSN 354
            +     + VR+    +   R  QE+++++S    +  EV  S    +       +  +++
Sbjct: 1329 EKVDGALTVRL----DALERATQEASRSLSEAQKRAEEVFASGGAELRAGLGQGVADVAD 1384

Query: 355  TLNNSGRSL----ANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEK 410
             L     +L    A   G   L +    +++  AL E+   F      H  E++   +  
Sbjct: 1385 ALAEQSSALQERFALTAGEAVLAISTQGERIEEALAERIAAFESTVIGHGGEVAAALAAG 1444

Query: 411  QKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIV 470
               I   ++D + +   +LQ++ +   + + +       E    T  L N++ A  + IV
Sbjct: 1445 GDQIARGVSDQIAAFETALQQEGEQIAARIGA-------ESQRLTEQLGNKLIAVDRTIV 1497

Query: 471  ETFNNSITDF---SSFYKDNLSEFESNLQGNIDK---------LQGC------FADSHGN 512
            E     ++     S      L E    L  +I++         ++G        A+    
Sbjct: 1498 EGGGALVSRLDERSEALGARLVEQAQRLSEDIERQLSEVDRMIVEGGGALVARLAEQSET 1557

Query: 513  MEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDML 572
            +    +   Q +   ++++    +  + +    +    +  +E L   L      L + +
Sbjct: 1558 LAARLVEQAQRLSEEMERQLATADRTIGEGGGELVARLAEQSEALAARLGEQAQRLSEEV 1617

Query: 573  EEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQ 632
            E +    D  IG+    L +      + ++  + ++ +  S  + R     E  +     
Sbjct: 1618 ERQLATADRTIGEGGGALVARLAEQSEALAARLGEQSQRLSEDIERQLGAVERAVGEGGG 1677

Query: 633  SIVDSISNSTNNLYDKIMVLAAALSES--QK--SLDNSLKAHATDVVHKITNAENQLVNR 688
             +V  ++  +  L  ++   +  LSE   Q+  +++ +L     ++V +I    + +  R
Sbjct: 1678 ELVARLAEQSETLAGRLGEQSQRLSEEVEQRFATVERALGEGGGELVGRIAEQADAVAGR 1737

Query: 689  FDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNS-----------T 737
              E SK +          ++    K   +  D    +++ ++G + +            T
Sbjct: 1738 LAEQSKTLTDHVKRQLVAIDKSVSKDGAALVDLLGARAEEIAGAMASKIETFEAVSNERT 1797

Query: 738  QHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDV--ETISTALKERCQELG 795
            +   D      +R++  L S S + +  LS  +  + +S+ D   E I + L E+ +E+ 
Sbjct: 1798 REAVDRMDGLVERIDAGLGSASQSFQETLSRHAVEVARSMGDGGREVIRS-LDEKVKEID 1856

Query: 796  SDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSS 855
            + L+  S ++  +L    E +  T   R +     L +    FENN+V +    LD +S+
Sbjct: 1857 AVLLERSSQLSETLSTKAEEINATLGGRAEEIAGTLDNRIGVFENNVVGR----LDAVSN 1912

Query: 856  DIQK----LTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEEC 911
            +I +    + +   ++  ++  +L+  +  +  TL   +  + E ++     ++ T +E 
Sbjct: 1913 EIGERSRLVVETIGARISEINATLSSAKRELDATLHARTGDLGEALTKRVDEISATLDER 1972

Query: 912  MSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIE 971
            ++ I  +  E    + ++L+D  +++ + +    + I   +G     I   + E++  ++
Sbjct: 1973 LTQIGTTLGERGGEVTRELADVGELVAKTIESRGSSIVQHLGEKRAEIAASIAESAQELK 2032

Query: 972  SLL-SCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLE---- 1026
            + L S S  SV + LL  ++K   L +E  D L +L    AS L T +     NLE    
Sbjct: 2033 TALESGSEGSVRA-LLSVNEK---LRKELPDVLDRLGATNAS-LQTIIEHAGANLEGLET 2087

Query: 1027 ---NNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTT-------DIS 1076
                 L E + ++S  V +  +    LSD     AQE+V  + S  Q+ T       +  
Sbjct: 2088 QLTGRLHEFQGAISD-VSSQIAELGKLSDGTIGEAQEIVGAMESHRQTLTQSVDRLAETQ 2146

Query: 1077 GKLEISLDSVNQKIQKC-------REFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQ 1129
             +L+ +LD+  + ++         R+ F   + AF    S ++E S +R+ +R + +   
Sbjct: 2147 EQLDSALDARRRSLEGLVGLVEGKRKDFEGAVAAF----SGLVEDSFRRVEERARAVGGL 2202

Query: 1130 LLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILL 1189
            L ++     + + +  + VRG  +          R  EQ      +A D  S ++ RI  
Sbjct: 2203 LAESTRDTADLVDERFAAVRGAAL----------RESEQTSAALRAACDQASGDLDRIFG 2252

Query: 1190 DVDHTISSHTNESRSL 1205
            +     ++   E R +
Sbjct: 2253 EATEKFNAAAAEMRGM 2268



 Score = 41.6 bits (96), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 99/480 (20%), Positives = 195/480 (40%), Gaps = 78/480 (16%)

Query: 207  MTEEIDRAISRASE-LEKTV-RSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQL 264
            + E ID  +  AS+  ++T+ R  +EV  +        I ++ + +K+    ++   +QL
Sbjct: 1807 LVERIDAGLGSASQSFQETLSRHAVEVARSMGDGGREVIRSLDEKVKEIDAVLLERSSQL 1866

Query: 265  CTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVT---EKTTRIVQESAQ 321
              +++   E +   L   +EEI+  L   I  F++ V  R+  V+    + +R+V E   
Sbjct: 1867 SETLSTKAEEINATLGGRAEEIAGTLDNRIGVFENNVVGRLDAVSNEIGERSRLVVE--- 1923

Query: 322  TISSKID-----------QLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNY 370
            TI ++I            +L   LH+ +  + +    R++ +S TL+        Q+G  
Sbjct: 1924 TIGARISEINATLSSAKRELDATLHARTGDLGEALTKRVDEISATLDER----LTQIGT- 1978

Query: 371  TLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQ 430
               LG    +V+  L +  +   +   S    +     EK+  I  ++ +  Q L+ +L+
Sbjct: 1979 --TLGERGGEVTRELADVGELVAKTIESRGSSIVQHLGEKRAEIAASIAESAQELKTALE 2036

Query: 431  EKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSE 490
               +     L S  +   +E+ +  + L     A L+ I+E               NL  
Sbjct: 2037 SGSEGSVRALLSVNEKLRKELPDVLDRL-GATNASLQTIIEHAGA-----------NLEG 2084

Query: 491  FESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQIT 550
             E+ L G + + QG  +D    + +L   +  TIG          ++I          + 
Sbjct: 2085 LETQLTGRLHEFQGAISDVSSQIAELGKLSDGTIGEA--------QEI----------VG 2126

Query: 551  SMNTERLENTLTNSINSLKDMLEEKRQRIDS--DIGKKS-EELCSSFNSSYQKVSNVISD 607
            +M + R   TLT S+    D L E ++++DS  D  ++S E L        +     ++ 
Sbjct: 2127 AMESHR--QTLTQSV----DRLAETQEQLDSALDARRRSLEGLVGLVEGKRKDFEGAVAA 2180

Query: 608  REKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKI-----MVLAAALSESQKS 662
               L  +S  RV+           +++   ++ ST +  D +      V  AAL ES+++
Sbjct: 2181 FSGLVEDSFRRVEE--------RARAVGGLLAESTRDTADLVDERFAAVRGAALRESEQT 2232


>gi|254470613|ref|ZP_05084017.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211960924|gb|EEA96120.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 2378

 Score =  158 bits (399), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 294/1408 (20%), Positives = 566/1408 (40%), Gaps = 225/1408 (15%)

Query: 104  AFMSSLIWLACELGFLIKFYT-NSPMDSFYDFAMRPEVITLFLVVS--VVPILLFFSFFI 160
            AF  S++W    LG  + +      ++    FA   E  TL LV    VVPI   +   +
Sbjct: 119  AFAVSVVW--ASLGLAMSWGAFAEQLEKSSSFAGVFENPTLVLVSVFIVVPIAFVWVMAL 176

Query: 161  MISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASE 220
            M  RA++M + ++ +  +ALRL +PE+ + E + ++  A+R+E   M + I+RAI+RASE
Sbjct: 177  MFWRAQEMRNVARGMTEVALRLAEPEDVAKESILNVGQAIRREAAAMGDGIERAIARASE 236

Query: 221  LEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELS 280
            LE  +  E+  LEN+Y  +E++I  + + L  +REAI  +   +  +I+  HE+L  +L+
Sbjct: 237  LEVLIHKEVSSLENSYNDNELKIRRLVEELVSQREAIQANAELVRETISGSHENLASQLA 296

Query: 281  LTSEEISVHLSRA-------IDS----FQSIVDVRIAKVT-------------------- 309
             TSE+ +  + RA       IDS      S ++ R+++VT                    
Sbjct: 297  NTSEDFASSVDRARERLTGSIDSMLEQMNSKLETRVSEVTDSFTEAGSEMVSSLTIRSDD 356

Query: 310  --EKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQV 367
              E+ T    E  +T+S    +L E LH     I ++F +   S  + L   G  L +++
Sbjct: 357  YVERLTSTGSELVETLSETGSKLSETLHERGSSINEEFSSTANSFIDNLTERGSDLNSRL 416

Query: 368  GNYTLMLGNN----TDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLN---- 419
               +  L NN    +D+++  L     + ++  ++   E+S+  +E+  ++  TL     
Sbjct: 417  SETSEELVNNLASRSDEITATLSTTGTEIVEGLSARGNEISDLLAERGDALNATLGAAGA 476

Query: 420  --------------DVLQS----LRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENR 461
                           VLQ+    L  S++E   S  +     + +    +   +  +  +
Sbjct: 477  ELSATITDQTEAMKGVLQAQGTELTASIEETVSSVTAQFVGASSDLTETLVTTSGEVVGQ 536

Query: 462  ITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNI 521
            I+A   E+  T  N +++F++   +  SE    L      +     +++  + +    ++
Sbjct: 537  ISAANTELNSTLTNGLSEFTTSVSETSSELAQTLVITTSTVSEQLTEANATLTETLNVSV 596

Query: 522  QTIGSNLDKKTLLFEDILSKKQNNI-SQITSMNTERLE------NTLTNSINSLKDMLEE 574
            Q+I S  +  +     +LS     + + +TS +TE  E      +T+T+ INS  D L E
Sbjct: 597  QSISSAAEGASSQVSAVLSNGVTELTTSVTSASTELSEALAATTSTVTDQINSANDTLTE 656

Query: 575  KRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSI 634
                    I +  E   S   ++    SN ++++       +     +  ET+ G   +I
Sbjct: 657  TMNLGVVSINQSVETAGSELTTTLLTASNEVTEK-------ITTANDNLTETLKGSVDTI 709

Query: 635  ---VDSISNS-TNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFD 690
               VD +S   + +L   + +L+  ++ S  ++  ++++  T++   +  A  QL    D
Sbjct: 710  TRTVDGVSGELSQSLDSGVELLSQTVTNSTAAIAETMESGVTNLNESVYGASAQLTETLD 769

Query: 691  ESSKNIICSYNSSNNKLETIFQKHLHS----------------------FNDTFNNKSDH 728
             S+ N   S + +   +    +  + S                       ++T N     
Sbjct: 770  ASASNFTASVSGATANITDALEDGVSSLSRTVSGAKEQISETLDGGVVTLSETVNATGSQ 829

Query: 729  VSGILKNSTQHIDDLFSNNAKRMEELLHSGSAN----IESELSAISKAMNKSIDDV-ETI 783
            +S ++ +    + D        M E L +G  +    + S  S IS  M+  +  + ET+
Sbjct: 830  ISTVMDSGVGSLTDAVKTANTIMSETLDAGVGSLNETVGSASSQISTIMDTGVSSLNETV 889

Query: 784  STALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNA---LAD----NQS 836
            +TA  +    L   +   SD+  S+  Q  E L T+ +   + F +A   L+D       
Sbjct: 890  NTANTQLTDTLNLTVTTVSDQFGSANAQLHETLETSISGITEHFSSASTRLSDEILTRGE 949

Query: 837  KFENNLVNQSHLLLDKLSSDIQKLTDI---------------AYSKAIDVANSLTEIQGN 881
            +   NL   S  L+D ++   +++  +                   A  +AN   EI   
Sbjct: 950  EINANLSLTSGRLIDTITGRTEEMMGVVDERVTNLDTALRATGEQAAEGIANRGREINEA 1009

Query: 882  VGV-------TLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHI 934
            + V       TL N S  + E +  +   +         +I    DE   TL   ++   
Sbjct: 1010 IAVQCTDFIDTLSNRSTEVSEVLRGAGESIIADLSLRGGDIATRLDETANTLGTTITVSG 1069

Query: 935  DVLRQNLAGSENK------IDGA-----IGSASQFIRDILDENSSRIESLLSCSNNSVNS 983
              L   L     +      I+GA     +      + D + + +S  ++ L  + + +  
Sbjct: 1070 GELADRLGNVSTQIYESITINGAELDQRLAERGAEVADTISKQTSAFKTALESTTSDITG 1129

Query: 984  TL-LRSHQKFDRL---------------------LQEKSDELIQLLDNKASCLSTAVSTQ 1021
             L LR+ +  D+L                     L E  D + + LD +   L+  ++++
Sbjct: 1130 ALGLRTEELADKLADTGTQLAYLIGSRGERVTADLTEIGDRITETLDIRGRALNDGLASK 1189

Query: 1022 TINLENNLKEQEKSLSRVVDTSASSFKYLSDS-IQTLAQELVSVIGSMSQSTTDISGKLE 1080
               LE  + E    L + +D  + +     DS I++L  +L     +  QS    +  L 
Sbjct: 1190 LAELEQVVTESGSDLVQSIDLRSQNIGASFDSRIESLDAKLEERTSTFEQSFDTRAAALT 1249

Query: 1081 ISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQ 1140
             +++S   K+    E  G  I+A               + ++TQ IS+ L    D+I   
Sbjct: 1250 ETIESRTTKLADAVE-QGTGIIA-------------STLEEKTQSISKILEDRTDIIA-- 1293

Query: 1141 IIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTN 1200
             ++ + RV    V +SN+  +   +L QR E          + IS  L   D  +     
Sbjct: 1294 -VNLSERVEQVGVSLSNRAEKIGEILAQRSEAIE-------ETISNSLSTFDQAVGDKVE 1345

Query: 1201 ESRSLIEQRIHEVKDVLSN----LDRALESYG----STVFKQFKEYVQCFETNMENMESL 1252
             + ++I  R   + + LS+    +D+AL++       T+  + +E  + F      +   
Sbjct: 1346 AAATVITDRAEHLSESLSSGTERIDQALDARAKQISETLVSRTREIAKAFHDGQTEINEA 1405

Query: 1253 FDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNV-IDQQIYNAANA 1311
             D            R     +I+ Q+S  ++D++S     E  A +NV +  +++  A  
Sbjct: 1406 LDS-----------RLEEAGSIIVQQSKNLTDALS-----EQVAEINVSLGSKVFEVAET 1449

Query: 1312 L----KKLEALLISDVEKITNRITDSSQ 1335
            L    K LE +L   +E IT  + D S+
Sbjct: 1450 LDSRSKALETILTDRLEAITTTMGDESE 1477



 Score =  130 bits (326), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 102/161 (63%), Gaps = 8/161 (4%)

Query: 1674 KRPSGKKT---KNNHAIKEWFNKILSSSTHSKGKSSSHI-DISDKDS----LSSIDSLVE 1725
            KRP        + N   K W + +L  ++  +     H  D ++  +    + S++SL  
Sbjct: 2216 KRPQATPAAVQQGNGTSKGWISDLLRRASDDEDGMGGHAHDTANARTPQHMVESLNSLSM 2275

Query: 1726 NISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYI 1785
            +I++ +D++ FV LW+ Y  GE D+F++RLYT++GQ+ F  ++++Y  D   R+A++RYI
Sbjct: 2276 DIARAVDHETFVDLWERYKRGERDVFTRRLYTLQGQQTFDEIRQKYGRDPEFRSAVERYI 2335

Query: 1786 SNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             +FE++LS++++S+ D+ L Q ++ S+ GKVYTML HASGR
Sbjct: 2336 QDFEQLLSQVSRSDSDNQLGQTYLTSDTGKVYTMLAHASGR 2376



 Score = 47.4 bits (111), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 215/1158 (18%), Positives = 468/1158 (40%), Gaps = 152/1158 (13%)

Query: 561  LTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQ 620
            LT   + L   L E  + + +++  +S+E+ ++ +++  ++   +S R    S+ LA   
Sbjct: 405  LTERGSDLNSRLSETSEELVNNLASRSDEITATLSTTGTEIVEGLSARGNEISDLLAERG 464

Query: 621  SHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITN 680
                 T+      +  +I++ T  +     VL A  +E    L  S++   + V  +   
Sbjct: 465  DALNATLGAAGAELSATITDQTEAMKG---VLQAQGTE----LTASIEETVSSVTAQFVG 517

Query: 681  AENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHI 740
            A + L      +S  ++   +++N +L +     L  F  + +  S  ++  L  +T  +
Sbjct: 518  ASSDLTETLVTTSGEVVGQISAANTELNSTLTNGLSEFTTSVSETSSELAQTLVITTSTV 577

Query: 741  DD-LFSNNAKRMEEL---LHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGS 796
             + L   NA   E L   + S S+  E   S +S  ++  + +   ++T++     EL  
Sbjct: 578  SEQLTEANATLTETLNVSVQSISSAAEGASSQVSAVLSNGVTE---LTTSVTSASTELSE 634

Query: 797  DLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSD 856
             L   +  V   +  A + L  T      S   ++    S+    L+  S+ + +K+++ 
Sbjct: 635  ALAATTSTVTDQINSANDTLTETMNLGVVSINQSVETAGSELTTTLLTASNEVTEKITTA 694

Query: 857  IQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNIL 916
               LT+        +  ++  + G +  +L++  + + + ++ S   +A+T E  ++N+ 
Sbjct: 695  NDNLTETLKGSVDTITRTVDGVSGELSQSLDSGVELLSQTVTNSTAAIAETMESGVTNL- 753

Query: 917  LSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSC 976
               +E+      +L++ +D    N   S       +  A+  I D L++  S +   +S 
Sbjct: 754  ---NESVYGASAQLTETLDASASNFTAS-------VSGATANITDALEDGVSSLSRTVSG 803

Query: 977  SNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSL 1036
            +   ++ TL          +     ++  ++D+    L+ AV T    +   L     SL
Sbjct: 804  AKEQISETLDGGVVTLSETVNATGSQISTVMDSGVGSLTDAVKTANTIMSETLDAGVGSL 863

Query: 1037 SRVVDTSAS--------SFKYLSDSIQTLAQELVSVIGSMSQSTTDISGK--------LE 1080
            +  V +++S            L++++ T   +L   +     + +D  G         LE
Sbjct: 864  NETVGSASSQISTIMDTGVSSLNETVNTANTQLTDTLNLTVTTVSDQFGSANAQLHETLE 923

Query: 1081 ISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKR----ISQRTQEISQQLLQNNDV 1136
             S+  + +          D I+   +EI+  + ++  R    I+ RT+E+   +   ++ 
Sbjct: 924  TSISGITEHFSSASTRLSDEILTRGEEINANLSLTSGRLIDTITGRTEEMMGVV---DER 980

Query: 1137 ITNQIIDSTSRVRGEIV--DISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHT 1194
            +TN  +D+  R  GE     I+N+  E +  +  +   F   L + S  +S +L      
Sbjct: 981  VTN--LDTALRATGEQAAEGIANRGREINEAIAVQCTDFIDTLSNRSTEVSEVLRGAGE- 1037

Query: 1195 ISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFD 1254
                     S+I        D+ + LD    + G+T+     E         + + ++  
Sbjct: 1038 ---------SIIADLSLRGGDIATRLDETANTLGTTITVSGGELA-------DRLGNVST 1081

Query: 1255 KNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKK 1314
            +  +S+ ++  E    LD  L++R  E++D+IS    K+ +A    ++    +   AL  
Sbjct: 1082 QIYESITINGAE----LDQRLAERGAEVADTIS----KQTSAFKTALESTTSDITGALGL 1133

Query: 1315 LEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLA 1374
                     E++ +++ D+   +  +I    +   +V   L +  +RITET   +D    
Sbjct: 1134 -------RTEELADKLADTGTQLAYLIGSRGE---RVTADLTEIGDRITET---LDI--- 1177

Query: 1375 ESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDA 1434
                L +     L E+ +V     S++V   D  SQ +  S DS ++       SLD   
Sbjct: 1178 RGRALNDGLASKLAELEQVVTESGSDLVQSIDLRSQNIGASFDSRIE-------SLD--- 1227

Query: 1435 NNLVDLTSRLVSKSSE-AQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKI-- 1491
                   ++L  ++S   Q F                   DT    +T++I+S   K+  
Sbjct: 1228 -------AKLEERTSTFEQSF-------------------DTRAAALTETIESRTTKLAD 1261

Query: 1492 ---DGT---LSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQK 1545
                GT    S +E +++   ++++     I     + ++   V+L  ++  +   + Q+
Sbjct: 1262 AVEQGTGIIASTLEEKTQSISKILEDRTDIIAVNLSERVEQVGVSLSNRAEKIGEILAQR 1321

Query: 1546 ICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDI--ALTSR--RIA 1601
              +    I N  ST ++     ++     + ++ +  ++ LS  ++ I  AL +R  +I+
Sbjct: 1322 SEAIEETISNSLSTFDQAVGDKVEAAATVITDRAEHLSESLSSGTERIDQALDARAKQIS 1381

Query: 1602 EDL-NNSRDILK--RDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASY 1658
            E L + +R+I K   D  +   EA      + S +EE  + +    K +TD++    A  
Sbjct: 1382 ETLVSRTREIAKAFHDGQTEINEA------LDSRLEEAGSIIVQQSKNLTDALSEQVAEI 1435

Query: 1659 NKGLHSDEYNISQ-VDKR 1675
            N  L S  + +++ +D R
Sbjct: 1436 NVSLGSKVFEVAETLDSR 1453



 Score = 43.1 bits (100), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 216/1097 (19%), Positives = 430/1097 (39%), Gaps = 197/1097 (17%)

Query: 322  TISSKIDQLLEVLHSTSIVITKDFD-------NRIESLSNTLNN----SGRSLANQVGNY 370
            T+S++  ++ EVL      I  D          R++  +NTL      SG  LA+++GN 
Sbjct: 1020 TLSNRSTEVSEVLRGAGESIIADLSLRGGDIATRLDETANTLGTTITVSGGELADRLGNV 1079

Query: 371  TLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQ 430
                              S Q  ++ T +  E+    +E+   +  T++           
Sbjct: 1080 ------------------STQIYESITINGAELDQRLAERGAEVADTIS----------- 1110

Query: 431  EKEDSFCSNLKSTTDNTLREVDNRTNTLEN------------------RITAFLKEI--- 469
            ++  +F + L+STT +    +  RT  L +                  R+TA L EI   
Sbjct: 1111 KQTSAFKTALESTTSDITGALGLRTEELADKLADTGTQLAYLIGSRGERVTADLTEIGDR 1170

Query: 470  -VETFNNSITDFSSFYKDNLSEFESNL-QGNIDKLQGCFADSHGNMEDLFLSNIQTIGSN 527
              ET +      +      L+E E  + +   D +Q     S  N+   F S I+++ + 
Sbjct: 1171 ITETLDIRGRALNDGLASKLAELEQVVTESGSDLVQSIDLRSQ-NIGASFDSRIESLDAK 1229

Query: 528  LDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKS 587
            L+++T  FE     +   +++     T +L + +      +   LEEK Q I   +  ++
Sbjct: 1230 LEERTSTFEQSFDTRAAALTETIESRTTKLADAVEQGTGIIASTLEEKTQSISKILEDRT 1289

Query: 588  EELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGH----PQSIVDSISNSTN 643
            + +  + +   ++V   +S+R +     LA+     EETI+       Q++ D +  +  
Sbjct: 1290 DIIAVNLSERVEQVGVSLSNRAEKIGEILAQRSEAIEETISNSLSTFDQAVGDKVEAAAT 1349

Query: 644  NLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSS 703
             + D+   L+ +LS   + +D +L A A  +          LV+R  E +K         
Sbjct: 1350 VITDRAEHLSESLSSGTERIDQALDARAKQISET-------LVSRTREIAK--------- 1393

Query: 704  NNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIE 763
                   F       N+  +++ +    I+   ++++ D  S     +   L S    + 
Sbjct: 1394 ------AFHDGQTEINEALDSRLEEAGSIIVQQSKNLTDALSEQVAEINVSLGSKVFEVA 1447

Query: 764  SELSAISKAMNKSIDD-VETISTALKERCQELGSDLVNHSDKVLSSLK----QAQELLCT 818
              L + SKA+   + D +E I+T + +  ++  + L     +  SSL     + ++L+  
Sbjct: 1448 ETLDSRSKALETILTDRLEAITTTMGDESEKAATTLTTAMAEATSSLGSESTRVRDLILD 1507

Query: 819  TFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEI 878
               Q +D     LA  +      +V+    L   LS + ++L +I  +   +  NSL E 
Sbjct: 1508 VVGQASDR----LAQERDLTTEKVVSSVEQLSGTLSKEGERLQEIVSNSIGEARNSL-EG 1562

Query: 879  QG------------NVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTL 926
            +G            NV  TL      + +++ A+   VA+      +N L    EN + +
Sbjct: 1563 EGEKAAAAVSDAMANVRGTLTKEGDEVAQRVLAT---VAQ-----AANALAVESENARAM 1614

Query: 927  DKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLL 986
                +  +  +   L G  +K+ G +    + +   L   S R +++L+ S   V     
Sbjct: 1615 ---YTATLAEMSGALTGESDKVRGDLSQTIELVTGRLSAESERSKTILAESAEDVR---- 1667

Query: 987  RSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASS 1046
                   +LL  ++DE+      +A   +T            ++E   +LS  V      
Sbjct: 1668 -------KLLAGETDEV------RARVFTT------------IEEAAGTLSTRV------ 1696

Query: 1047 FKYLSDSIQTLAQELVSVIGSMSQSTTDISGK--LEISLDSVNQKIQKCREFFGDNIVAF 1104
             K ++D +   A+ L    GS S   ++I GK   E+ L   N+                
Sbjct: 1697 -KSVADELLVKAENLNDAFGSRSSELSEIIGKDGSELILAIENRA--------------- 1740

Query: 1105 MDEISKVMEISEK---RISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIE 1161
             D  ++V E+       ++ + +E+S +  QN    T +++++  ++   I + S   I 
Sbjct: 1741 HDLTTRVNEVQNAILDAVTVKGREVSDRFAQNGLQATRELVEAGEKIVTAIDERST--IA 1798

Query: 1162 TSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLD 1221
            T+R+ + RE +  + ++   + +S    +V  T++     +   + Q I  + + + +  
Sbjct: 1799 TTRMDDSRE-RMQADMNVLLNAVSTKGQEVADTVTRQGAVATEALTQTIDGIGNTIEDRT 1857

Query: 1222 RALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSM---LLSFKERSNILDNILSQR 1278
            R        V    KE     ET++  + +  + +N S+   L S  E  + ++  L+ R
Sbjct: 1858 R----MAVNVMTGTKER---LETDVSEILTRLNASNGSLRQILASASENLSEVETNLANR 1910

Query: 1279 SMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVT 1338
            + E   +I  A   E  A    I+ Q+      L+     +++D  KI  R+ D +Q + 
Sbjct: 1911 AGEFRTAIDRAV-TETEAANATIEAQVGQ----LRNTTHTVLADAAKIAGRMEDQNQLLG 1965

Query: 1339 TIISDATDSLNKVDERL 1355
              I+D   +   VD R 
Sbjct: 1966 QAIADLEATNTHVDSRF 1982


>gi|217979652|ref|YP_002363799.1| Apolipoprotein A1/A4/E [Methylocella silvestris BL2]
 gi|217505028|gb|ACK52437.1| Apolipoprotein A1/A4/E [Methylocella silvestris BL2]
          Length = 2327

 Score =  152 bits (383), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 323/1704 (18%), Positives = 666/1704 (39%), Gaps = 321/1704 (18%)

Query: 242  RIDNITQNLKQEREAIINHGTQLCTSIAEVHES----LKEELSLTSEEISVHLSRAIDSF 297
            R D +   L    +A+  H  ++   +A V ES    L E+ +   + +S  ++R ++  
Sbjct: 822  RTDELHAQLGATIDAVDAHLEEISRRLAVVSESSVGALAEQTAALQDRLSA-VARTVNEH 880

Query: 298  QSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLN 357
               +  R+A     +   + E  Q +  +I+  L +L+  S  I        E L++T  
Sbjct: 881  AGEISRRLASSARDSVGTLAERTQALEQRIEAALSLLNEKSDAIG-------ERLASTAE 933

Query: 358  NSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFF-SEKQKSITV 416
             S  ++A Q               S AL+E+    + A T+H  E++    +  Q+S   
Sbjct: 934  QSADAVAGQ---------------SEALRERLGAAIAALTAHNEEIARRVEAAAQQSAGA 978

Query: 417  ------TLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIV 470
                  +L + L ++  ++ E  D+    L +T D +   +  RT+ L  R+ A +  + 
Sbjct: 979  LAGQADSLQERLGAVVAAIDEHSDAIAGRLAATADLSAGALAERTDALHERLGAVVGALD 1038

Query: 471  ETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDK 530
            E   +SI            E    L+       G FA+ H                 L +
Sbjct: 1039 E---HSI------------EMSERLEATAHYSIGAFAE-HSEA--------------LHQ 1068

Query: 531  KTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEEL 590
            +     D L++    ++Q T   + RLE+T   ++N+     +   +R+++ +     E 
Sbjct: 1069 R---LNDTLAETLGALTQHTESMSGRLESTAQFTVNAFSGHAQSVHERLEATL----SEA 1121

Query: 591  CSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIM 650
             +S  +    VS  +S+  +  +++L        E +AG   + + ++S+    + +K+ 
Sbjct: 1122 LASLTAHTDDVSTRLSETARQSADALTSPVEALRERLAGAVAATLGALSDHAAEISEKLA 1181

Query: 651  ---------------VLAAALSESQKSLDNSLKAHATDVVHKITNAE----NQLVNRFDE 691
                            L A LSES  +LD    AH  ++  ++T++     N L  R + 
Sbjct: 1182 ATAANSAGALTSQTDALRATLSESLAALD----AHLAEIGARLTSSADISANALGARTEA 1237

Query: 692  SSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRM 751
             S+ +  +   +   L     KH    N   N         L   T  +++      +R 
Sbjct: 1238 LSERLALAVGETLGSL----TKHADDVNQRLNATVGETLLTLGAQTDRVNERLEATTQRS 1293

Query: 752  EELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSD-LVNHSDKVLSSLK 810
               L S + ++++ L++    + +++  +   S  +++R Q +GS  L   +D   S L+
Sbjct: 1294 LGALASHTESLQTRLAST---LGETLGALSGYSDEMQDRLQGIGSQSLAAFADHT-SGLE 1349

Query: 811  QAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTD-------- 862
            +   L+        ++F N L    S+   NL  +S   +   + + Q L +        
Sbjct: 1350 ERLTLML------GEAF-NTLTIQASQLTENLSARSQEAVQAFAGETQALQESFDATAQQ 1402

Query: 863  ----IAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLS 918
                I Y  A D+ +  TE        +  HS+ + E +S+   +  +TF      +  +
Sbjct: 1403 AAAAIGY-HAGDLNDRFTETASQAIDAIAVHSERINEALSSRLAMFEETFLGHGGAVASN 1461

Query: 919  YDENRQTLDKKLSDHIDVLRQNL--------------AG-SENKIDGAIG-------SAS 956
              +  +     LSD +  +   L              AG +   ++G IG       + +
Sbjct: 1462 LSDQTERFTATLSDRLGAIENTLTVRGGDLNERLARRAGETARALEGQIGDFENRTAARA 1521

Query: 957  QFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLST 1016
            Q I   L   + R ++       ++++ L     +  R+L E SD +I+ LD KA  +  
Sbjct: 1522 QEIGQTLQALTERFDAGFESRATALDAALSARAGELARMLGEGSDNVIRALDGKAREIQA 1581

Query: 1017 AVST-----------QTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVI 1065
             +++           +   ++     Q +S++  +DT  S F+ L               
Sbjct: 1582 TLASSAAALAQSLADRAAEIDATFAAQARSIATALDTRVSEFETL--------------- 1626

Query: 1066 GSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQE 1125
                     I+G+L+++   +  + +   E                       I+ RT E
Sbjct: 1627 ---------IAGRLDLTASELESRGRAVAEA----------------------IAARTSE 1655

Query: 1126 ISQQLLQNNDVITNQIIDSTSRVRGEIV-DISNKFIETSRVLEQREEKFHSALDSFSDNI 1184
            I   L Q+   I N  +D   R  G +   +S +  E   +L Q  E             
Sbjct: 1656 IGDTLGQHASDI-NAALD---REHGHVAASLSGRAAEIRDLLTQATE------------- 1698

Query: 1185 SRILLDVDHTISSHTNESRSLIEQRIHEV----KDVLSNLDRALESYGSTVFKQFKEYVQ 1240
                 D+D T++    E    +  R++E+     D LS+++ AL   G  + +   E   
Sbjct: 1699 -----DLDATLAGRAGEIGDALGVRVNEISLALADRLSDIEGALGGRGEALHQGLLE--- 1750

Query: 1241 CFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNV 1300
                + E++  LFD+    ++ +   R   +   ++     + D ++      G+A+V  
Sbjct: 1751 ----SAESLRDLFDRRGFDLVAALSARGGEIAEEMTN----VGDLVTQTIESRGSAIVQH 1802

Query: 1301 IDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTN 1360
            +  +    A A+ +  A L    E        +S  +  +I    D+  K+   +++  +
Sbjct: 1803 LGAKQEELAEAIDRSAAHLRDAFE------AGASASLGALI----DANGKLGAEMNEVID 1852

Query: 1361 RITETTGHIDTVLAESSKLFEKKIKDLGEIS---RVSLLQMSEIVSKFDKNSQILIKSHD 1417
            R+   +  +   ++ ++  F      LG      R  L  +S  V++ ++ +   ++   
Sbjct: 1853 RLVAGSASLQEQISSANLNFAGVETTLGRRMDEFRTVLAAVSGEVARLNEAASETVREAG 1912

Query: 1418 SLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVV 1477
             L +  +  + S+   A++LV    +L  +S  A++  +  L+    +  + DF  +T++
Sbjct: 1913 GLAETIAAHRDSIASSADDLVRSQDQL-DQSLGARRASLETLIGALDLRRR-DF--ETML 1968

Query: 1478 KNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYD 1537
               +  ++ +F  ++G       R+RD    +  ++    ++  + + S   ++ E    
Sbjct: 1969 SAFSGYMEQAFETVEG-------RARDVSAFMSESIGAAASEADQQLASVRASVVEGRER 2021

Query: 1538 LSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTS 1597
             +  MR         I+  FS       QS + F  ++++  D                +
Sbjct: 2022 AAEAMRLACLEANAEIDGFFS-------QSSERFQSAVSDLRD---------------MA 2059

Query: 1598 RRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKN---- 1653
            R I ++L  +R++LK     L +E  + A ++R  + ++I  LK+   ++T S ++    
Sbjct: 2060 RTIQDELATTRELLKTSVAELPQETAQQAASMRKIVADEIKALKELSDIVTRSGRSLDVS 2119

Query: 1654 ------------NAASYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKE---WFNKILS-S 1697
                         A   +  +  +E   +     P   +   N A  E   W + +L+ +
Sbjct: 2120 AAPAPAERPSVAPARRPSPPVRPEEPARASEPPAPIEPRRPQNPAPTERSGWLSDLLARA 2179

Query: 1698 STHS----------KGKSSSHIDISDKDSLSS-----IDSLVENISKFIDYDAFVQLWKS 1742
            ST            + K+ +   IS   + ++     ++++  +I+  ID DAF + W  
Sbjct: 2180 STEETAPARPLRDLRPKALAPAPISSPPATTTQNTRPLEAISLDIAGMIDPDAFAEAWDR 2239

Query: 1743 YTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDS 1802
            Y  GE   F +++Y  +G++ F  ++ +Y+ +   R  IDRY+  FE +L+E+ +   D+
Sbjct: 2240 YRRGEPRPFFEQIYVGRGRQTFDEVRRRYRLNPEFRATIDRYVQEFERLLNELDRDGADA 2299

Query: 1803 PLVQEHIMSNYGKVYTMLVHASGR 1826
             + Q ++ S  G VYTML HASGR
Sbjct: 2300 AMTQNYLASETGMVYTMLAHASGR 2323



 Score =  149 bits (377), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 246/1184 (20%), Positives = 469/1184 (39%), Gaps = 236/1184 (19%)

Query: 56   TTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACE 115
            ++ +    +AS+ Q      PAND D      +L+ +           A ++SL W+A  
Sbjct: 73   SSFAAAVAEASSGQIRRSASPAND-DRHSAGEMLRKLQARPSRTPTIVAAIASLAWVALT 131

Query: 116  LGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSI 175
            LG+L+       + +  + +  P V  L+ +    P++ FF   +MI RA++M   ++S+
Sbjct: 132  LGYLLAH--REALFAGPEGSTLP-VGALYFLTIAGPVVFFFITAMMIRRAQEMRVTARSM 188

Query: 176  AGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENN 235
              +ALRL  PE  ++E+M ++S A+R+E+  M + I+RA++RA ELE  VRSE+  LE +
Sbjct: 189  TEVALRLASPETAATEQMVTLSQAIRREVASMGDGIERALARAGELETLVRSEVSNLERS 248

Query: 236  YTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS------------ 283
            Y+ +E R+  +   L  ER++++ +  ++  +I++ HE++  ++   S            
Sbjct: 249  YSDNERRVRALIDELAAERDSVLANADRVRGAISQTHEAVSRDIETVSTRFSERVGAAAA 308

Query: 284  ----------EEISVHLSRA----IDSFQSIVDVRIAKVTEK----TTRIVQES---AQT 322
                      EEI+  LSR     I+S  +  +  + ++T++    T  + Q S   AQT
Sbjct: 309  EVGASLNAKGEEITNALSRGRDDLIESLSNHGNDLVGRLTQRGEAATADLAQASASVAQT 368

Query: 323  ISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVS 382
            +  ++ ++   L      +  D   R +SLS  L   G  +A+ V +    L    ++ S
Sbjct: 369  LDQRLAEINARLRDAQEALAADLGARGDSLSQRLAVVGAGIADTVSSRGDSLAARLEETS 428

Query: 383  IALKEQSQQFMQAFTSHICEMSNFFS----EKQKSITVTLNDVLQSL------------- 425
              L E       A   H+ E    FS    E+  S   TL+   QSL             
Sbjct: 429  GRLHEVVAVQGGALGDHLAEAGERFSRMIAERVSSARETLDQSGQSLVALFEAGGGRLQS 488

Query: 426  --------------------RISLQEKEDSFCSNLKSTTDNTLREVDNRTN--------T 457
                                  +L    +S   +L  + + T+R +D+  N        T
Sbjct: 489  EFDRNGGDLQRNLLTVAESTAATLSAHTESLRGSLAHSVEETVRRLDDHANRVHTHLSLT 548

Query: 458  LENRITAF----------LKEIVETFNNSITDFSSFYKDNL--------SEFESNLQGNI 499
             ++ I AF          L   +E+   ++ D S+F  + L        ++F    +   
Sbjct: 549  ADDAIAAFAGRSEQLSEQLASTLESTLGALNDHSAFMSERLDSAAEQAATDFAGRSEALH 608

Query: 500  DKLQGCFADSHGNMEDLFLSNIQTIGSNLD----KKTLLFEDILSKKQNNISQITSMNTE 555
            ++L     D+ G + +      + + + LD    +   LF D     Q  +S+       
Sbjct: 609  ERLTATIDDTLGALAE----RSEQVAAGLDASSRRSAALFGDQTEGLQQRLSETLDTLHT 664

Query: 556  RLENTLTNSINSLKDM-------LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDR 608
            RL  T+  ++ +L D        L+   +R  + +G  +E L     ++ + +     D 
Sbjct: 665  RLAATVEETLGALADRSGLVAEELDASSRRSAALLGDHAESLQHQIGATLEALDRHAQD- 723

Query: 609  EKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLK 668
                   L  +  H  +      +S+ + ++ + N L D    ++  L+ S +    +L 
Sbjct: 724  ---LGGRLGALSEHSLDAFVSQTESLHERLNAAINALDDHSNSISRRLAASAQESAGALA 780

Query: 669  AHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQK--------------- 713
            A    +  ++  A +    R DE ++ I    +S+ ++ ET+  +               
Sbjct: 781  AQTQTLQERLAAAVDTASERSDEIARRI---ADSTRDQTETLASRTDELHAQLGATIDAV 837

Query: 714  --HLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISK 771
              HL   +      S+   G L   T  + D  S  A+ + E  H+G          IS+
Sbjct: 838  DAHLEEISRRLAVVSESSVGALAEQTAALQDRLSAVARTVNE--HAGE---------ISR 886

Query: 772  AMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNAL 831
             +  S  D  ++ T L ER Q               +L+Q  E   +   +++D+    L
Sbjct: 887  RLASSARD--SVGT-LAERTQ---------------ALEQRIEAALSLLNEKSDAIGERL 928

Query: 832  ADNQSKFENNLVNQSHLLLDKLSSDIQKLT----------DIAYSKAIDV----ANSLTE 877
            A    +  + +  QS  L ++L + I  LT          + A  ++       A+SL E
Sbjct: 929  ASTAEQSADAVAGQSEALRERLGAAIAALTAHNEEIARRVEAAAQQSAGALAGQADSLQE 988

Query: 878  IQGNVGVTLENHSQAMLEKISASNTLVAK-------TFEECMSNILLSYDENRQTLDKKL 930
              G V   ++ HS A+  +++A+  L A           E +  ++ + DE+   + ++L
Sbjct: 989  RLGAVVAAIDEHSDAIAGRLAATADLSAGALAERTDALHERLGAVVGALDEHSIEMSERL 1048

Query: 931  -----------SDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNN 979
                       ++H + L Q L    + +   +G+ +Q    +    S R+ES    + N
Sbjct: 1049 EATAHYSIGAFAEHSEALHQRL---NDTLAETLGALTQHTESM----SGRLESTAQFTVN 1101

Query: 980  SVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRV 1039
            + +      H++ +  L E    L    D+        VST                 R+
Sbjct: 1102 AFSGHAQSVHERLEATLSEALASLTAHTDD--------VST-----------------RL 1136

Query: 1040 VDTSASSFKYLSDSIQTLAQELVSVI----GSMSQSTTDISGKL 1079
             +T+  S   L+  ++ L + L   +    G++S    +IS KL
Sbjct: 1137 SETARQSADALTSPVEALRERLAGAVAATLGALSDHAAEISEKL 1180


>gi|90419561|ref|ZP_01227471.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1]
 gi|90336498|gb|EAS50239.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1]
          Length = 2567

 Score =  150 bits (379), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 353/1768 (19%), Positives = 715/1768 (40%), Gaps = 258/1768 (14%)

Query: 97   LNIALRNAFMSSLIWLACEL-GFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLF 155
            +  A+  A++  + +++ +L G  I   ++   D F     R   + +   V V+P+LL 
Sbjct: 223  IGAAVSAAWVGIVGYISYDLLGSDIAILSDGIADPF-----RQSELAIMAAVLVIPVLLI 277

Query: 156  FSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAI 215
             +F +M+ R+ DM   S+S+A +ALRL +PE  ++E++ S+  AVR+E+  + E ++RA+
Sbjct: 278  MAFAVMVRRSADMRLMSRSMAEVALRLAEPESIATERVMSVGQAVRREVAALGEGVERAL 337

Query: 216  SRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESL 275
            +R +ELE  V +E+  LE  Y  +E +I  +  +L  ER+A+++H  +L +++   H+ L
Sbjct: 338  ARTAELENVVHNEVSSLERAYADNEAKIRGLVNDLGAERDAMLSHAERLRSAVVGSHQRL 397

Query: 276  KEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLH 335
             E++   S+ I   +  A   F +++D R   +    TR   E    +        E L 
Sbjct: 398  VEDVDGASDHILSRIEDASRRFTTLLDERGDALARDYTRRSDEFVSLVDEHTRNARESLA 457

Query: 336  --STSIV--ITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQ 391
              S S++  I K  D+    LS + +   R +  +  +      N  +++S+A       
Sbjct: 458  KDSDSLIARIAKSADDATSRLSESGDEVARLIELRTADLDDRSRNLIERISVA------- 510

Query: 392  FMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREV 451
              +A +  +       +   +     L  VL    I +    ++F S+L    +  LRE+
Sbjct: 511  -GEAISGLLQTRGETLAGDSEKFLTDLTGVLDDRAIGIAMNGETFLSSLDGAFEERLREI 569

Query: 452  DNRTNTLENR------------------ITAFLKEIVETFNNS----ITDFSSFYKDNLS 489
            D R+N    R                  +T  LK   E         + D +    D   
Sbjct: 570  DERSNGFVGRLSDVGNDITARLSASGDAVTGLLKARGEAVAGESEKFLADLTGVLDDRAI 629

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDL---FLSNIQTIGSNL--------DKKTLLF--- 535
                N +  +  L G F +    +++    F+  +  +G ++        D  T L    
Sbjct: 630  GIAMNGETFLSSLDGAFEERLREIDERSNGFVGRLSDVGYDITARLSASGDAVTGLLKAQ 689

Query: 536  -EDILSKKQNNISQITSMNTERLENTLTNS---INSLKDMLEEKRQRIDSDIGKKSEELC 591
             + +  + +  ++ +T +  +R      N    ++SL    EE+ + ID        E  
Sbjct: 690  GDAVAGESEKFLADLTGVLDDRAIGIAMNGETFLSSLDGAFEERLREID--------ERS 741

Query: 592  SSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMV 651
            + F      V N I+ R     ++++ +     E +AG  +     +++ T+ L D+ + 
Sbjct: 742  NGFVGRLSDVGNDITARLSASGDAVSGLLKARGEAVAGESEKF---LADLTSILDDRSLG 798

Query: 652  LAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIF 711
            LA        SLD + +    ++  K     N L         ++    +S  N+LE   
Sbjct: 799  LAMDSQTFLSSLDEAFETRMREIGEK-----NGLF------LSSLTEDIDSRRNRLEEES 847

Query: 712  QKHLHSFNDTFNNKSDHVSGILKN-STQHIDDLFSNNAKRMEELLHSGSANIESELSAIS 770
             + L +   +   +++  + +L + S++ + DL S  A     L  +G + + + + A +
Sbjct: 848  GRFLQTLESSLGERTEQAARMLSDTSSRTLGDLDSRLAAIDHTLTETGGSLVAT-IEARA 906

Query: 771  KAMNKSIDDVETISTALKERCQELGSDLVNHSDKVL----------------------SS 808
            +A+++S D V   S  L ER QE    L   S +++                      S+
Sbjct: 907  EAVDRSTDRV---SQVLAERSQEFAGALAERSREIMDAFERGHTELTMRAGDAVTLSQSA 963

Query: 809  LKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSD-----IQKLT-- 861
            L++    L T F +R  + + A+ D ++      ++   L  D L+SD     IQ  T  
Sbjct: 964  LEERTGHLRTLFDERI-AGLKAIMDERAGMLAGTLDDRLLAFD-LASDSRVENIQARTGE 1021

Query: 862  -DIAYSKAIDVANSLTEIQGN----VGVTLENHSQAMLEKISASNTLVAKTFEECMSNIL 916
             D A  +    A  L E+ G     +   +E  ++ +   +      + K+  +   +I 
Sbjct: 1022 MDAALER---TAARLEELLGQRREEIEAMVERSAEGLRAALDGRVGAIEKSIADHSEDIE 1078

Query: 917  LSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRD-----------ILDE 965
             ++  ++Q+L   L D    L Q +  +  K++  +G+A   + +           +LDE
Sbjct: 1079 AAFAFSQQSLIGSLDDRGASLTQAIEATVAKLESLVGNAQGAMAEGVDEKTREMARLLDE 1138

Query: 966  NSSRIESLLSCSN-----------NSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCL 1014
                IE+L++ S            +++ S L     +F + LQ +S   I  L+ +   L
Sbjct: 1139 RREAIETLVADSRDGLVNGLDQRIDAIASLLADRVGRFHQSLQSESVRFISGLEEQGGRL 1198

Query: 1015 STAVSTQTINLENNLKEQ----EKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQ 1070
               +  +T NL   L ++    +  ++   D   +       +I+T   E  SV+ S+S+
Sbjct: 1199 IGDIDARTGNLTAGLADRIAANQTQMASAQDALLAGLDDRHAAIRTTLDERTSVLRSLSE 1258

Query: 1071 ST------------TDISGKLEISL----DSVNQKIQKCREFFGDNIVAFMDEISKVMEI 1114
             T              I+G  + ++    D +++++Q  R    D+  A + ++    E 
Sbjct: 1259 ETHSALLSALDERIAGITGGFDDAVRQVADDLSERVQALRSVVEDSRSAIVGDVDSQTER 1318

Query: 1115 SEKRISQRTQEISQQLLQNND-----------VITNQIIDSTSRVR--GEIVDIS----- 1156
              + ++ RTQ     +  N             ++   + + TS +R   E V+ S     
Sbjct: 1319 LRQEMADRTQSFGDDIAINAGAQLVAIENALSMVVEGLEERTSHLRSAAESVEASLGQSL 1378

Query: 1157 -NKFIETSRVLEQREEKFHSALD----SFSDNISRILLDVDHTISSHTNESRSLIEQ--- 1208
              +F     V+++  +     LD    + ++ ++  ++ V   + + T   R L+E+   
Sbjct: 1379 DGRFDRIRTVMQEGRDSLIGELDGRTSTLNEEVNERVMRVTEGLDARTAAMRGLLEEART 1438

Query: 1209 -----------RIHEVKDVLSN--LDRALESYGSTVFKQFKE----YVQCFETNMENM-E 1250
                        IH + D   N  LD  L+   + + ++F+          E  +  M E
Sbjct: 1439 VLIDGLDERMAAIHGMVDGSQNSILD-GLDERTARISQEFEAGRTSIAAAIEERVNGMTE 1497

Query: 1251 SLFDKNNDSMLLS--FKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNA 1308
            +LF+ +   M LS   +ER + L +I+     E + S S       + V   I+Q + + 
Sbjct: 1498 ALFEAD---MRLSAALEERRDSLASIVE----EAARSASATLGDRADDVRRAIEQSVGDV 1550

Query: 1309 ANALKKLEALLISDVEKITNRITDSSQDVTTIISDATD-SLNKVDERLHQTTNRITETTG 1367
            + +L+     L+S +E  ++ +T +    +  IS A +  L  V+  L+ +T +I ++  
Sbjct: 1551 STSLEARRDDLLSALESGSSNLTGAIDQRSDAISSALERGLGNVERTLNTSTAKIADSLR 1610

Query: 1368 HIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETK 1427
            H    +AE++     + +   E       +++E VS  D+  Q      ++ ++   E  
Sbjct: 1611 H---AIAEATTAMSLEARQAREGLEGETAKIAESVSGIDRLFQ--ASGEEARLRIAGEA- 1664

Query: 1428 LSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSS 1487
               D+ A  L  L   L  +++EA     +++ +  +I E     ++ V++++++  +S 
Sbjct: 1665 ---DRLAERLASLADDLAGRAAEAS---TTLVGEGGRIAENISGAAE-VIRSLSEQSRSR 1717

Query: 1488 FI-----------KIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNF-------- 1528
            F            +I GTL +     R+++      LAD  +    TI S F        
Sbjct: 1718 FATEAEELARSINEISGTLRSETEEVRESLAGQRVALADSLSGITTTIASEFERNTRDFA 1777

Query: 1529 VTLKEKSYDL---SNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQK 1585
                E S  +    +  RQ+  S    I         +  +  +    +L    + FT++
Sbjct: 1778 AQFGEASEQIRSAGDESRQRFVSDASAIAEQVEAATARMREMTEAAEVALRENTEGFTRR 1837

Query: 1586 LSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKE--SADTIRSAIEEQINTLKDF 1643
            LS  S  I   + R+A  L    +    +   +  +  E  +++ +R  +EE    ++D 
Sbjct: 1838 LSGASYQIRGETERVAATLEERAERFSEELGGVTTQLSEMLASNALRGELEEATRLIRDE 1897

Query: 1644 QKLITDSVKNNAASYNKGLHSDEYNISQ 1671
                + S+++   +    L  D  N SQ
Sbjct: 1898 LANASQSMRDGVYAVATQLRGDVDNASQ 1925



 Score =  103 bits (256), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 254/1402 (18%), Positives = 553/1402 (39%), Gaps = 250/1402 (17%)

Query: 385  LKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTT 444
            L ++     QA  + + ++ +     Q ++   +++  + +   L E+ ++  + +  + 
Sbjct: 1092 LDDRGASLTQAIEATVAKLESLVGNAQGAMAEGVDEKTREMARLLDERREAIETLVADSR 1151

Query: 445  DNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQG 504
            D  +  +D R +     I + L + V  F+ S+   S  +   L E    L G+ID   G
Sbjct: 1152 DGLVNGLDQRIDA----IASLLADRVGRFHQSLQSESVRFISGLEEQGGRLIGDIDARTG 1207

Query: 505  ----CFAD-------SHGNMEDLFLSNI----QTIGSNLDKKTLLFEDI--------LSK 541
                  AD          + +D  L+ +      I + LD++T +   +        LS 
Sbjct: 1208 NLTAGLADRIAANQTQMASAQDALLAGLDDRHAAIRTTLDERTSVLRSLSEETHSALLSA 1267

Query: 542  KQNNISQITSM---NTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSY 598
                I+ IT        ++ + L+  + +L+ ++E+ R  I  D+  ++E L        
Sbjct: 1268 LDERIAGITGGFDDAVRQVADDLSERVQALRSVVEDSRSAIVGDVDSQTERLRQEMADRT 1327

Query: 599  QKVSN--VISDREKLFS--NSLARVQSHFEET---IAGHPQSIVDSISNSTNNLYDKIMV 651
            Q   +   I+   +L +  N+L+ V    EE    +    +S+  S+  S +  +D+I  
Sbjct: 1328 QSFGDDIAINAGAQLVAIENALSMVVEGLEERTSHLRSAAESVEASLGQSLDGRFDRIRT 1387

Query: 652  LAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIF 711
            +   + E + SL   L    + +  ++    N+ V R  E         ++    +  + 
Sbjct: 1388 V---MQEGRDSLIGELDGRTSTLNEEV----NERVMRVTEG-------LDARTAAMRGLL 1433

Query: 712  QKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSG----SANIESELS 767
            ++      D  + +   + G++  S   I D       R+ +   +G    +A IE  ++
Sbjct: 1434 EEARTVLIDGLDERMAAIHGMVDGSQNSILDGLDERTARISQEFEAGRTSIAAAIEERVN 1493

Query: 768  AISKAMNKSIDDVETISTALKERCQELGS-----------DLVNHSDKVLSSLKQAQELL 816
             +++A+ ++  D+  +S AL+ER   L S            L + +D V  +++Q+   +
Sbjct: 1494 GMTEALFEA--DMR-LSAALEERRDSLASIVEEAARSASATLGDRADDVRRAIEQSVGDV 1550

Query: 817  CTTFAQRNDSFVNALADNQSKFENNLVNQSHLL---LDKLSSDIQKLTDIAYSKAID--- 870
             T+   R D  ++AL    S     +  +S  +   L++   ++++  + + +K  D   
Sbjct: 1551 STSLEARRDDLLSALESGSSNLTGAIDQRSDAISSALERGLGNVERTLNTSTAKIADSLR 1610

Query: 871  -------VANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYD--- 920
                    A SL   Q   G  LE  +  + E +S  + L   + EE    I    D   
Sbjct: 1611 HAIAEATTAMSLEARQAREG--LEGETAKIAESVSGIDRLFQASGEEARLRIAGEADRLA 1668

Query: 921  ENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRI---------- 970
            E   +L   L+         L G   +I   I  A++ IR + +++ SR           
Sbjct: 1669 ERLASLADDLAGRAAEASTTLVGEGGRIAENISGAAEVIRSLSEQSRSRFATEAEELARS 1728

Query: 971  ----------------ESL----------LSCSNNSVNSTLLRSHQKFDRLLQEKS---- 1000
                            ESL          LS    ++ S   R+ + F     E S    
Sbjct: 1729 INEISGTLRSETEEVRESLAGQRVALADSLSGITTTIASEFERNTRDFAAQFGEASEQIR 1788

Query: 1001 ---DELIQLLDNKASCLSTAVSTQTINL-------ENNLKEQEKSLSRVVDTSASSFKY- 1049
               DE  Q   + AS ++  V   T  +       E  L+E  +  +R +  S +S++  
Sbjct: 1789 SAGDESRQRFVSDASAIAEQVEAATARMREMTEAAEVALRENTEGFTRRL--SGASYQIR 1846

Query: 1050 ---------LSDSIQTLAQELVSVIGSMSQ--STTDISGKLEISLDSVNQKIQKCREFFG 1098
                     L +  +  ++EL  V   +S+  ++  + G+LE +   +  ++    +   
Sbjct: 1847 GETERVAATLEERAERFSEELGGVTTQLSEMLASNALRGELEEATRLIRDELANASQSMR 1906

Query: 1099 DNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNK 1158
            D + A   ++   ++ + + +S+  +   + +L     + +Q    ++ ++         
Sbjct: 1907 DGVYAVATQLRGDVDNASQTLSRDAESARELMLAQGGELASQFASISAAIQ--------- 1957

Query: 1159 FIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLS 1218
             +ET R    R+E   SA  S   ++S  + + D  I++        I++R   +  +LS
Sbjct: 1958 -LETERA---RQELLDSA-GSLGQDLSTRMGEADRIIATRARVMGEDIDERTRTLATLLS 2012

Query: 1219 N----LDRALESYGSTVFKQFKE----YVQCFETNMENMESLFDKNNDSMLLSFKERSNI 1270
            +    + R L+     VF++  E      +  ET   +        N +++         
Sbjct: 2013 SRSAEISRILDEEARPVFERLGENGTELARMIETTTRDASDKLRSENAALV--------- 2063

Query: 1271 LDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRI 1330
              + L +R+ E+ +++    ++    ++   +++  +A  A+  +   L  ++  +  R+
Sbjct: 2064 --SALGRRASEVVETL----NRSSGDIIGSFEEKTASAVGAVSDIRDSLQQEIGSLVGRL 2117

Query: 1331 TDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEI 1390
            + +S  +  ++ +A ++L  +D+ L ++  R ++ T      ++ SS+L E  ++ L ++
Sbjct: 2118 SQTSGSLRGLVDEAVENLGAIDQTLRESGARFSQETEEASNSISLSSRLLESNVERLDKL 2177

Query: 1391 SRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSE 1450
            S  +  ++S I  +F  +  +L ++   +   ++  + +L+     + +L++ LV +S E
Sbjct: 2178 SMTAFSKVSAIADRFQDHGTVLGEAVRLIETGEANLRATLEAGHGGIEELSAGLVKRSEE 2237

Query: 1451 AQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLID 1510
                + S+L   +++                         + G     E RSR    LI 
Sbjct: 2238 ----IGSLLHSFEEL-------------------------MGGLFDRTEQRSR----LIS 2264

Query: 1511 HNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQV 1570
              L+    +T+   D    T +E+S   +  MRQ I S I +    F             
Sbjct: 2265 SRLSTEMGETLVEADRQLQTTEERSRATAEAMRQAIQSVIEDASARF------------- 2311

Query: 1571 FLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIR 1630
                     D  T ++ +T+++I        ++L  +R  +KR    L  EA+ES + +R
Sbjct: 2312 ---------DGATAEIRRTAEEIR-------QELETARADIKRGVFELPDEARESTEAMR 2355

Query: 1631 SAIEEQINTLKDFQKLITDSVK 1652
             A+ +QI  L+D   +++ S +
Sbjct: 2356 RAVADQIRALRDLSDVVSHSGR 2377


>gi|319408439|emb|CBI82094.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 1564

 Score =  148 bits (374), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 241/1127 (21%), Positives = 503/1127 (44%), Gaps = 175/1127 (15%)

Query: 783  ISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNL 842
            I+  L+ER  ++ +   N  D VLS++ ++++LL       +D+ V+ + +    F+  +
Sbjct: 528  INANLQERTADIANVFTNGRDNVLSAIDESKKLLREEIQNVDDAIVDIIKERSQDFKLQI 587

Query: 843  VNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQG----NVGVT---LENHSQAML- 894
             +Q  ++ + L+S+  K+ D   ++  ++  +++ I+     N+ +     ENH  A+  
Sbjct: 588  ADQRDIMENMLTSEKDKIADTLKNQIDELTQNVSSIEKTLTDNIQIIDQRAENHLSAIAH 647

Query: 895  --EKISASNTLVAKTFEECMS----NILL-------SYDENRQTLDKKLSDHIDVLRQNL 941
              EK+  + T   KT ++ +     NI +       S   N  +L++ L+D    + Q +
Sbjct: 648  CTEKLQETITQSCKTTQDALEMQAKNIDIRAEALRDSLATNSFSLNEVLADQTRTIEQRM 707

Query: 942  -------AGSENKIDGAIGSASQFIRDILDENSSRI-ESL------LSCSNNSVNSTLLR 987
                   A S+  ID A+      + +I+D N+  I E++      L     ++  TL +
Sbjct: 708  ETIHNIIAKSDIHIDTALKQQMDLVENIIDSNNKTITETVQDHIKNLESHTETLKDTLSQ 767

Query: 988  SHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSF 1047
            S++      + + +   + L+NKA  +   V+T    LE  L E+   +   +    S F
Sbjct: 768  SNETLFETFENRIESFDENLENKAGQIFERVTT----LEEKLSEKMGQICETIKEQTSVF 823

Query: 1048 KYLSDSIQT---LAQELVSVIGSMSQSTTD-ISGKLEISLDSVNQKIQKCREFFGDNIVA 1103
            +  SD+++T   L  E    +    +++ D I G LE S+++V   +             
Sbjct: 824  EERSDTLKTSIALNNEHAQAVQQALETSVDNICGTLENSVNTVTGSLH------------ 871

Query: 1104 FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNK--FIE 1161
                  K+ME S+   S       +Q+  + D       + T++ + ++V+ S +   I 
Sbjct: 872  -----DKLMEASDILAS-----TGEQMFSSLD-------NETNKAQEKLVNASQQAALIM 914

Query: 1162 TSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKD-VLSNL 1220
              +V E+ E    SA + F  ++S +    ++ I    N   S +EQ IH   + +LS L
Sbjct: 915  ADQV-EKSETSILSAGNQFVSSVSDVTAKAENIIFESGNRIVSNVEQTIHNTSEKILSVL 973

Query: 1221 DRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSM 1280
            +           +Q     + F     N ++LF++       +    +  ++ +L++RS 
Sbjct: 974  E-----------EQTAHTAEAFTIAGNNAQTLFNE-------AIYSSTTAIEQLLNERS- 1014

Query: 1281 EISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTI 1340
                              NV+ Q       ++++LE  L   +  + NR+ + +   T+ 
Sbjct: 1015 ------------------NVLYQ-------SMQELENNLGYRLSDVGNRLEEVNNQTTSQ 1049

Query: 1341 ISDATDSLNKVDERLHQTTNRITETTG----HIDTVLAESSKLFEKKIKDLGEISRVSLL 1396
            +S   + L ++ + L+QT     E+ G    HI   LA S++  E++I    E    +  
Sbjct: 1050 VSGYVEHLTELTDYLNQTAQNTAESFGNLTQHISEQLALSTQDAEQRIYAQNEAWMNTFA 1109

Query: 1397 QM-SEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFV 1455
            Q  SE +       + LI +  ++++  +++  S+ +++N L+     + ++ +E     
Sbjct: 1110 QTNSETIQTMATMKEDLINNISAILEQLNQSIYSIHENSNILMSTVQNIDTQFNETTN-- 1167

Query: 1456 MSILVDVKKIVEQADFLSDTVVKNM---TDSIQSSFIKIDGTLSNIETRSR---DTVRLI 1509
             +   +  +  E       T+  NM      +Q++F KI    +N    ++   DT+ ++
Sbjct: 1168 -NFFQNTNQAAEHLSISGQTLHNNMEALQGFMQNTFDKISHITTNFSEHTQTLSDTIHML 1226

Query: 1510 DHNLADIGNKTVKTIDSNFVTLKEKSYDLS----------NHMRQKICSTIPNIENIFST 1559
            + +   +G           VTL+EK   LS          N + Q I      + + F  
Sbjct: 1227 EQSENTLG-----------VTLEEKRNALSTLSNTLISKSNEINQLIRHYEDALSSAFKR 1275

Query: 1560 LEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLA 1619
             +E +  S Q+   +LN   +  + + S  ++DI  ++  I  +L    + +  +   L 
Sbjct: 1276 TDENTRNSTQLLEQTLNQLTNEVSVRFSGAAEDIRKSADEIRLELLKVNNDINENIQKLP 1335

Query: 1620 KEAKESADTIRSAIEEQINTLKDFQKLITDSVKNN-----AASYNKGLHSDEYNISQ--- 1671
             + KE+  T+R  + EQI  LKD   +I +  KN+      ++    L S+  N +    
Sbjct: 1336 AQTKETMQTVRYTLNEQITALKDLANVIQNDDKNSEKEQLMSAAPTSLTSNRVNSTSSET 1395

Query: 1672 ----VDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKS--------SSHIDISDKDSLSS 1719
                V  +P   + ++      W + +L+ ++  K +S         S +      +  S
Sbjct: 1396 TKKIVPPKPIWSQEQSKPNQNRWVSDLLAGASCEKTQSESTNNSPIPSSVQTKSHPANGS 1455

Query: 1720 IDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRN 1779
            ++SL  +I K I+++A V+LW  Y  G+ +I  ++LYT  G+ +F  ++++Y +D   R+
Sbjct: 1456 LNSLATSILKAINHNAIVELWNHYRRGQKNIIPEQLYTSNGKMIFEIIKQKYISDINFRD 1515

Query: 1780 AIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            ++++YI++FE++L ++++S+ ++   +++++S+ GKVYT+L HASGR
Sbjct: 1516 SVNQYIADFEKLLRDVSRSSGNTHTARQYLISDTGKVYTILAHASGR 1562



 Score =  105 bits (263), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 336/1606 (20%), Positives = 652/1606 (40%), Gaps = 318/1606 (19%)

Query: 83   GG--ITHILQNIGKNSL-NIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPE 139
            GG  I H L   G NSL NI    AF++S   LA   G                      
Sbjct: 147  GGAFIAHKLAPAGLNSLANIT---AFITSPTGLAVTAG---------------------- 181

Query: 140  VITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSA 199
                    +++PIL+ + F  +  R+ ++ + +  I   A +L +P+  S ++  +I   
Sbjct: 182  --------TMIPILMSWGFAQLTKRSTELRNIAVLITHAAQQLNEPQHISEKQAIAIGET 233

Query: 200  VRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIIN 259
            +RKE+  M E I+R + RA ELE  ++SE+  LE  Y ++E RI  + + L  ER AI+N
Sbjct: 234  IRKEVAAMNEGIERTLGRAVELEAIIQSEVHNLEQAYAENESRIHKLIEELNNERMAILN 293

Query: 260  HGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQES 319
            H  ++ ++I    E L  E  L                                      
Sbjct: 294  HANRVQSTIKGTQEQLSGEFDLV------------------------------------- 316

Query: 320  AQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTD 379
            A  IS+ ID+L + L  T        + + E L   L+ +G  +  Q       L    +
Sbjct: 317  ASKISTNIDKLTQTLSQT-------LEKQGEDLVTKLSYAGDGITKQ-------LVEKFN 362

Query: 380  KVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSN 439
            + ++ +++++ +F      +    S  F   +K +  T N+      + + +       N
Sbjct: 363  ETTVHIQQKNTEFFDELGKNFDGFSERFDNNEKQLEKTFNETTAKAEMHIAK----IAEN 418

Query: 440  LKSTTDNTLREVDNRTNTLENRIT--------------------AFLKEIVETFNNSITD 479
            +++ TD TL  +D +  T++  I                     A+  +I  TF+N    
Sbjct: 419  IQAATDQTLSSIDEKFKTVDTVIVDRHNQSLQNLDEKIIQLDEQAY--KISSTFDNITAQ 476

Query: 480  FSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDIL 539
                +++ L+  + +L+ + D +   F      +ED    N++ +G  L+  TL    I 
Sbjct: 477  ALEAFENRLANADLSLKEHGDSIIESFISRSQTLED----NVEKLGGFLEAHTL---QIN 529

Query: 540  SKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQ 599
            +  Q   + I ++ T   +N L+ +I+  K +L E+ Q +D  I                
Sbjct: 530  ANLQERTADIANVFTNGRDNVLS-AIDESKKLLREEIQNVDDAI---------------- 572

Query: 600  KVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSES 659
               ++I +R + F   +A  +   E  +      I D++ N  + L   +  +   L+++
Sbjct: 573  --VDIIKERSQDFKLQIADQRDIMENMLTSEKDKIADTLKNQIDELTQNVSSIEKTLTDN 630

Query: 660  QKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQK---HLH 716
             + +D   + H + + H           +  E+   I  S  ++ + LE   +       
Sbjct: 631  IQIIDQRAENHLSAIAH--------CTEKLQET---ITQSCKTTQDALEMQAKNIDIRAE 679

Query: 717  SFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKS 776
            +  D+    S  ++ +L + T+ I+       +RM E +H+  A  +S++  I  A+ + 
Sbjct: 680  ALRDSLATNSFSLNEVLADQTRTIE-------QRM-ETIHNIIA--KSDIH-IDTALKQQ 728

Query: 777  IDDVETI----STALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALA 832
            +D VE I    +  + E  Q+   +L +H++ +  +L Q+ E L  TF  R +SF   L 
Sbjct: 729  MDLVENIIDSNNKTITETVQDHIKNLESHTETLKDTLSQSNETLFETFENRIESFDENLE 788

Query: 833  DNQSKFENNLVNQSHLLLDKLS----------------SDIQKLTDIAYSK--AIDVANS 874
            +   +    +      L +K+                 SD  K T IA +   A  V  +
Sbjct: 789  NKAGQIFERVTTLEEKLSEKMGQICETIKEQTSVFEERSDTLK-TSIALNNEHAQAVQQA 847

Query: 875  LTEIQGNVGVTLENH----SQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKL 930
            L     N+  TLEN     + ++ +K+  ++ ++A T E+  S++    ++ ++ L    
Sbjct: 848  LETSVDNICGTLENSVNTVTGSLHDKLMEASDILASTGEQMFSSLDNETNKAQEKLVNAS 907

Query: 931  SDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNN----SVNSTLL 986
                 ++   +  SE  I   + + +QF+  + D  +++ E+++  S N    +V  T+ 
Sbjct: 908  QQAALIMADQVEKSETSI---LSAGNQFVSSVSDV-TAKAENIIFESGNRIVSNVEQTIH 963

Query: 987  RSHQKFDRLLQEK---SDELIQLLDNKASCL-STAVSTQTINLENNLKEQEKSLSRVVDT 1042
             + +K   +L+E+   + E   +  N A  L + A+ + T  +E  L E+   L + +  
Sbjct: 964  NTSEKILSVLEEQTAHTAEAFTIAGNNAQTLFNEAIYSSTTAIEQLLNERSNVLYQSMQE 1023

Query: 1043 SASSFKY-LSDSIQTLAQELVSVIGSMSQSTTDISGKLE--ISL-DSVNQKIQKCREFFG 1098
              ++  Y LSD    +   L  V    +Q+T+ +SG +E    L D +NQ  Q   E FG
Sbjct: 1024 LENNLGYRLSD----VGNRLEEV---NNQTTSQVSGYVEHLTELTDYLNQTAQNTAESFG 1076

Query: 1099 DNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNK 1158
            +        IS+ + +S       TQ+  Q++   N+   N    + S     +  +   
Sbjct: 1077 N----LTQHISEQLALS-------TQDAEQRIYAQNEAWMNTFAQTNSETIQTMATMKED 1125

Query: 1159 FIET-SRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVL 1217
             I   S +LEQ  +  +S  ++     S IL+     I +  NE+ +   Q  ++  + L
Sbjct: 1126 LINNISAILEQLNQSIYSIHEN-----SNILMSTVQNIDTQFNETTNNFFQNTNQAAEHL 1180

Query: 1218 S-------NLDRALESYGSTVFKQ-------FKEYVQCFETNMENMESLFDKNNDSMLLS 1263
            S       N   AL+ +    F +       F E+ Q     +     + +++ +++ ++
Sbjct: 1181 SISGQTLHNNMEALQGFMQNTFDKISHITTNFSEHTQTLSDTIH----MLEQSENTLGVT 1236

Query: 1264 FKERSN---ILDNILSQRSMEIS-------DSISGAFHKEGNAVVNVIDQQIYNAANALK 1313
             +E+ N    L N L  +S EI+       D++S AF +              N  N+ +
Sbjct: 1237 LEEKRNALSTLSNTLISKSNEINQLIRHYEDALSSAFKRTDE-----------NTRNSTQ 1285

Query: 1314 KLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVL 1373
             LE  L     +++ R + +++D+         S +++   L +  N I E   +I  + 
Sbjct: 1286 LLEQTLNQLTNEVSVRFSGAAEDI-------RKSADEIRLELLKVNNDINE---NIQKLP 1335

Query: 1374 AESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKD 1433
            A++ +  +     L E    +L  ++ ++   DKNS+      + LM A + T L+    
Sbjct: 1336 AQTKETMQTVRYTLNE-QITALKDLANVIQNDDKNSE-----KEQLMSA-APTSLT---- 1384

Query: 1434 ANNLVDLTSRLVSKSSEAQKFVM---SILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIK 1490
                   ++R+ S SSE  K ++    I    +    Q  ++SD +     +  QS    
Sbjct: 1385 -------SNRVNSTSSETTKKIVPPKPIWSQEQSKPNQNRWVSDLLAGASCEKTQSESTN 1437

Query: 1491 IDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTI 1550
                 S+++T+S       + +L  +    +K I+ N +       +L NH R+   + I
Sbjct: 1438 NSPIPSSVQTKSHPA----NGSLNSLATSILKAINHNAIV------ELWNHYRRGQKNII 1487

Query: 1551 P------NIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTS 1590
            P      N + IF  +++K    +  F DS+N  +  F + L   S
Sbjct: 1488 PEQLYTSNGKMIFEIIKQKYISDIN-FRDSVNQYIADFEKLLRDVS 1532


>gi|240141317|ref|YP_002965797.1| hypothetical protein MexAM1_META1p4913 [Methylobacterium extorquens
            AM1]
 gi|240011294|gb|ACS42520.1| hypothetical protein MexAM1_META1p4913 [Methylobacterium extorquens
            AM1]
          Length = 2797

 Score =  147 bits (371), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 280/1605 (17%), Positives = 610/1605 (38%), Gaps = 249/1605 (15%)

Query: 310  EKTTRIVQESAQTISSKIDQ----LLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLA- 364
            E   R+  E A++++   D+    L   L     V  +  + R+  ++  L   G SL  
Sbjct: 1350 EAIARLFDERAESLNHLFDERGGALAADLDQRGRVAVEGLEGRLSDITQALEQGGASLGA 1409

Query: 365  --NQVGNYTLM-LGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDV 421
              ++ G   L  L +   +V   L E + +   AF +   E+      +   +   +   
Sbjct: 1410 LLDRRGTALLATLRDLMGQVDGLLGEGTGRLGHAFETQASEIRTLLDSRADDLRGLMEGS 1469

Query: 422  LQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFS 481
               +R  L+    SF + L           D R  T+ + + A   EI +TF++   D  
Sbjct: 1470 AGRVRGELEAGLGSFETVL-----------DERLRTVRDLLDARSAEIRDTFDHRTDDLR 1518

Query: 482  SFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSK 541
                         ++G   +++  F  S G ++      ++T+   LD ++    D L  
Sbjct: 1519 GL-----------MEGGAGRVRNEFEASLGALDTTLAERVRTVRDLLDARSAEIRDTLDH 1567

Query: 542  KQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKV 601
            + +++  +    + R+      S+ SL   LEE+ + +   +  +S E+ ++ +S   ++
Sbjct: 1568 RTDDLRGLMEDVSGRVGGAFEASLGSLDTTLEERIRMVRELLDARSAEIRNTLDSRTGEL 1627

Query: 602  SNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQK 661
                     L   S   V+  FE  +                        L AAL E  +
Sbjct: 1628 RG-------LVDGSAGHVRGEFETGLG----------------------TLRAALEEPAR 1658

Query: 662  SLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDT 721
            ++ + L                      D  +  I    ++ ++ L T  ++   +  D 
Sbjct: 1659 TVQDLL----------------------DSRAGEIRTMLDARSDDLRTTLEERARTVQDI 1696

Query: 722  FNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSA-NIESELSAISKAMNKSIDDV 780
             ++++  + G+L      +D+ F      ++  L  G+   +E+  + I +A  +     
Sbjct: 1697 LDHRTAEIRGLLDGHAGRLDEGFQGRILPLQAALTEGARLFVETLEAGIGRAAGEVDART 1756

Query: 781  ETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQS-KFE 839
              ++    ER   LG  +     +V  ++++  + L   F + + + + AL D +S    
Sbjct: 1757 RGLAHLFDERLGVLGDIVDGRGQQVAQTVERRSQELRALFDEIH-ATLGALVDERSTALT 1815

Query: 840  NNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISA 899
              L  Q+  L       ++ L  +  S+  + A  +     ++  T+E  S+    +I A
Sbjct: 1816 GRLEAQTQALATVFDERMRSLDGLVESRGGEFARLVENQAASLSQTVEARSEDFTARIDA 1875

Query: 900  SNTLVAKTFEECMSNILLSYDENR---------------QTLDKKLSDHIDVLRQNLAGS 944
                 A       + +  ++DE +                TLD++   H           
Sbjct: 1876 RLRAFATVVANRANALADAFDERQDAYTAQIDGGTARMVATLDERARQH----------- 1924

Query: 945  ENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELI 1004
                      A+QF  + ++E    + +L+      + +TL       +R  Q+ +    
Sbjct: 1925 ----------AAQF--ETVEERQKAVAALIEEGTARIAATL------DERARQQAA--FA 1964

Query: 1005 QLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSV 1064
            +  D +    ++ +   T+ +   L+E+ +  +   +T     + ++  I+     +V+ 
Sbjct: 1965 EAFDGQRESYASVIEQGTVRMVAALEERARRHAAQAETVEERQRAVAALIEEGTSRMVAA 2024

Query: 1065 IGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQ 1124
            +   +Q    ++  L+   D+    I++        +VA +DE +           QR  
Sbjct: 2025 LDERAQRQAALTETLDGQRDAYASVIEEGTA----RMVAALDERA-----------QRQA 2069

Query: 1125 EISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNI 1184
             +++      D   + I   T+R+   + + + +    +   ++++E + + +D      
Sbjct: 2070 ALTEAFDGQRDAYASLIEQGTARMVAALEERARRHAVLAEAFDRQKEAYAALIDG---GT 2126

Query: 1185 SRILLDVDHTISSHTNESRSLIEQR---IHEVKDVLSNLDRALESYGSTVFKQFKEYVQC 1241
            +R++  +D         + +  E++      V D ++ + R LE        + +     
Sbjct: 2127 ARMVAALDERAERQAALAETFDERQNAYAALVDDGIAQMGRMLEERARRHAAEVQARADA 2186

Query: 1242 FETNMEN----MESLFDKNNDSMLLSFKERSNILDNILSQRSM-------EISDSISGAF 1290
                M+     +  + D    ++  +  ER   LD +++ +         E +D+I    
Sbjct: 2187 LAETMDQRNGALARMIDGPAAALADALAEREQALDRLIADKGAPLVEALRERTDAIVVRT 2246

Query: 1291 HKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNK 1350
             +   A+   +D+    +A+ + +    +  DV     RI +++  +  ++  A+++L  
Sbjct: 2247 VESAKALRVALDEGAAASADTVAQAHERVRRDVAGFLTRIENANDGLKDLVGGASENLGA 2306

Query: 1351 VDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQ 1410
            +++ L     +I      +    A++S     ++  L E S+ +L Q S +    D   +
Sbjct: 2307 IEQGLAARVEQIQSALDRVAADTAQASDRVSTQVVALREASQGALAQASSLAETLDARGK 2366

Query: 1411 ILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQAD 1470
             L++   + + A       L+  A NL  +  RL    S  Q  V ++L    ++ E++ 
Sbjct: 2367 ALVERTGTHVGA-------LEAAAGNLEAVEGRLAESLSSRQAVVEAVL---SRLEERSQ 2416

Query: 1471 FLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVT 1530
                  ++  T    S    I+ TL   E R+R+    +  ++A +  +    +  +F  
Sbjct: 2417 -----AIEAQTGRFGSV---IEETLRAAEARARE----LSESVARVAREAGTAVAGDFER 2464

Query: 1531 LKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVF------------------- 1571
            L+  +             +    E + S +EE S + MQ F                   
Sbjct: 2465 LRSGAD----------AESARTAEAVRSAIEEASAKMMQSFAAASGQFGDSVTRMNAMAA 2514

Query: 1572 -----LDSLNNKVDSFTQKLSKTSDDIALTSRRIAED----LNNSRDILKRD--SVSLAK 1620
                 LD+    +      L + + D     RR+  +    LN    ++ R   SV +A+
Sbjct: 2515 EIRRELDATRADLQRGVLDLPRETQDATSEMRRVVAEQIDALNELSALVARSNRSVDVAQ 2574

Query: 1621 EAKES--ADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNI--------- 1669
             A ++  A+  R+A   +  +      +   +   NAA            +         
Sbjct: 2575 PAAQARGAEQRRTAEAGRAVSAAAPAPVSAPAPVRNAAPAAGRSQPASAPVRPANPAAVP 2634

Query: 1670 SQVDKRPSGKKTKNNHAIKEWFNKILSSST------HSKGKSSSHIDISDKDSLS--SID 1721
             QV  RP    T++N     W + +L+ ++       +    +       K  +   S+D
Sbjct: 2635 GQVQGRPG---TRDNRG---WLSDLLTRASLDDDGAEAVPAPAPAAAPEAKGPVERISLD 2688

Query: 1722 SLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAI 1781
            ++  +I++ +D+ A V+ W+ Y  G+ ++F  RLYT++G++ F  +Q +Y+AD+  R  +
Sbjct: 2689 AISTDIARMVDHQASVEFWQRYRQGDTNLFDGRLYTVQGRQTFEQIQRRYRADAEFRRTV 2748

Query: 1782 DRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            DRY+  FE +L E+ +++ D+     ++ S  GKVYTML HASGR
Sbjct: 2749 DRYVGEFERLLGEVTKNDRDTKRADAYLTSETGKVYTMLAHASGR 2793



 Score =  124 bits (310), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 123/604 (20%), Positives = 252/604 (41%), Gaps = 60/604 (9%)

Query: 104 AFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVV--PILLFFSFFIM 161
           A ++S +WL      L+    N        F      +   +V + +  PI+LF    ++
Sbjct: 121 AAIASFLWLDG----LVALAWNQSGGDLKTFITGLTALQAAVVATAIAGPIVLFLITAML 176

Query: 162 ISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASEL 221
             RA +M   ++++  +A+RL +PE +S++ + ++S  VR+E+  + + ++RA++RA EL
Sbjct: 177 AVRAHEMRLVARAVGEVAIRLAEPESFSTDAVLTMSQTVRREVAAVGDGVERALARAGEL 236

Query: 222 EKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSL 281
           E  VR EI  LE  Y+ +E+RI ++   L  +RE+I+    ++  +IA  HE+L  EL  
Sbjct: 237 ETLVRGEISTLERAYSDNEIRIRSLVDELIAQRESIVGSADRVRGAIAGSHENLSSELEG 296

Query: 282 TSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVI 341
            +E I   ++ A +     +D R   +TE    + +     +S++ D L+  L +TS   
Sbjct: 297 AAERIVAAINGAGERVTGALDARGTAITEALGEVGERVVGNVSTRGDDLVRQLTATS--- 353

Query: 342 TKDFDNRIESLSNTLNNSGRSLANQV--------GNYTLMLGNNTDKVSIALKEQSQQFM 393
            +     +E +  TL ++ +  A++V        G  T  L +N   V+ +L E     +
Sbjct: 354 -EGVRGGLEEIGTTLTSALQQRADEVTQAFERTGGALTRTLADNAGAVAQSLSETGTGLI 412

Query: 394 QAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDN 453
           +A       +   F    + +                  E++F S  + T      E+  
Sbjct: 413 EALDRQGGAVRETFERSTRGL------------------EEAFLS--RGT------ELTE 446

Query: 454 RTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQ-GCFADSHGN 512
           R       ITA   E  E  + +     +   ++++   ++L+  I+    G      G 
Sbjct: 447 RFAQTGGAITARFAETGEGLSRNFAATGAAISEDIAVRGASLRTEIEAAGTGVSELIEGR 506

Query: 513 MEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDML 572
             D   +     GS          D  S + + +      +  R   T+      L   +
Sbjct: 507 GRDAQAALALAAGS--------VADDFSTRIDRVRDAFLASATRAAETMDGRGLELAARI 558

Query: 573 EEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQ 632
           E    R+D  I  +   L S+ +++ ++V  ++++R        A+  +  E+ +AG   
Sbjct: 559 EAAASRVDDVIAVQGGALASNLDTAGERVVGLMTER-------AAQAAATVEQALAGLGA 611

Query: 633 SIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDES 692
           S   + + +  +L + +  L   L     +  + ++ +A      +  +   L  R  E+
Sbjct: 612 SFAANANGTAESLGETVARLGQDLDARTGAAQDGIRRNAETATASVGASVEALERRLREA 671

Query: 693 SKNI 696
           ++ +
Sbjct: 672 AEAM 675



 Score = 92.8 bits (229), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 194/1110 (17%), Positives = 421/1110 (37%), Gaps = 176/1110 (15%)

Query: 275  LKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVL 334
            + +ELS  S E +  L+RA +     V  R     E     ++     ++++ +     L
Sbjct: 946  MGDELSARSAEATASLARAAEQAGGEVGGRTESALEALRETLRRLGDEVAARGEATTRAL 1005

Query: 335  HSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQ 394
              T+  +  + + R+ +L ++    GR  A        ++ + +D+    L+  S++ + 
Sbjct: 1006 SRTAEDVGTELETRLGTLEDSFGRHGRGAAA-------LIASQSDEAQARLEGASREVVL 1058

Query: 395  AFTSHICEMSN-------FFSEKQKSITVTLNDVLQSLRISLQEK-------EDSFCSN- 439
            A   H+ ++ +        F E   S T  + + L +   +LQE         D    N 
Sbjct: 1059 AIAGHVSQVGDSLHRSHAAFVETADSRTRAVEEALGNRLAALQETIARGDILADRIAGNA 1118

Query: 440  --LKSTTDNTLREVDN----RTNTLENRITAFLK---EIVETFNNSITDFSSFYKDNLSE 490
              L  T D+ L E+D     + N L + +    +   E VET    +   S+     + E
Sbjct: 1119 QTLGDTLDSRLTEIDRIIAVQGNALADSLAERARLASETVETRIGEMESLSARRAAEIGE 1178

Query: 491  FESNLQGNIDKLQGCFADS-------------------------------HGNMEDLFLS 519
              + L G++D   G  A++                                G+ +D+   
Sbjct: 1179 SFAALVGHVDTRLGARANALNEALVLRSSEIARTLDEGNRILTDALDRRIEGSAQDIA-D 1237

Query: 520  NIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRI 579
              +++G  L  +     + L +   ++++      ERL+  +   +++L   LEE+ + +
Sbjct: 1238 RGRSVGDVLAARAAEIAERLERTTQDLARRLDEGAERLDTGVVARLDALSGTLEERTRHL 1297

Query: 580  DSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIV---D 636
            D   G ++ E      S  + +   ++ R +     L R      E + GH ++I    D
Sbjct: 1298 DESFGIQALEAVRLIESRTRTIDGELTGRIRDLVALLERRSGLAVEALGGHVEAIARLFD 1357

Query: 637  SISNSTNNLYD-KIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKN 695
              + S N+L+D +   LAA L +  +     L+   +D+   +      L    D     
Sbjct: 1358 ERAESLNHLFDERGGALAADLDQRGRVAVEGLEGRLSDITQALEQGGASLGALLDRRGTA 1417

Query: 696  IICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELL 755
            ++ +      +++ +  +        F  ++  +  +L +    +  L   +A R+   L
Sbjct: 1418 LLATLRDLMGQVDGLLGEGTGRLGHAFETQASEIRTLLDSRADDLRGLMEGSAGRVRGEL 1477

Query: 756  HSGSANIESELSAISKAMNKSIDDVET-ISTALKERCQELGSDLVNHSDKVLSSLKQAQE 814
             +G  + E+ L    + +   +D     I      R  +L   +   + +V +  + +  
Sbjct: 1478 EAGLGSFETVLDERLRTVRDLLDARSAEIRDTFDHRTDDLRGLMEGGAGRVRNEFEASLG 1537

Query: 815  LLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANS 874
             L TT A+R                   V     LLD  S++I+   D    +  D+   
Sbjct: 1538 ALDTTLAER-------------------VRTVRDLLDARSAEIRDTLD---HRTDDLRGL 1575

Query: 875  LTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYD----ENRQTLDKKL 930
            + ++ G VG   E           AS   +  T EE +  +    D    E R TLD + 
Sbjct: 1576 MEDVSGRVGGAFE-----------ASLGSLDTTLEERIRMVRELLDARSAEIRNTLDSRT 1624

Query: 931  SDHIDVLRQNLAGSENKIDG-----------AIGSASQFIRDILDENSSRIESLLSCSNN 979
             +    LR  + GS   + G           A+   ++ ++D+LD  +  I ++L   ++
Sbjct: 1625 GE----LRGLVDGSAGHVRGEFETGLGTLRAALEEPARTVQDLLDSRAGEIRTMLDARSD 1680

Query: 980  SVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEK----S 1035
             + +TL    +    +L  ++ E+  LLD  A  L      + + L+  L E  +    +
Sbjct: 1681 DLRTTLEERARTVQDILDHRTAEIRGLLDGHAGRLDEGFQGRILPLQAALTEGARLFVET 1740

Query: 1036 LSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCRE 1095
            L   +  +A      +  +  L  E + V+G +      + G+ +    +V ++ Q+ R 
Sbjct: 1741 LEAGIGRAAGEVDARTRGLAHLFDERLGVLGDI------VDGRGQQVAQTVERRSQELRA 1794

Query: 1096 FFGD---NIVAFMDEISKVMEISEKRISQRTQEIS---------------------QQLL 1131
             F +    + A +DE S  +     R+  +TQ ++                      +L+
Sbjct: 1795 LFDEIHATLGALVDERSTAL---TGRLEAQTQALATVFDERMRSLDGLVESRGGEFARLV 1851

Query: 1132 QNNDVITNQIIDSTS---------RVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSD 1182
            +N     +Q +++ S         R+R     ++N+    +   ++R++ + + +D    
Sbjct: 1852 ENQAASLSQTVEARSEDFTARIDARLRAFATVVANRANALADAFDERQDAYTAQIDG--- 1908

Query: 1183 NISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTV---FKQFKEYV 1239
              +R++  +D     H  +  ++ E++    K V + ++       +T+    +Q   + 
Sbjct: 1909 GTARMVATLDERARQHAAQFETVEERQ----KAVAALIEEGTARIAATLDERARQQAAFA 1964

Query: 1240 QCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + F+   E+  S+ ++    M+ + +ER+ 
Sbjct: 1965 EAFDGQRESYASVIEQGTVRMVAALEERAR 1994


>gi|319899000|ref|YP_004159093.1| hypothetical protein BARCL_0834 [Bartonella clarridgeiae 73]
 gi|319402964|emb|CBI76515.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 1525

 Score =  147 bits (370), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 237/1108 (21%), Positives = 486/1108 (43%), Gaps = 179/1108 (16%)

Query: 783  ISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNL 842
            I+  LKE   ++ +   N  D +LS++ +++++L       +++ ++ + +    F+  +
Sbjct: 531  INVNLKEITTDIANVFTNGHDHILSAVNESKKVLQEEIKNVDNAIIDIIDERSQDFKAQI 590

Query: 843  VNQSHLLLDKLSSDIQKLTD-------IAYSKAIDVANSLTEIQGNVGVTLENHS----- 890
              Q  ++   L ++  K+ D       +      DV   L++    V    ++H+     
Sbjct: 591  AGQRDIIASMLDNEKNKMADTLKDQIDVLTKNVSDVEKMLSQNIQVVDQHAKDHAADIVQ 650

Query: 891  --QAMLEKISASNTLVAKTFEECMSNILLSYDENRQTL-------DKKLSDHIDVLRQNL 941
              + + E I+ S  +     EE   NI +  D  R +L       ++ L+D    L Q +
Sbjct: 651  CTEKLQEVITQSCEITKNALEEQTKNIDIRADALRDSLAINSFSLNEVLADQARTLDQRM 710

Query: 942  -------AGSENKIDGAIGSASQFIRD-ILDENSSRIESL------LSCSNNSVNSTLLR 987
                   A S+  ID A+      + + I++ N +  E++      L    + + +TL +
Sbjct: 711  ETIHNLIAKSDIHIDMALKQQVDLVENAIINNNKAITETVQNHMKNLEGHTDLLKNTLSQ 770

Query: 988  SHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSF 1047
            S+  F   LQ +    + L D      +  V  +   LE  L E+ + +   +D   S+F
Sbjct: 771  SNDVFLDTLQTR----VGLFDENLESRARQVFERAATLEETLSEKLEKVCETIDMQTSTF 826

Query: 1048 KYLSDSIQT---LAQELVSVIG-SMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVA 1103
            +  SD+++T   L  E    +  ++ +S  +I   LE S+++V   +Q+           
Sbjct: 827  EERSDNLKTSIVLNNEHSQAVQEALEESVGNIRISLENSVNTVTDSVQE----------- 875

Query: 1104 FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETS 1163
                  K + ISEK  S               ++ N+    T +    +V   N+FI   
Sbjct: 876  ------KFINISEKLAS---------------IMANE----TEKSEASLVAAGNQFI--- 907

Query: 1164 RVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRA 1223
                           SF+D    + +   + IS  +N   S +EQ +HE           
Sbjct: 908  --------------SSFAD----VAVKATNIISESSNRIVSNVEQTVHETS--------- 940

Query: 1224 LESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEIS 1283
             E   S + +Q     + F T   N ++L ++       +    +  +D +LS+RS    
Sbjct: 941  -EKVISALTEQTAHTAEAFATASNNAQTLINE-------TVHASTEAIDQLLSERS---- 988

Query: 1284 DSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISD 1343
                           N++ Q + +  N L          +  ++NR+ ++    +T IS 
Sbjct: 989  ---------------NILHQSMLDFENNLSH-------QLADVSNRLEEAKNQTSTTISG 1026

Query: 1344 ATDSLNKVDERLHQTTNRITETTGHIDTVLAE----SSKLFEKKIKDLGEISRVSLLQM- 1398
              + L ++ + L+Q     TE+ G++   + E    S++  E+KI    E    +L Q  
Sbjct: 1027 HMEQLTELTDYLNQAAYNTTESIGNLTQQIGEQLSLSTQEAEQKIYAQNESLVNTLAQKN 1086

Query: 1399 SEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSI 1458
            SE +       + LI +  ++++  + +  ++ +++N L+     L  + +E        
Sbjct: 1087 SETIQTMATVQEDLINNVSAVLEQLNHSIYNIHENSNMLISTVQSLDGQLNETASNFFHN 1146

Query: 1459 LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSR---DTVRLIDHNLAD 1515
               V + +  ++ + +  V+ +    Q++F +I    +N    ++   + +R+++     
Sbjct: 1147 TNQVAEYLSTSNQVLNNNVETLQGLSQNTFEQISYITNNFGEHAKTLSEAIRVLE----- 1201

Query: 1516 IGNKTVKTIDSNFVTLKEKSYDLS---NHMRQK---ICSTIPNIENIFSTLEEKSDQSMQ 1569
               ++  T++   +TL+EK   LS   N +  K   +   I + EN+ S + E++D+  +
Sbjct: 1202 ---QSENTLN---ITLQEKQNALSVLSNALVSKSDEVNQLIKHYENVLSLIFERADKDTR 1255

Query: 1570 VFLDSLNNK----VDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKES 1625
               DSL       ++  + + S+ +++I  ++  I  +L+   + +      L ++AKE+
Sbjct: 1256 NSTDSLKQTLHELINEASTRFSEAAENIRFSANEIRLELSKINNDIDESVQKLPEKAKET 1315

Query: 1626 ADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGL-----HSDEYNISQVDKRPSGKK 1680
              TIR A+ EQI  LKD   ++ ++ K+        L      + E N   +  +P  + 
Sbjct: 1316 TQTIRHALSEQITVLKDLTSVMQNTEKDQLVPKTPALLKPNNAAPEVNKKIIPPQPIAQP 1375

Query: 1681 TKNNHAIKEWFNKILS-SSTHSKGKSSSHIDISDKDSL-SSIDSLVENISKFIDYDAFVQ 1738
             ++N   K+W + +L  +S      S+S  +    DS+  S+DSLV +I + I++ A V+
Sbjct: 1376 EQHNTKQKKWVSDLLERASREENNNSASSPEQEKSDSINGSLDSLVSDIVQTINHTAAVE 1435

Query: 1739 LWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQS 1798
            LW  Y  G+ +I  + LYT  G+ +F  ++++Y  D   +++I++YIS+FE++L +I++S
Sbjct: 1436 LWNRYKRGQKNIVIEHLYTPNGKLIFETIRKKYLNDVNFKDSINQYISDFEKLLRDISRS 1495

Query: 1799 NDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            + D  L ++++ S+ GK+YTML HASGR
Sbjct: 1496 SGDIRLARQYLTSDTGKIYTMLAHASGR 1523



 Score =  117 bits (292), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 293/1402 (20%), Positives = 588/1402 (41%), Gaps = 263/1402 (18%)

Query: 76   PANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSF---Y 132
            PAND  +  +    +++ +N+++    +    S +W A    F+      S ++S     
Sbjct: 114  PAND--DITVPFNFRSLKQNAVSRIYWSTTALSALW-ATGGAFIAHKLAPSGLNSLANII 170

Query: 133  DFAMRPEVITLFLVVSV---VPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYS 189
            +F   P    L L V+    +PIL+ + F  +I R+ ++H+ +  +   A RL +P+  S
Sbjct: 171  NFVTSP----LGLAVAAGTTIPILMSWGFAQLIKRSNELHNIAVLMTNAAQRLSEPQNIS 226

Query: 190  SEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQN 249
             ++  +I   +RKE+  M E I+R + RA ELE  ++SE+  LE  Y+++E RI  + + 
Sbjct: 227  EKQAIAIGQTIRKEVAAMNEGIERTLGRAVELEAIIQSEVHNLERAYSENETRIYTLIKE 286

Query: 250  LKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVT 309
            L  ER AI+NH  ++ T I    E L +E  L                          VT
Sbjct: 287  LNNERTAILNHADRVQTVIKGTQEQLSDEFDL--------------------------VT 320

Query: 310  EKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGN 369
             K    V++ AQT+S  + +                  + E L   L+ +G  + NQ   
Sbjct: 321  SKIATNVEQLAQTLSQTLQK------------------QGEDLIKKLSCAGDGVTNQ--- 359

Query: 370  YTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISL 429
                L    ++ +I +++++ +F           +  F   +K +  T N+   +++   
Sbjct: 360  ----LFEKFNETTIQVQQKNTEFFHVLGKTFDTFAERFDNNEKQLEKTFNET--AVKAET 413

Query: 430  QEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLS 489
               + + C  +++ TD TL  +D +  TL+       + I++  N S+ DF+      L 
Sbjct: 414  HIAKLATC--IQTATDQTLSNIDEKFRTLD-------EAIIDRNNQSLKDFNEKIMQ-LD 463

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
            +    L    D +     ++ GN     L N+                 LS K+++ + I
Sbjct: 464  QQAYKLSSKFDNITSEAIEAFGNR----LVNVD----------------LSLKEHSDTII 503

Query: 550  TSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDRE 609
             S      E  L N+   L   LE    +I+ ++ + + ++ + F + +  + + +++ +
Sbjct: 504  ESFIARSKE--LENNAEKLGGFLEAHASQINVNLKEITTDIANVFTNGHDHILSAVNESK 561

Query: 610  KLFSNSLARVQSH-----------FEETIAGHPQSIVDSISNSTN----NLYDKIMVLAA 654
            K+    +  V +            F+  IAG    I   + N  N     L D+I VL  
Sbjct: 562  KVLQEEIKNVDNAIIDIIDERSQDFKAQIAGQRDIIASMLDNEKNKMADTLKDQIDVLTK 621

Query: 655  ALSESQKSL-------DNSLKAHATDVVH-------KITNAENQLVNRFDESSKNIICSY 700
             +S+ +K L       D   K HA D+V         IT +     N  +E +KNI    
Sbjct: 622  NVSDVEKMLSQNIQVVDQHAKDHAADIVQCTEKLQEVITQSCEITKNALEEQTKNIDIRA 681

Query: 701  NSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSA 760
            ++  + L       ++SF+         ++ +L +  + +D       +RM E +H+  A
Sbjct: 682  DALRDSLA------INSFS---------LNEVLADQARTLD-------QRM-ETIHNLIA 718

Query: 761  NIESELSAISKAMNKSIDDVETI----STALKERCQELGSDLVNHSDKVLSSLKQAQELL 816
              +S++  I  A+ + +D VE      + A+ E  Q    +L  H+D           LL
Sbjct: 719  --KSDIH-IDMALKQQVDLVENAIINNNKAITETVQNHMKNLEGHTD-----------LL 764

Query: 817  CTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDK-------LSSDIQKLTDIAYSKAI 869
              T +Q ND F++ L      F+ NL +++  + ++       LS  ++K+ +      I
Sbjct: 765  KNTLSQSNDVFLDTLQTRVGLFDENLESRARQVFERAATLEETLSEKLEKVCE-----TI 819

Query: 870  DVANSLTEIQGN---VGVTLEN-HSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQT 925
            D+  S  E + +     + L N HSQA           V +  EE + NI +S + +  T
Sbjct: 820  DMQTSTFEERSDNLKTSIVLNNEHSQA-----------VQEALEESVGNIRISLENSVNT 868

Query: 926  LDKKLSDHIDVLRQNLAG-----SENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNS 980
            +   + +    + + LA      +E      + + +QFI    D  + +  +++S S+N 
Sbjct: 869  VTDSVQEKFINISEKLASIMANETEKSEASLVAAGNQFISSFADV-AVKATNIISESSNR 927

Query: 981  VNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVV 1040
            + S +       ++ + E S+++I  L  + +  + A +T + N +  + E   + +  +
Sbjct: 928  IVSNV-------EQTVHETSEKVISALTEQTAHTAEAFATASNNAQTLINETVHASTEAI 980

Query: 1041 DTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGD- 1099
            D      + LS+    L Q ++    ++S    D+S +LE + +  +  I    E   + 
Sbjct: 981  D------QLLSERSNILHQSMLDFENNLSHQLADVSNRLEEAKNQTSTTISGHMEQLTEL 1034

Query: 1100 ----NIVAF--MDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIV 1153
                N  A+   + I  + +   +++S  TQE  Q++   N+ + N +    S     + 
Sbjct: 1035 TDYLNQAAYNTTESIGNLTQQIGEQLSLSTQEAEQKIYAQNESLVNTLAQKNSETIQTMA 1094

Query: 1154 DISNKFI-ETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHE 1212
             +    I   S VLEQ     + ++ +  +N S +L+    ++    NE+ S      ++
Sbjct: 1095 TVQEDLINNVSAVLEQ----LNHSIYNIHEN-SNMLISTVQSLDGQLNETASNFFHNTNQ 1149

Query: 1213 VKD-------VLSNLDRALESYGSTVFKQFKEYVQCFETNMENMES---LFDKNNDSMLL 1262
            V +       VL+N    L+      F+Q       F  + + +     + +++ +++ +
Sbjct: 1150 VAEYLSTSNQVLNNNVETLQGLSQNTFEQISYITNNFGEHAKTLSEAIRVLEQSENTLNI 1209

Query: 1263 SFKERSN---ILDNILSQRSMEISDSISGAFHKEGNAVVNVI----DQQIYNAANALKKL 1315
            + +E+ N   +L N L  +S E++  I    H E   V+++I    D+   N+ ++LK+ 
Sbjct: 1210 TLQEKQNALSVLSNALVSKSDEVNQLIK---HYEN--VLSLIFERADKDTRNSTDSLKQT 1264

Query: 1316 EALLISDVEKITNRITDSSQDV-----------TTIISDATDSLNKVDERLHQTTNRITE 1364
               LI++    + R +++++++           + I +D  +S+ K+ E+  +TT  I  
Sbjct: 1265 LHELINEA---STRFSEAAENIRFSANEIRLELSKINNDIDESVQKLPEKAKETTQTIRH 1321

Query: 1365 TTGHIDTVLAESSKLFEKKIKD 1386
                  TVL + + + +   KD
Sbjct: 1322 ALSEQITVLKDLTSVMQNTEKD 1343


>gi|220926373|ref|YP_002501675.1| hypothetical protein Mnod_6604 [Methylobacterium nodulans ORS 2060]
 gi|219950980|gb|ACL61372.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 2955

 Score =  146 bits (369), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 299/1644 (18%), Positives = 624/1644 (37%), Gaps = 292/1644 (17%)

Query: 300  IVDVRIAKVTEKTTRIVQESAQTISSKIDQLL----EVLHSTSIVITKDFDNRIESLSNT 355
            +V+ ++  + E++ R   E    IS+  D L+    + L + +  + +    R   ++  
Sbjct: 1483 VVETQLGALEERSARRSAE----ISANFDTLVGHVDKHLGARATALNEALIVRAGEIARA 1538

Query: 356  LNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSIT 415
            +   GR +A         L    D++  A+  QSQ    A  +   E+ +    + + +T
Sbjct: 1539 MAEGGREVAQ-------ALDARADELVRAITAQSQAMSDALLARAGEIGSELGRRTEELT 1591

Query: 416  VTLND--------VLQSL---RISLQEK----EDSFCSNLKSTTDNTLREVDNRTNTLEN 460
              ++         VL+ L     +L E+    ED+F    +      LR+++ RT  ++ 
Sbjct: 1592 ERMDAGASRFDERVLRRLDGVAAALDERSRLIEDTFGGQAQ----EILRQIETRTRAIDE 1647

Query: 461  RITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSN 520
             ++A  +E+V           SF +        +L G+ + ++  F      +  L    
Sbjct: 1648 ELSARTRELV-----------SFVETQSGTASRDLAGHAEAIRAAFEGRAEMLNRLVEER 1696

Query: 521  IQTIGSNLDKKTLLFEDILSKK-----------QNNISQITSMNTERLENTLTNSINSLK 569
               + + LD++       L ++             +++++     E +   L  ++    
Sbjct: 1697 TAAMAAELDERGRAMFGTLGQRVTELARLFDRGGASLAELLERRGETIVGRLQEAVAEAD 1756

Query: 570  DMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAG 629
              LE    R+   +  ++  L   F      V +   DR K   + +    +     + G
Sbjct: 1757 RTLEAGGTRLQEGVVARTAALAELFTERGASVDHAFEDRLKRLGSLVDEQAAMIHALLDG 1816

Query: 630  HPQSIVDSISNSTNNLYDKIMVLAAA----LSESQKSLDNSLKAHATDVVHKITNAENQL 685
              + +  S+      L+D +   AAA    L     +L + L      +V ++      L
Sbjct: 1817 QAEILRASLDERIRALHDILDQRAAAMRGLLDGQAGALGSVLDERGQGLVRQLEAQVGDL 1876

Query: 686  VNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFS 745
                DE ++++   ++     L+ + ++   +F +T   +++ ++ ++            
Sbjct: 1877 TGAVDERTRDLATLFDRRIAALDLLVERRGAAFAETVETRANALAALVDG---------- 1926

Query: 746  NNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKV 805
                R E    +    ++  + ++ +++   IDD   + TA++   Q   S LV      
Sbjct: 1927 ----RAEAFARA----VDDRVVSLGQSLQARIDD---LGTAVERGAQAF-SGLVEERRAA 1974

Query: 806  LSSLKQAQELLCTTFAQRNDSFVNALAD-NQSKFENNLVNQSHLLLDKLSSDIQKLTDIA 864
            L+ L      L     + N+  + AL D  Q+     +  ++  L   L   +Q L+   
Sbjct: 1975 LAQLLDGGAGLREVL-EENERAIAALLDARQTALAREMHARTTTLASVLDERMQSLSG-- 2031

Query: 865  YSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQ 924
                                TLE   QA+ E + A +   A+  +E ++ +  + ++  Q
Sbjct: 2032 --------------------TLERGGQALTEAMGAGDA-AARALQERVAALSEAVEQGTQ 2070

Query: 925  TLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNST 984
             L   L D                    G A++F+  +++  S  + S L     + +  
Sbjct: 2071 AL-VSLFD--------------------GRAAEFL-GLIESRSGALGSTLQARIAAFSEA 2108

Query: 985  LLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSA 1044
            +      F  L++ +++E  ++LD +   L+  +  Q   L+  +     + +  V+T A
Sbjct: 2109 MAERDAAFAGLVEGRTEEFRRVLDERGEALAARLQAQIAALDGTVAAGADAFAETVETRA 2168

Query: 1045 SSFKYLSDSIQTLAQELVSVIGSMSQS-TTDISGKLEISLDSVNQKIQKCREFFGDNIVA 1103
             +   L   +Q  ++ L   +   S + T  I G++      V  + +   + F D   A
Sbjct: 2169 QALAAL---LQERSEALSGAVDERSAAFTARIDGRMRAFAALVAARGEALADAFDDRSDA 2225

Query: 1104 FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVD-----ISNK 1158
            +   +        + + +R+  +   L + N  + +   D  +     ++D     +S  
Sbjct: 2226 YAALVDARTAALTQALDERSAALEAALDERNASLASGF-DRRAAALAALIDQRSATLSRS 2284

Query: 1159 FIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLS 1218
              ET+R L Q       ALD     +SR L   D  + +       +++ R   +   L 
Sbjct: 2285 LAETARELVQ-------ALDGPGAALSRSL---DERVGALAE----IVDGRGQALGRTLE 2330

Query: 1219 NLDRAL---------------ESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLS 1263
            +  RAL               E+ G+TV     + V         + +L D    +++ +
Sbjct: 2331 DSARALQEAIDARGTALVASLEASGATVVGGLDQQVAA-------LRALVDGPGTALVSA 2383

Query: 1264 FKERSNILD-----------NILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANAL 1312
              ERS  L            + L +RS E+++    A  +   ++    DQ    A  AL
Sbjct: 2384 LGERSEALGQSLEQGVGAVLDTLHRRSQELAE----AVSRAAASLDAAADQGAARAVEAL 2439

Query: 1313 KKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTV 1372
             ++ A L  D+  +  R+  +   +  +I  A D+L  +++ L     R+ +  G +  +
Sbjct: 2440 TQVNARLGGDLGALLGRVESACLGLQELIGSAGDNLIAIEDGL---AGRVQQIQGALAEI 2496

Query: 1373 LAESSKLFE---KKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLS 1429
              E+ +  E    ++  L + +  +L Q S + +  D   + L +S    +        +
Sbjct: 2497 AEETGRASEHVSGRVAALQDAATGALRQASSLAAALDARGKALGESTRQHLA-------T 2549

Query: 1430 LDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFI 1489
            L + A  L  +  R+ +  +E Q  +  +L    +I E+A  L        T S +    
Sbjct: 2550 LTEAAGQLEGVEGRMAAALTERQAAIDGLLA---RIDERATAL--------TASTEGLGG 2598

Query: 1490 KIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICST 1549
            +++ TL  +E R++     +   LA+      + +   F  L+  S D            
Sbjct: 2599 RVEETLRGVEARTQ----ALSSALAESARSAGEALAEAFERLR-GSAD---------AQG 2644

Query: 1550 IPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRD 1609
                E +   +E  S +    F ++   +     + L   + DI    RR    L+  R 
Sbjct: 2645 TQAAEAVRKVVEGASGELQGAFGEA-ATRFQGTVESLRGMAADI----RRT---LDEIRT 2696

Query: 1610 ILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVK--NNAASYNKGLHSDEY 1667
             L++   ++ +E +++   +R  + +QI  L +   L+  S +  + AA     + S E 
Sbjct: 2697 DLQQGVTAIPQETQDATSEMRRVVADQIKALNELSALVARSGRAVDVAAPKTAEIRSAEI 2756

Query: 1668 NISQVDK--------------------------------------------RPSGKKTKN 1683
              ++  +                                            +P G     
Sbjct: 2757 RSAEASRVAEAGRPAAPAPARPAPAATPAARGPAMRPAPAAPAPAAPAGRAKPGGTG--- 2813

Query: 1684 NHAIKEWFNKILSSSTHSKGKSSSHIDISDKD-SLSSIDSLVENISKFIDYDAFVQLWKS 1742
                  W + +LS ++  +  + +       D  L +IDS+  NI++ ID+ A V LW+ 
Sbjct: 2814 ------WLSDLLSRASQDEAPAEAGGPKRGADEGLGTIDSISGNIARMIDHQAAVTLWER 2867

Query: 1743 YTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDS 1802
            Y  GE ++F++ LYT +GQ+ F  ++ +Y+A+   +  +DRY+  FE +L E+++++ D 
Sbjct: 2868 YRQGESNLFTRDLYTAQGQQTFDEIRRRYQAEPEFQRTVDRYVREFERLLGEVSRADKDP 2927

Query: 1803 PLVQEHIMSNYGKVYTMLVHASGR 1826
                 ++ S  GKVYTML HASGR
Sbjct: 2928 RRANAYLTSETGKVYTMLAHASGR 2951



 Score =  117 bits (292), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 94/367 (25%), Positives = 170/367 (46%), Gaps = 42/367 (11%)

Query: 72  SGFYP------ANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGF--LIKFY 123
            G  P      AND D  GI  + Q++           AF+++ IWLA   GF  L    
Sbjct: 79  GGLLPPDRSLVAND-DRRGIGAMRQSLRVQPSRTPYLLAFLAAAIWLA---GFAGLAWAQ 134

Query: 124 TNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLI 183
            N  +  F    +      +     + P+LLFF   ++  RA++M   ++++  +A+RL 
Sbjct: 135 ANGDIRGFL-AGLSGLQGAVGAAAVLAPVLLFFIAAMLAVRAQEMRLVARAVGDVAIRLA 193

Query: 184 DPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRI 243
           +PE +S++ + ++S AVR+E+  + + ++RA++RA ELE  VR EI  LE  Y+ +E+RI
Sbjct: 194 EPEAFSTDAVLTMSQAVRREVAAVGDGVERALARAGELETLVRGEISTLERAYSDNEIRI 253

Query: 244 DNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISV-------HLSRAIDS 296
             +   L  +RE+I+ +  ++  +I   H++L +EL   +  I          ++ ++ S
Sbjct: 254 RALVDELVAQRESIVANAERVRGAIQGSHQNLTQELDTAATRIVAAVDGVGERVTASLGS 313

Query: 297 FQSIVDVRIAKVTEKTTRIVQES----AQTISSKIDQLLEVLHSTSIVITKDFDNRIESL 352
               +   + +  E+ T  + E+    AQ +S + D LL+ L +T            E +
Sbjct: 314 RGEEITTALGRKGEEITTALAETGERVAQAVSGEGDGLLQRLAATG-----------EGI 362

Query: 353 SNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQK 412
              L  +G +LA         L   TD+V+ A+   S     A +    E++    +   
Sbjct: 363 RTGLGEAGDALAA-------TLQARTDEVTRAIGHTSGLLTTALSDSAGEVARVLGQTGA 415

Query: 413 SITVTLN 419
            +  TLN
Sbjct: 416 GVIETLN 422


>gi|163868474|ref|YP_001609683.1| hypothetical protein Btr_1324 [Bartonella tribocorum CIP 105476]
 gi|161018130|emb|CAK01688.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 1519

 Score =  144 bits (363), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 285/1324 (21%), Positives = 590/1324 (44%), Gaps = 218/1324 (16%)

Query: 618  RVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHK 677
            RVQS    TI G  + + D     T+ +   +  LA  LS++       L+    D+V K
Sbjct: 297  RVQS----TIKGTQEQLSDEFGLVTSKIVTNVEKLAQTLSQT-------LQKQGEDLVEK 345

Query: 678  ITNA----ENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGIL 733
            ++ A     NQLV +F++++  I        N+LE    K+   F   F++    +    
Sbjct: 346  LSYAGDGVTNQLVEKFNKTTTQIQQKNTEFFNELE----KNFDGFAKQFDHNEKQIEKAF 401

Query: 734  KNST----QHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM----NKSIDDVETIST 785
              +      H+  + ++     ++ LH+    ++ +  A+ KA+    N+S+ + +    
Sbjct: 402  NETAVKAEMHVAKIATHIQAATDQTLHA----VDEKFKALDKALIDRNNQSLQNFDEKIL 457

Query: 786  ALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRN----DSFV---NALADNQSKF 838
             L ++  +L S   N + + + + +Q    +  +  + +    DSF+    AL DN  K 
Sbjct: 458  KLDDQAHKLSSQFDNVTSQAIGAFEQRLATVDLSLKEHSNSIIDSFIERSQALEDNAEKL 517

Query: 839  ENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKIS 898
             N L  ++H+L  K++ ++Q+       K  D+ ++ T           N  +A+L  I 
Sbjct: 518  GNFL--EAHVL--KINENLQE-------KTADITHAFT-----------NGREAILSAID 555

Query: 899  ASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQF 958
             S   + +  +   + I+    E  Q    +LSD   ++   L   +NKI   + +    
Sbjct: 556  KSKESLREEIQHVDNAIVDIIQERSQDFKLQLSDQRALMADMLDNEKNKIADTLRNQI-- 613

Query: 959  IRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAV 1018
              D+L +N+S IE +L+ +   V+    ++      ++Q  +D+L +++    +    A+
Sbjct: 614  --DVLAQNTSHIEKVLTDNAQIVDK---KAENHIANIIQ-CTDKLQEVIVQSCNTTQDAL 667

Query: 1019 STQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGK 1078
              Q  N++        SL+     S S  + L+D  +TL Q + ++   +++S  DI  +
Sbjct: 668  EAQARNIDIRADALRDSLAI---NSFSLNEVLADQARTLEQRMETIHNLIAKS--DI--R 720

Query: 1079 LEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVIT 1138
            ++++L    Q+I               D +   +  + K I++  Q+  + L  + +++ 
Sbjct: 721  VDVAL---KQQI---------------DLVESAIAANNKNITETVQDHIKNLESHAEILK 762

Query: 1139 NQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSH 1198
            N +  S           S  F ET   LE R E F + L+  +  I      ++ T+S  
Sbjct: 763  NTLSQS-----------SGVFFET---LETRMESFDTNLEDRAHKIVERTTTLEETLSEK 808

Query: 1199 TNE-------SRSLIEQRIHEVKD--VLSN-----LDRALESYGSTVFKQFKEYVQCFET 1244
              +         S+IE+R   +K   +L+N     + +ALES    +    ++ V     
Sbjct: 809  FGQVCEAIDMQTSVIEERSDTLKASLMLNNEQSQIIQQALESSVDNMRVSLEDSVNTVTD 868

Query: 1245 NMEN----MESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNV 1300
            N+ N       +     + +L S  + +   +NILS+    I  ++    +     V++V
Sbjct: 869  NLHNKIIKASDILSSTTEQILSSVTDVTAQAENILSESGNRIVSNVKKTVYDTSEKVLSV 928

Query: 1301 IDQQIYNA----ANALKKLEALL-------ISDVEKITNRITD----SSQ---------- 1335
            + +Q  +     A A    +ALL        + +E+I N   D    S Q          
Sbjct: 929  LSEQTAHTVEAFATASHNAQALLNETVHTSTTAIEQILNERCDVLHHSMQNLKNNLGYQL 988

Query: 1336 -DVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVS 1394
             DVT+ + DA    N+   ++ +   +ITE T H++     +++  +   + +GE   +S
Sbjct: 989  SDVTSRLEDAK---NQTATQISEHVGKITELTNHLNQAAQNTTESIDSLTQHIGEQLSLS 1045

Query: 1395 LLQMSEIVSKFDKNSQILIKSHD-----SLMKAQSETKLSLDKDANNLVDLTSRLVSKSS 1449
                        +N++  I +H+     SL KA SET  ++      LV+  S ++ + +
Sbjct: 1046 T-----------QNAEQRIYAHNESLVNSLNKANSETLQTVTVIKEELVNNVSSILKQLN 1094

Query: 1450 EA----QKFVMSILVDVKKIVEQADFLSDTVVKN---MTDSIQSSFIKIDGTLSNIETRS 1502
            ++    Q+    +L  V+ I  Q +  ++   +N   + + + +S   ++  +  ++  S
Sbjct: 1095 QSIYNFQENSHVVLSAVQNIDGQFNETANNFFRNTNQVAECLSASNQALNNNVEILQGLS 1154

Query: 1503 RDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQK----------------- 1545
            + T   I+H  ++ G +  +T+      L++    LS+ + +K                 
Sbjct: 1155 KSTFEQINHITSNFG-EHARTLSQTIQVLEQSENSLSSTLEEKHNTLSLLSDALVSKSHE 1213

Query: 1546 ICSTIPNIENIFSTLEEKSDQSMQ----VFLDSLNNKVDSFTQKLSKTSDDIALTSRRIA 1601
            I   I + E IF+   E+SD++ +     F  SLN  +   + + S  ++DI  ++  + 
Sbjct: 1214 INQMIEHYEKIFNLALERSDKNARNATDSFQQSLNRLISEASTRFSGAAEDIRRSADEVR 1273

Query: 1602 EDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKN------NA 1655
             +L+   + +  ++  L ++ KE+  TIR+A+ EQI  LKD   +I +  K       +A
Sbjct: 1274 LELSKINNDIHENAKKLPEKTKETTQTIRTALNEQITALKDLVSVIQNDQKGTTQQLTSA 1333

Query: 1656 ASYNKGLHSDEYNISQ-----VDKRPSGKKTKNNHAIKEWFNKILSSSTHSKG------- 1703
               +  L+    N S+     +  RP  ++ ++  + ++W + +L  ++  +        
Sbjct: 1334 FPPSSMLNKRSENSSESIKKIIPPRPVLQQNQSKKSPRKWVSNLLERASREEPFYDEPLN 1393

Query: 1704 -KSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQK 1762
               S+ +    + + SS+++L   I + I+++A V+LW  Y  G+ +I ++RLYT+ G+ 
Sbjct: 1394 EAISTSVQTKPRPANSSLNALASGIVQAINHNAIVELWDHYQRGQKNIITERLYTLNGKT 1453

Query: 1763 VFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVH 1822
            +F  ++ +Y +D   ++++++Y+S+FE++L +I++S+  S  V+++++S+ GKVYTML H
Sbjct: 1454 IFEMIKRKYMSDFEFKHSVNQYVSDFEKLLRDISRSSGSSNSVRKYLISDTGKVYTMLAH 1513

Query: 1823 ASGR 1826
            ASGR
Sbjct: 1514 ASGR 1517



 Score =  103 bits (256), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 262/1271 (20%), Positives = 534/1271 (42%), Gaps = 188/1271 (14%)

Query: 148  SVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLM 207
            + +PIL+ +    +  R+ ++H+ +  +   A RL +P++ S ++  +I   +R+E+  M
Sbjct: 182  TAIPILISWGVAQLTKRSNELHNIAILMTNAAQRLSEPQQLSEKQAIAIGQTIREEVAAM 241

Query: 208  TEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTS 267
             E I+R + RA ELE  ++ E+  LE  Y ++E RI  + + L  ER AI+NH  ++ ++
Sbjct: 242  NEGIERTLGRAVELEAIIQGEVHNLEQAYAENESRIHTLIKELSNERIAILNHADRVQST 301

Query: 268  IAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKI 327
            I    E L +E  L                          VT K    V++ AQT+S   
Sbjct: 302  IKGTQEQLSDEFGL--------------------------VTSKIVTNVEKLAQTLSQ-- 333

Query: 328  DQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKE 387
                         + K  ++ +E LS     +G  + NQ       L    +K +  +++
Sbjct: 334  ------------TLQKQGEDLVEKLS----YAGDGVTNQ-------LVEKFNKTTTQIQQ 370

Query: 388  QSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNT 447
            ++ +F      +    +  F   +K I    N+      + + +      +++++ TD T
Sbjct: 371  KNTEFFNELEKNFDGFAKQFDHNEKQIEKAFNETAVKAEMHVAK----IATHIQAATDQT 426

Query: 448  LREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFA 507
            L  VD +   L+       K +++  N S+ +F         E    L     KL   F 
Sbjct: 427  LHAVDEKFKALD-------KALIDRNNQSLQNF--------DEKILKLDDQAHKLSSQFD 471

Query: 508  DSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINS 567
            +        F   + T+  +L + +    D   ++    SQ    N E+L N L   +  
Sbjct: 472  NVTSQAIGAFEQRLATVDLSLKEHSNSIIDSFIER----SQALEDNAEKLGNFLEAHVLK 527

Query: 568  LKDMLEEK-----------RQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSL 616
            + + L+EK           R+ I S I K  E L          + ++I +R + F   L
Sbjct: 528  INENLQEKTADITHAFTNGREAILSAIDKSKESLREEIQHVDNAIVDIIQERSQDFKLQL 587

Query: 617  ARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSL-DNSLKAHATDVV 675
            +  ++   + +      I D++ N       +I VLA   S  +K L DN+       +V
Sbjct: 588  SDQRALMADMLDNEKNKIADTLRN-------QIDVLAQNTSHIEKVLTDNA------QIV 634

Query: 676  HKITNAENQLVNRF---DESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGI 732
             K   AEN + N     D+  + I+ S N++ + LE   +          + ++D +   
Sbjct: 635  DK--KAENHIANIIQCTDKLQEVIVQSCNTTQDALEAQARN--------IDIRADALRDS 684

Query: 733  LKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQ 792
            L  ++  ++++ ++ A+ +E+ + +    I      +  A+ + ID VE+   A  +   
Sbjct: 685  LAINSFSLNEVLADQARTLEQRMETIHNLIAKSDIRVDVALKQQIDLVESAIAANNKNIT 744

Query: 793  ELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDK 852
            E   D +        +L+   E+L  T +Q +  F   L      F+ NL +++H ++++
Sbjct: 745  ETVQDHI-------KNLESHAEILKNTLSQSSGVFFETLETRMESFDTNLEDRAHKIVER 797

Query: 853  LSSDIQKLTD--IAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEE 910
             ++  + L++      +AID+  S+ E + +   TL    +A L   +  + ++ +  E 
Sbjct: 798  TTTLEETLSEKFGQVCEAIDMQTSVIEERSD---TL----KASLMLNNEQSQIIQQALES 850

Query: 911  CMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRI 970
             + N+ +S +++  T+   L + I      L+ +  +I  ++   +    +IL E+ +RI
Sbjct: 851  SVDNMRVSLEDSVNTVTDNLHNKIIKASDILSSTTEQILSSVTDVTAQAENILSESGNRI 910

Query: 971  ESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLL----DNKASCLSTAVSTQTINLE 1026
             S       +V  T+  + +K   +L E++   ++       N  + L+  V T T  +E
Sbjct: 911  VS-------NVKKTVYDTSEKVLSVLSEQTAHTVEAFATASHNAQALLNETVHTSTTAIE 963

Query: 1027 NNLKEQEKSLSRVVDTSASSFKY-LSDSIQTLAQELVSVIGSMSQSTTDIS---GKLEIS 1082
              L E+   L   +    ++  Y LSD    L         + +Q+ T IS   GK+   
Sbjct: 964  QILNERCDVLHHSMQNLKNNLGYQLSDVTSRLE-------DAKNQTATQISEHVGKITEL 1016

Query: 1083 LDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQII 1142
             + +NQ  Q   E   D++   + E          ++S  TQ   Q++  +N+ + N + 
Sbjct: 1017 TNHLNQAAQNTTESI-DSLTQHIGE----------QLSLSTQNAEQRIYAHNESLVNSLN 1065

Query: 1143 DSTSRVRGEIVDISNKFI-ETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNE 1201
             + S     +  I  + +   S +L+Q     + ++ +F +N S ++L     I    NE
Sbjct: 1066 KANSETLQTVTVIKEELVNNVSSILKQ----LNQSIYNFQEN-SHVVLSAVQNIDGQFNE 1120

Query: 1202 SRSLIEQRIHEVKDVLSNLDRA-------LESYGSTVFKQFKEYVQCFETNMENME---S 1251
            + +   +  ++V + LS  ++A       L+    + F+Q       F  +   +     
Sbjct: 1121 TANNFFRNTNQVAECLSASNQALNNNVEILQGLSKSTFEQINHITSNFGEHARTLSQTIQ 1180

Query: 1252 LFDKNNDSMLLSFKERSN---ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNA 1308
            + +++ +S+  + +E+ N   +L + L  +S EI+  I   + K  N  +   D+   NA
Sbjct: 1181 VLEQSENSLSSTLEEKHNTLSLLSDALVSKSHEINQMIEH-YEKIFNLALERSDKNARNA 1239

Query: 1309 ANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRIT----E 1364
             ++ ++    LIS+    + R + +++D+     +    L+K++  +H+   ++     E
Sbjct: 1240 TDSFQQSLNRLISEA---STRFSGAAEDIRRSADEVRLELSKINNDIHENAKKLPEKTKE 1296

Query: 1365 TTGHIDTVLAE 1375
            TT  I T L E
Sbjct: 1297 TTQTIRTALNE 1307


>gi|154248044|ref|YP_001419002.1| hypothetical protein Xaut_4123 [Xanthobacter autotrophicus Py2]
 gi|154162129|gb|ABS69345.1| hypothetical protein Xaut_4123 [Xanthobacter autotrophicus Py2]
          Length = 1411

 Score =  143 bits (360), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 241/1184 (20%), Positives = 479/1184 (40%), Gaps = 212/1184 (17%)

Query: 77   ANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFY-----TNSPMDSF 131
            AND D   I  +L  + K S       A  +S +W+   + F   ++     +++ ++S 
Sbjct: 112  AND-DRQTIGQLLGQLQKRSAATPYYWAAGASALWIIAGIAFAFAYHRALVASSNGVESL 170

Query: 132  YDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSE 191
            +     P ++ +F  + ++P L FF    ++ R+ ++   ++S+  +ALRL  PE  ++E
Sbjct: 171  FGS---PALLGIFASI-LLPPLAFFGLASVLRRSLELQGIARSMTEVALRLAQPESIATE 226

Query: 192  KMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLK 251
             + ++  AVR+E+  M + +DRAISRA ELE  VR+E+ +LE  Y ++E RI ++   L+
Sbjct: 227  TVVTVGQAVRREVAAMGDGVDRAISRAGELEAMVRAEVSILERAYEENEARIRSLIDELR 286

Query: 252  QER-----------------EAIIN----------HGTQLCTSIAEVHESLKEELSLTSE 284
             ER                 EA+++          HGT +     E  E + E L    E
Sbjct: 287  NERHNIQIETERLREGIVSAEAVLSNEVKDVASRIHGTMM-----EASEQVTEILGQKGE 341

Query: 285  EISVHLSRAIDSFQSIVDVRIAKVTEKTTRI----------VQESA----QTISSKIDQL 330
             I+  L+R  D   S++D   AK  E   R+          + ES      T+ S+ D L
Sbjct: 342  HITAALARVGD---SMIDGLTAKGGELIDRLQLTGSDIRQDLSESGDLLVHTLKSRTDDL 398

Query: 331  LEVLHSTSIVITKDFDNRIESLSNTLN----NSGRSLANQVGNYTLMLGNNTDKVSIALK 386
               L ST+  + +  D   E ++  ++      G +LA+    +   +     +V+ AL+
Sbjct: 399  STNLLSTTSDVAQLIDRWGEDITANIDRLKHGIGETLADNSNRFAEDIDQRVSQVNTALR 458

Query: 387  EQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDN 446
              S+  +Q F+    E+   F E  + +  TL     S+R +           +++T + 
Sbjct: 459  ATSENAVQDFSIRGGELIKKFEETGERVAQTL-----SVRGT------DLADRIETTGNR 507

Query: 447  TLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCF 506
                V  R   L+ R+    + I  + + S T   + + D  +E  S+L  NI       
Sbjct: 508  IYDAVAVRGEDLQQRLAETGERITASLDRSSTQVVAAFVDKGNEISSSL--NI-----AG 560

Query: 507  ADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSIN 566
            +D    +  +     Q IG+   K    F +                 + L  T+    +
Sbjct: 561  SDMTERLSRVAGEVTQAIGARGSKVNEAFRE---------------TADMLVATIGVKGD 605

Query: 567  SLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEET 626
            ++K+ML  + + I+  I     +L    +     ++  + +  + F  ++        E 
Sbjct: 606  AIKEMLTARLKAIEETITVGGADLAERLHHDGSAIARTMQEGVRAFDTTMKVHAPELVEQ 665

Query: 627  IAGHPQSIVDSISNSTNNLYDKIMV----LAAALSESQKSLDNSLKAHATDVVHKITNAE 682
            IA    ++ +++ ++T+ L +++      +A  + +    ++ +L   +  +   +    
Sbjct: 666  IAHRVAAVNENLKHATSTLDERLSATTDNVATIMDQRISRIEQTLDQRSQSLTETLATRT 725

Query: 683  NQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDD 742
                    E +K+   S + S   LET F     +  D    +++ V+  +      I  
Sbjct: 726  VTFARTIAEGTKSATESLDKSVETLETFFASRSKALGDVLTERAEVVNRNIGTRASEIAS 785

Query: 743  LFSNNAKRMEELLHSGSANIESELSAISKAMNKS-IDDVETISTALKERCQELGSDLVNH 801
            +      R+EEL+      + + L     A+  + +  +ET+S  L+    E+       
Sbjct: 786  VLDGRVHRIEELVLGRLDGVATSLEVRGGALADTLVGRIETVSGTLRAEASEV------- 838

Query: 802  SDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLT 861
             ++ LSSL Q    +  T  + ++   +AL          L   +HL+ DK  + +  L 
Sbjct: 839  -ERSLSSLSQN---VSRTLTEHSEKVADALG-------TRLTEIAHLIDDKNGTFLSALE 887

Query: 862  DIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDE 921
              +     ++  + T ++ +VG        +++E+++ +N     TF   MS  + + D 
Sbjct: 888  RTSQRAVAEITATNTSLKSDVG--------SIIERLAEANA----TFHGAMSTAVNNLDA 935

Query: 922  NRQTLDKKLSDH---IDVLRQNLAGSENKIDGAI--------GSASQFI---------RD 961
               +  +++      +D + QN   +  +  G +        G+ +Q           R 
Sbjct: 936  FSGSFARQVEGFGATVDGISQNADATAYRFQGQVDALREVSNGALAQMASLAERLEQNRQ 995

Query: 962  ILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQ--------------LL 1007
            ++DE +      L  + + V+STL       D+L    S  L+Q              +L
Sbjct: 996  LMDEAA----RTLGTAQDQVDSTLAARRGDMDQL----SQSLVQRIADVDARVSAFHAML 1047

Query: 1008 DNK-----------ASCLSTAVSTQTINLENNL--------KEQEKSLSRVVDTSASSFK 1048
            D             AS +S A S  T  +EN L        +E+E++ + + +T A++  
Sbjct: 1048 DQTFSAAQERARQIASVVSEATSGSTQAVENQLSLVRTAADQERERTAAALRETYAAA-- 1105

Query: 1049 YLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEI 1108
             L+D +QTL        G      T+++G L+   + V Q I   RE     I+    E+
Sbjct: 1106 -LAD-VQTL-------FGETGNRFTEVAGDLKRVAEDVQQAITLAREEMKRGIL----EL 1152

Query: 1109 SKVMEISEKRISQRTQEISQQLLQNNDVITNQ-----IIDSTSR 1147
                E S   + +   E  + L + N+++  Q     ++++++R
Sbjct: 1153 PAETEASAATMRRAVAEQIKALAELNEIVARQGQALDVVETSAR 1196



 Score =  139 bits (351), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 177/909 (19%), Positives = 372/909 (40%), Gaps = 183/909 (20%)

Query: 999  KSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLA 1058
            K D + ++L  +   +   ++    +L   L     +++R +     +F     +++  A
Sbjct: 603  KGDAIKEMLTARLKAIEETITVGGADLAERLHHDGSAIARTMQEGVRAFDT---TMKVHA 659

Query: 1059 QELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDE-ISKVMEISEK 1117
             ELV  I   +     ++  L+ +  ++++++        DN+   MD+ IS++    E+
Sbjct: 660  PELVEQI---AHRVAAVNENLKHATSTLDERLSATT----DNVATIMDQRISRI----EQ 708

Query: 1118 RISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSAL 1177
             + QR+Q +++ L          I + T     E +D S + +ET          F S  
Sbjct: 709  TLDQRSQSLTETLATRTVTFARTIAEGTKSAT-ESLDKSVETLETF---------FASRS 758

Query: 1178 DSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKD-VLSNLDR---ALESYGSTVFK 1233
             +  D ++     V+  I +  +E  S+++ R+H +++ VL  LD    +LE  G  +  
Sbjct: 759  KALGDVLTERAEVVNRNIGTRASEIASVLDGRVHRIEELVLGRLDGVATSLEVRGGALAD 818

Query: 1234 QFKEYVQCFETNMENMESLFDKNNDSML----LSFKERSNILDNILSQRSMEIS---DSI 1286
                 ++     +    S  +++  S+      +  E S  + + L  R  EI+   D  
Sbjct: 819  TLVGRIETVSGTLRAEASEVERSLSSLSQNVSRTLTEHSEKVADALGTRLTEIAHLIDDK 878

Query: 1287 SGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATD 1346
            +G F       ++ +++    A   +      L SDV  I  R+ +++      +S A +
Sbjct: 879  NGTF-------LSALERTSQRAVAEITATNTSLKSDVGSIIERLAEANATFHGAMSTAVN 931

Query: 1347 SLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFD 1406
            +L+       +       T   I      ++  F+ ++  L E+S  +L QM+ +  + +
Sbjct: 932  NLDAFSGSFARQVEGFGATVDGISQNADATAYRFQGQVDALREVSNGALAQMASLAERLE 991

Query: 1407 KNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIV 1466
            +N Q++ ++  +L  AQ +   +L     ++                             
Sbjct: 992  QNRQLMDEAARTLGTAQDQVDSTLAARRGDM----------------------------- 1022

Query: 1467 EQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDS 1526
               D LS ++V+ + D        +D  +S              H +          +D 
Sbjct: 1023 ---DQLSQSLVQRIAD--------VDARVSAF------------HAM----------LDQ 1049

Query: 1527 NFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNK-------V 1579
             F   +E++  +++ + +    +   +EN  S +   +DQ  +    +L          V
Sbjct: 1050 TFSAAQERARQIASVVSEATSGSTQAVENQLSLVRTAADQERERTAAALRETYAAALADV 1109

Query: 1580 DSFTQKLSKTSDDIALTSRRIAEDLNNS----RDILKRDSVSLAKEAKESADTIRSAIEE 1635
             +   +      ++A   +R+AED+  +    R+ +KR  + L  E + SA T+R A+ E
Sbjct: 1110 QTLFGETGNRFTEVAGDLKRVAEDVQQAITLAREEMKRGILELPAETEASAATMRRAVAE 1169

Query: 1636 QINTLKDFQKLIT------DSVKNNAASYNK----------------------GLHSDEY 1667
            QI  L +  +++       D V+ +A +  +                      GL   E 
Sbjct: 1170 QIKALAELNEIVARQGQALDVVETSARTATQDAARASAVREASRETSRSRSEGGLLQSEL 1229

Query: 1668 NISQVD---------KRPSGKKTKNNHAI---------KEWFNKILSSSTHSKGKSSSHI 1709
              S            +RP+ +      ++         + W  ++L+ ++ S        
Sbjct: 1230 RRSAPPAAPRRAEPVERPAPRPAPVRESVSRETQGEEQEGWLTELLARASDS-------- 1281

Query: 1710 DISDKDSLS------------SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYT 1757
             ++D+D  +            S+D+L  +I++ +D+ A  ++W  +  GE+ +FS+RLYT
Sbjct: 1282 -LNDEDRPAARAPQAPAANTVSLDTLSADIARMVDHQAAGEMWDRHNKGENHVFSRRLYT 1340

Query: 1758 IKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVY 1817
             +GQ+ F  L+ +Y+AD+  R  +DRY++ FE +L +++  +  S L + ++ S+ GKVY
Sbjct: 1341 AQGQQAFDTLKRRYRADAEFRETVDRYVTEFERLLEQVSGDDRGSALAKTYLTSDTGKVY 1400

Query: 1818 TMLVHASGR 1826
            TML HA+GR
Sbjct: 1401 TMLAHAAGR 1409


>gi|240850698|ref|YP_002972098.1| hypothetical protein Bgr_11550 [Bartonella grahamii as4aup]
 gi|240267821|gb|ACS51409.1| hypothetical protein Bgr_11550 [Bartonella grahamii as4aup]
          Length = 1519

 Score =  140 bits (354), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 284/1288 (22%), Positives = 551/1288 (42%), Gaps = 191/1288 (14%)

Query: 706  KLETIFQKHLHSFNDTFNNKSDHVSGILKN-STQHIDDLFSNNAKRMEELLHSGSANIES 764
            +LE I Q  +H+    +      +  ++K  S + I  L  N+A R++  +      +  
Sbjct: 254  ELEAIIQGEVHNLEQAYAENESRIHTLIKELSNERIAIL--NHADRVQSTIKGTQEQLSD 311

Query: 765  ELSAISKAMNKSIDDVETISTALKERCQELGSDLVNH----SDKVLSSLKQAQELLCTTF 820
            E   ++   +K + +VE ++  L +  Q+ G DLV       D V + L +      T  
Sbjct: 312  EFGLVT---SKIVTNVEKLAQTLSQTLQKQGEDLVEKLSYAGDGVTNQLVEKFNETTTQI 368

Query: 821  AQRNDSFVNALADNQSKFE--------------NNLVNQSHLLLDKLSSDIQKLTDIAYS 866
             Q+N  F + L  N   F               N    ++ + + K+++ IQ +TD    
Sbjct: 369  QQKNTDFFHELGKNFDGFAKRFDHNEKQIEKTFNETAEKAEVHVAKIATHIQAVTDQTLH 428

Query: 867  ------KAIDVA------NSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSN 914
                  KA+D A       SL      + + L++ +  +  K     +     FE+ ++ 
Sbjct: 429  AVDEKFKALDKALIDRNNQSLQNFDEKI-LKLDDQAHKLSSKFDNVTSQAIGAFEQRLAT 487

Query: 915  ILLSYDE------------------NRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSAS 956
            + LS  E                  N + L   L  H+  + +NL      I  A  +  
Sbjct: 488  VDLSLKEHSDSIIDSFIERSQALEDNAEKLGNFLESHVLKINENLQEKTADITHAFTNGR 547

Query: 957  QFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLST 1016
            + I   +D++   +   +   +N++   +    Q F   L ++   +  +LDN+ + ++ 
Sbjct: 548  EAILSAIDKSKESLREEIQYVDNAIVDIIQERSQDFKVQLSDQRALMADMLDNEKNKIAD 607

Query: 1017 AVSTQTINLENNLKEQEKSLS---RVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTT 1073
             +  Q   L  N    EK L+   +VVD  A +  ++++ IQ   ++L  VI     +T 
Sbjct: 608  TLRNQIDVLSQNTSHIEKVLAENIQVVDKQAEN--HITNIIQ-CTEKLQDVIVQSCNTTQ 664

Query: 1074 DI----SGKLEISLDSVNQKIQ----KCREFFGDNIVAF---MDEISKVMEISEKRI--- 1119
            D     +  ++I  D++   +        E   D        M+ I  ++  S+ R+   
Sbjct: 665  DALEAQARNIDIRADALRDSLAINSFSLNEVLADQARTLEQRMETIHNLIAKSDIRVDVA 724

Query: 1120 -SQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRV----LEQREEKFH 1174
              Q+   +   ++ NN  IT  + D    +      + N   ++S V    LE R E F 
Sbjct: 725  LKQQIDLVESAIVANNKNITETVQDHIKNLESHAEILKNTLSQSSGVFFETLETRMESFD 784

Query: 1175 SALDSFSDNISRILLDVDHTISSHTNE-------SRSLIEQRIHEVKD--VLSN-----L 1220
            + L+  +  I      ++ T+S   ++         S+IE+R   +K   +L+N     +
Sbjct: 785  TDLEDRAHKIFERTTTLEETLSEKFSQICEAIDMQTSVIEERSDTLKTSLMLNNEQSQII 844

Query: 1221 DRALESYGSTVFKQFKEYVQCFETNMEN----MESLFDKNNDSMLLSFKERSNILDNILS 1276
             +ALES    +    ++ V     N+ N       +    ++ +L S    +   +NILS
Sbjct: 845  QQALESSVDNMRVTLEDSVNIVTDNLHNKIIKASDILSSTSEQILSSVTNVTTQAENILS 904

Query: 1277 QRSMEISDSISGAFHKEGNAVVNVIDQQIYNA----ANALKKLEALL-------ISDVEK 1325
            +    I  ++    +     V++V+ +Q  +     A A    +ALL        + +E+
Sbjct: 905  ESGNRIVSNVKKTVYDTSEKVLSVLSEQTAHTVEAFATASHNAQALLNETIHTSTTAIEQ 964

Query: 1326 ITNRITD----SSQ-----------DVTTIISDATDSLNKVDERLHQTTNRITETTGHID 1370
            + N   D    S Q           DVT+ + DA    N+   ++ +   +ITE T H++
Sbjct: 965  VLNERCDVLHHSMQNLKNNLGYQLSDVTSRLEDAE---NQTATQISKHVGKITELTNHLN 1021

Query: 1371 TVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSL 1430
                 +++  +   + +GE  ++SL    E   +   +++ L+   +SL KA SET  ++
Sbjct: 1022 QAAQNTTESIDSLTQHIGE--QLSL-STQEAEQRIYAHNEFLV---NSLTKANSETLQTI 1075

Query: 1431 DKDANNLVDLTSRLVSKSSEA----QKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQS 1486
                  LV+  S ++++ +++     +    +L  V+ I  Q +  ++   +N TD +  
Sbjct: 1076 TVMKEELVNNVSSVLTQLNQSIYNFNENSNVLLSAVQNIDGQFNESANNFFRN-TDQVAE 1134

Query: 1487 SFIKIDGTLSN----IETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHM 1542
                 +  L+N    ++  S++T   I H  +  G +  KT+      L++    LS  +
Sbjct: 1135 RLSASNQALNNNVEILQRLSKNTFEQISHITSSFG-EHAKTLSQTIHVLEQSENSLSTTL 1193

Query: 1543 RQK-----------------ICSTIPNIENIFSTLEEKSDQ----SMQVFLDSLNNKVDS 1581
             +K                 I   I + E IF++  E+SD+    S   F  SLN  V  
Sbjct: 1194 EEKHNTLSVLSDALVSKSHEINQLIGHYEKIFNSALERSDKNARNSTNSFQQSLNRLVSE 1253

Query: 1582 FTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLK 1641
             + + S+ ++DI  ++  +  +L+   + +  +   L ++ KE+  TIR+A+ EQI  L+
Sbjct: 1254 ASARFSEAAEDIRRSADEVRLELSKINNDINENVKKLPEKTKETTQTIRTALNEQITALQ 1313

Query: 1642 DFQKLITDSVKNNAASYNKGLHSDEYNISQVDKRP-----SGKKTKNNHAI------KEW 1690
            D   +I    +N+  S  K L S+    S  ++R      S KK      I      K+ 
Sbjct: 1314 DLVSVI----QNDQKSAKKQLISEFPASSTFNQRSDNSTESVKKIVPPKPILQQDQSKKR 1369

Query: 1691 FNKILSSSTHSKGKSSSHIDISDKDSL------------SSIDSLVENISKFIDYDAFVQ 1738
             NK +S+      +  +  D    D++            SS++SL   I + I+++A V+
Sbjct: 1370 PNKWVSNLLERASREETFYDAPPSDNVLTSVQTKPSPANSSLNSLASGIVQAINHNAIVE 1429

Query: 1739 LWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQS 1798
            LW  Y  G+ +I ++RLYT+ GQK+F  ++ +Y +D   + ++++Y+++FE++L +I++S
Sbjct: 1430 LWDHYQRGQKNIVTERLYTLNGQKIFEMIKRKYMSDFEFKRSVNQYVTDFEKLLRDISRS 1489

Query: 1799 NDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +  S  V+++++S+ GKVYTML HASGR
Sbjct: 1490 SGSSSSVRKYLISDTGKVYTMLAHASGR 1517



 Score =  110 bits (274), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 255/1274 (20%), Positives = 530/1274 (41%), Gaps = 194/1274 (15%)

Query: 148  SVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLM 207
            + +PIL+ +    +  R+ D+H+ +  +   A RL +P+  S ++  +I   +R+E+  M
Sbjct: 182  TAIPILISWGVAQLTKRSNDLHNIALLMTNAAQRLSEPQHLSEKQAIAIGQTIREEVAAM 241

Query: 208  TEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTS 267
             E I+R + RA ELE  ++ E+  LE  Y ++E RI  + + L  ER AI+NH  ++ ++
Sbjct: 242  NEGIERTLGRAVELEAIIQGEVHNLEQAYAENESRIHTLIKELSNERIAILNHADRVQST 301

Query: 268  IAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKI 327
            I    E L +E  L                          VT K    V++ AQT+S  +
Sbjct: 302  IKGTQEQLSDEFGL--------------------------VTSKIVTNVEKLAQTLSQTL 335

Query: 328  DQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKE 387
             +                  + E L   L+ +G  + NQ       L    ++ +  +++
Sbjct: 336  QK------------------QGEDLVEKLSYAGDGVTNQ-------LVEKFNETTTQIQQ 370

Query: 388  QSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNT 447
            ++  F      +    +  F   +K I  T N+  +   + + +      +++++ TD T
Sbjct: 371  KNTDFFHELGKNFDGFAKRFDHNEKQIEKTFNETAEKAEVHVAK----IATHIQAVTDQT 426

Query: 448  LREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFA 507
            L  VD +   L+       K +++  N S+ +F         E    L     KL   F 
Sbjct: 427  LHAVDEKFKALD-------KALIDRNNQSLQNF--------DEKILKLDDQAHKLSSKFD 471

Query: 508  DSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINS 567
            +        F   + T+  +L + +    D   ++    SQ    N E+L N L + +  
Sbjct: 472  NVTSQAIGAFEQRLATVDLSLKEHSDSIIDSFIER----SQALEDNAEKLGNFLESHVLK 527

Query: 568  LKDMLEEK-----------RQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSL 616
            + + L+EK           R+ I S I K  E L          + ++I +R + F   L
Sbjct: 528  INENLQEKTADITHAFTNGREAILSAIDKSKESLREEIQYVDNAIVDIIQERSQDFKVQL 587

Query: 617  ARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVH 676
            +  ++   + +      I D++ N  + L      +   L+E+ + +D   + H T+++ 
Sbjct: 588  SDQRALMADMLDNEKNKIADTLRNQIDVLSQNTSHIEKVLAENIQVVDKQAENHITNII- 646

Query: 677  KITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNS 736
                   Q   +  +    I+ S N++ + LE   +          + ++D +   L  +
Sbjct: 647  -------QCTEKLQDV---IVQSCNTTQDALEAQARN--------IDIRADALRDSLAIN 688

Query: 737  TQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGS 796
            +  ++++ ++ A+ +E+ + +    I      +  A+ + ID VE+   A  +   E   
Sbjct: 689  SFSLNEVLADQARTLEQRMETIHNLIAKSDIRVDVALKQQIDLVESAIVANNKNITETVQ 748

Query: 797  DLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSD 856
            D +        +L+   E+L  T +Q +  F   L      F+ +L +++H + ++ ++ 
Sbjct: 749  DHI-------KNLESHAEILKNTLSQSSGVFFETLETRMESFDTDLEDRAHKIFERTTTL 801

Query: 857  IQKLTDIAYSK---AIDVANSLTEIQGNVGVT--LENHSQAMLEKISASNTLVAKTFEEC 911
             + L++  +S+   AID+  S+ E + +   T  + N+ Q+          ++ +  E  
Sbjct: 802  EETLSE-KFSQICEAIDMQTSVIEERSDTLKTSLMLNNEQSQ---------IIQQALESS 851

Query: 912  MSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIE 971
            + N+ ++           L D ++++  NL     K    + S S+ I   +   +++ E
Sbjct: 852  VDNMRVT-----------LEDSVNIVTDNLHNKIIKASDILSSTSEQILSSVTNVTTQAE 900

Query: 972  SLLSCSNN----SVNSTLLRSHQKFDRLLQEKSDELIQLL----DNKASCLSTAVSTQTI 1023
            ++LS S N    +V  T+  + +K   +L E++   ++       N  + L+  + T T 
Sbjct: 901  NILSESGNRIVSNVKKTVYDTSEKVLSVLSEQTAHTVEAFATASHNAQALLNETIHTSTT 960

Query: 1024 NLENNLKEQEKSLSRVVDTSASSFKY-LSDSIQTLAQELVSVIGSMSQSTTDIS---GKL 1079
             +E  L E+   L   +    ++  Y LSD    L         + +Q+ T IS   GK+
Sbjct: 961  AIEQVLNERCDVLHHSMQNLKNNLGYQLSDVTSRLE-------DAENQTATQISKHVGKI 1013

Query: 1080 EISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITN 1139
                + +NQ  Q   E   D++   + E          ++S  TQE  Q++  +N+ + N
Sbjct: 1014 TELTNHLNQAAQNTTESI-DSLTQHIGE----------QLSLSTQEAEQRIYAHNEFLVN 1062

Query: 1140 QIIDSTSRVRGEIVDISNKFI-ETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSH 1198
             +  + S     I  +  + +   S VL Q     + ++ +F++N S +LL     I   
Sbjct: 1063 SLTKANSETLQTITVMKEELVNNVSSVLTQ----LNQSIYNFNEN-SNVLLSAVQNIDGQ 1117

Query: 1199 TNESRS-------LIEQRIHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMES 1251
             NES +        + +R+      L+N    L+      F+Q       F  + + +  
Sbjct: 1118 FNESANNFFRNTDQVAERLSASNQALNNNVEILQRLSKNTFEQISHITSSFGEHAKTLSQ 1177

Query: 1252 ---LFDKNNDSMLLSFKERSN---ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQI 1305
               + +++ +S+  + +E+ N   +L + L  +S EI+  I G + K  N+ +   D+  
Sbjct: 1178 TIHVLEQSENSLSTTLEEKHNTLSVLSDALVSKSHEINQLI-GHYEKIFNSALERSDKNA 1236

Query: 1306 YNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNK----VDERLHQTTNR 1361
             N+ N+ ++    L+S+    + R +++++D+     +    L+K    ++E + +   +
Sbjct: 1237 RNSTNSFQQSLNRLVSEA---SARFSEAAEDIRRSADEVRLELSKINNDINENVKKLPEK 1293

Query: 1362 ITETTGHIDTVLAE 1375
              ETT  I T L E
Sbjct: 1294 TKETTQTIRTALNE 1307


>gi|254563827|ref|YP_003070922.1| hypothetical protein METDI5504 [Methylobacterium extorquens DM4]
 gi|254271105|emb|CAX27112.1| hypothetical protein METDI5504 [Methylobacterium extorquens DM4]
          Length = 2797

 Score =  138 bits (348), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 284/1651 (17%), Positives = 627/1651 (37%), Gaps = 254/1651 (15%)

Query: 316  VQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTL--- 372
            ++ + Q ++ ++D+  E L  T +V       R+++LS TL    R L    G   L   
Sbjct: 1257 LERTTQDLARRLDEGAERLD-TGVVA------RLDALSGTLEERTRHLDESFGIQALEAV 1309

Query: 373  -------------MLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSI----- 414
                         + G   D V++ L+ +S   ++A   H+  ++  F E+ +S+     
Sbjct: 1310 RLIESRTRTIDGELTGRIRDLVAL-LERRSGLAVEALGGHVEAIARLFDERAESLNHLFD 1368

Query: 415  ---TVTLNDVLQSLRISLQEKEDSF----------CSNLKSTTDN-------TLREVDNR 454
                    D+ Q  R++++  E              ++L +  D        TLR++  +
Sbjct: 1369 ERGGALAADLDQRGRVAVEGLEGRLSDITQALEQGGASLGALLDRRGTALLATLRDLMGQ 1428

Query: 455  TNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNME 514
             + L    T  L      F    ++  +      ++    ++G+  +++G      G+ E
Sbjct: 1429 VDGLLGEGTGRLGH---AFETQASEIRTLLDSRANDLRGLMEGSAGRVRGEIEAGLGSFE 1485

Query: 515  DLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEE 574
             +    ++T+   LD ++    D    + +++  +      R+ N    S+ +L   L E
Sbjct: 1486 TVLDERLRTVRDLLDARSAEIRDTFDHRTDDLRGLMEGGAGRVRNEFEASLGALDTTLAE 1545

Query: 575  KRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREK----LFSNSLARVQSHFEETI--- 627
            + + +   +  +S E+  +F+     +  ++ D        F  SL  + +  EE I   
Sbjct: 1546 RVRTVRDLLDARSAEIRDTFDHRTDDLRGLMEDVSGRVGGAFEASLGSLDTTLEERIRMV 1605

Query: 628  ------------------AGHPQSIVDSISNSTNNLYD-KIMVLAAALSESQKSLDNSLK 668
                               G  + +VD  +      ++  +  L AAL E  +++ + L 
Sbjct: 1606 RELLDARSAEIRNTLDSRTGELRGLVDGSAGHVRGEFETGLGALRAALEEPARTVQDLL- 1664

Query: 669  AHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDH 728
                                 D  +  I    ++ ++ L T  ++   +  D  ++++  
Sbjct: 1665 ---------------------DSRAGEIRAMLDARSDDLRTTLEERSRAVQDILDHRTAE 1703

Query: 729  VSGILKNSTQHIDDLFSNNAKRMEELLHSGSA-NIESELSAISKAMNKSIDDVETISTAL 787
            + G+L      +D+ F      ++  L  G+   +E+    I +A  +       ++   
Sbjct: 1704 IRGLLDGHAGRLDEGFQGRILPLQAALTDGARLFVETLEGGIGRAAGEVDARTRGLAHLF 1763

Query: 788  KERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQS-KFENNLVNQS 846
             ER   LG  +     +V  ++++  + L   F + + + + AL D +S      L NQ+
Sbjct: 1764 DERLGVLGDIVDGRGQQVAQTVERRSQELRALFDEIH-ATLGALVDERSTALTGRLENQT 1822

Query: 847  HLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAK 906
              L       ++ L  +  S+  + A  +      +  T+E  S+    +I A     A 
Sbjct: 1823 QALATVFDERMRSLDGLVESRGGEFARLVENQAATLSQTVETRSEDFTARIDARLRAFAT 1882

Query: 907  TFEECMSNILLSYDENR---------------QTLDKKLSDHIDVLRQNLAGSENKIDGA 951
                  + +  ++DE +                TLD++   H                  
Sbjct: 1883 VVANRANALADAFDERQDAYTAQIDGGTARMVATLDERARQH------------------ 1924

Query: 952  IGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKA 1011
               A+QF  + ++E    + +L+      + +TL       +R  Q+ +    +  D + 
Sbjct: 1925 ---AAQF--ETVEERQKAVAALIEEGTARIAATL------DERARQQSA--FAEAFDGQR 1971

Query: 1012 SCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQS 1071
               ++ +   T  +   L+E+ +  +   +T     + ++  I+     +V+ +   +Q 
Sbjct: 1972 ESYASVIEQGTARMVAALEERARRHAAQAETVEERQRAVAALIEEGTARMVAALDERAQR 2031

Query: 1072 TTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLL 1131
                +  L+   D+    I++        +VA +DE +           QR   +++   
Sbjct: 2032 QAAFAETLDGQRDAYASVIEEGTA----RMVAALDERA-----------QRQAALTEAFD 2076

Query: 1132 QNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDV 1191
               D   + I   T+R+   + + + +    +   ++++E + + +D      +R++  +
Sbjct: 2077 GQRDAYASLIEQGTARMVAALEERARRHAVLAEAFDRQKEAYAALIDG---GTARMVAAL 2133

Query: 1192 DHTISSHTNESRSLIEQR---IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMEN 1248
            D         + +  E++      V D ++ + R LE        + +         M+ 
Sbjct: 2134 DERAERQAALAETFDERQNAYAALVDDGIAQMGRMLEERARRHAAEVQARADALAETMDQ 2193

Query: 1249 ----MESLFDKNNDSMLLSFKERSNILDNILSQRSM-------EISDSISGAFHKEGNAV 1297
                +  + D    ++  +  ER   LD +++ +         E +D+I     +   A+
Sbjct: 2194 RNGALARMIDGPAAALADALAEREQALDRLIADKGAPLVEALRERTDAIVVRTVESAKAL 2253

Query: 1298 VNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQ 1357
               +D+    +A+ + +    +  DV     RI +++  +  ++  A+++L  +++ L  
Sbjct: 2254 RVALDEGAAASADTVAQAHERVRRDVAGFLTRIENANDGLKDLVGGASENLGAIEQGLAA 2313

Query: 1358 TTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHD 1417
               +I      +    A++S     ++  L E S+ +L Q S +    D   + L++   
Sbjct: 2314 RVEQIQSALDRVAADTAQASDRVSTQVVALREASQGALAQASSLAETLDARGKALVERTG 2373

Query: 1418 SLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKF---VMSILVDVKKIVEQADFLSD 1474
            + + A       L+  A NL  +  RL    S  Q     V+S L +  + +E       
Sbjct: 2374 THVGA-------LEAAAGNLEAVEGRLAESLSSRQAVVEAVLSRLEERSQAIEAQTGRFG 2426

Query: 1475 TVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEK 1534
            +V++               TL   E R+R+    +  ++A +  +    +  +F  L+  
Sbjct: 2427 SVIEE--------------TLRAAEARARE----LSESVARVAREAGTAVAGDFERLRSG 2468

Query: 1535 SYDLSNHMRQKICSTIPNI-ENIFSTLEEKSDQ------SMQVFLDSLNNKVDSFTQKLS 1587
            +   S    + + S I      +  +    S Q       M      +  ++D+    L 
Sbjct: 2469 ADAESARTAEAVRSAIEEASAKMMQSFAAASGQFGDSVTRMNAMAAEIRRELDATRADLQ 2528

Query: 1588 K--------TSDDIALTSRRIAED---LNNSRDILKRD--SVSLAKEAKES--ADTIRSA 1632
            +        T D  +   R +AE    LN    ++ R   SV +A+ A ++  A+  R+A
Sbjct: 2529 RGVLDLPRETQDATSEMRRVVAEQIDALNELSALVARSNRSVDVAQPAAQARGAEQRRTA 2588

Query: 1633 IEEQINTLKDFQKLITDSVKNNAASYNKGLHSDEYNI---------SQVDKRPSGKKTKN 1683
                  +      +   +   NAA       S    +           V  RP    T++
Sbjct: 2589 EAGHTVSAAAPAPVSAPAPVRNAAPAAGRSQSASAPVRPASPAAVPGPVQGRPG---TRD 2645

Query: 1684 NHAIKEWFNKILSSST------HSKGKSSSHIDISDKDSLS--SIDSLVENISKFIDYDA 1735
            N   + W + +L+ ++       +    +       K  +   S+D++  +I++ +D+ A
Sbjct: 2646 N---RGWLSDLLTRASLDDDGAEAVPAPAPAAAPEAKGPVERISLDAISTDIARMVDHQA 2702

Query: 1736 FVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEI 1795
             V+ W+ Y  G+ ++F  RLYT++G++ F  +Q +Y+AD+  R  +DRY+  FE +L E+
Sbjct: 2703 SVEFWQRYRQGDTNLFDGRLYTVQGRQTFEQIQRRYRADAEFRRTVDRYVGEFERLLGEV 2762

Query: 1796 AQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             +++ D+     ++ S  GKVYTML HASGR
Sbjct: 2763 TKNDRDTKRADAYLTSETGKVYTMLAHASGR 2793



 Score =  124 bits (310), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 124/604 (20%), Positives = 251/604 (41%), Gaps = 60/604 (9%)

Query: 104 AFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVV--PILLFFSFFIM 161
           A ++S +WL      L+    N        F      +   +V + +  PI+LF    ++
Sbjct: 121 AAIASFLWLNG----LVALAWNQSGGDLKTFITGLTALQAAVVATAIAGPIVLFLITAML 176

Query: 162 ISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASEL 221
             RA +M   ++++  +A+RL +PE +S++ + ++S  VR+E+  + + ++RA++RA EL
Sbjct: 177 AVRAHEMRLVARAVGEVAIRLAEPESFSTDAVLTMSQTVRREVAAVGDGVERALARAGEL 236

Query: 222 EKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSL 281
           E  VR EI  LE  Y+ +E+RI ++   L  +RE+I+    ++  +IA  HE+L  EL  
Sbjct: 237 ETLVRGEISTLERAYSDNEIRIRSLVDELIAQRESIVGSADRVRGAIAGSHENLSSELEG 296

Query: 282 TSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVI 341
            +E I   ++ A +     +D R   +TE    + +     +S++ D L+  L +TS   
Sbjct: 297 AAERIVAAINGAGERVTGALDARGTAITEALGEVGERVVGDVSTRGDDLVRQLTATS--- 353

Query: 342 TKDFDNRIESLSNTLNNSGRSLANQV--------GNYTLMLGNNTDKVSIALKEQSQQFM 393
            +     +E +  TL ++ +  A++V        G  T  L +N   V+ +L E     +
Sbjct: 354 -EGVRGGLEEIGTTLTSALQQRADEVTQAFERTGGALTRTLADNAGAVAQSLSETGTGLI 412

Query: 394 QAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDN 453
           +A       +   F    K +                  E++F S  + T      E+  
Sbjct: 413 EALDRQGGAVRETFERSTKGL------------------EEAFLS--RGT------ELTE 446

Query: 454 RTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQ-GCFADSHGN 512
           R       ITA   E  E  + +     +   ++++   ++L+  I+    G      G 
Sbjct: 447 RFAQTGGAITARFAETGEGLSRNFAATGAAIAEDIAVRGASLRTEIEAAGTGVSELIEGR 506

Query: 513 MEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDML 572
             D   +     GS          D  S + + +      +  R   T+      L   +
Sbjct: 507 GRDAQAALALAAGS--------VADDFSTRIDRVRDAFLASATRAAETMDGRGLELAARI 558

Query: 573 EEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQ 632
           E    R+D  I  +   L S+ +++ ++V  ++++R        A+  +  E+ +AG   
Sbjct: 559 EAAASRVDDVIAVQGGALASNLDTAGERVVGLMTER-------AAQAAATVEQALAGLGA 611

Query: 633 SIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDES 692
           S   + + +  +L + +  L   L     +    ++ +A      +  +   L  R  E+
Sbjct: 612 SFAANANGTAESLGETVARLGQDLDARTGAAQEGIRRNAETATASVGASVEALERRLREA 671

Query: 693 SKNI 696
           ++ +
Sbjct: 672 AEAM 675



 Score = 81.6 bits (200), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 180/1062 (16%), Positives = 402/1062 (37%), Gaps = 176/1062 (16%)

Query: 323  ISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVS 382
            ++++ +   + L  T+  +  + + R+ +L ++    GR  A        ++ + +D+  
Sbjct: 994  VAARGEATTQALSRTAEDVGTELETRLGTLEDSFGRHGRGAAA-------LIASQSDEAQ 1046

Query: 383  IALKEQSQQFMQAFTSHICEMSN-------FFSEKQKSITVTLNDVLQSLRISLQEK--- 432
              L+  S++ + A   H+ ++ +        F E   S T  + + L +   +LQE    
Sbjct: 1047 ARLEGASREVVLAIAGHVSQVGDTLHRSHAAFVETADSRTRAVEEALGNRLAALQETIAR 1106

Query: 433  ----EDSFCSN---LKSTTDNTLREVDN----RTNTLENRITAFLKEIVETFNNSITDFS 481
                 D    N   L  T D+ L E+D     + N L + +    +   ET    I +  
Sbjct: 1107 GDILADRIAGNAQTLGDTLDSRLTEIDRIIAVQGNALADSLAERARLASETVEARIGEME 1166

Query: 482  SFYKDNLSEFE---SNLQGNIDKLQGCFADS----------------------------- 509
            S      +E     + L G++D   G  A++                             
Sbjct: 1167 SLSARRAAEIGESFAALVGHVDTRLGARANALNEALVLRSSEIARTLDEGNRILTDALDR 1226

Query: 510  --HGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINS 567
               G+ +D+     +++G  L  +     + L +   ++++      ERL+  +   +++
Sbjct: 1227 RIEGSAQDIA-DRGRSVGDVLAARAAEIAERLERTTQDLARRLDEGAERLDTGVVARLDA 1285

Query: 568  LKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETI 627
            L   LEE+ + +D   G ++ E      S  + +   ++ R +     L R      E +
Sbjct: 1286 LSGTLEERTRHLDESFGIQALEAVRLIESRTRTIDGELTGRIRDLVALLERRSGLAVEAL 1345

Query: 628  AGHPQSIV---DSISNSTNNLYD-KIMVLAAALSESQKSLDNSLKAHATDVVHKITNAEN 683
             GH ++I    D  + S N+L+D +   LAA L +  +     L+   +D+   +     
Sbjct: 1346 GGHVEAIARLFDERAESLNHLFDERGGALAADLDQRGRVAVEGLEGRLSDITQALEQGGA 1405

Query: 684  QLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDL 743
             L    D     ++ +      +++ +  +        F  ++  +  +L +    +  L
Sbjct: 1406 SLGALLDRRGTALLATLRDLMGQVDGLLGEGTGRLGHAFETQASEIRTLLDSRANDLRGL 1465

Query: 744  FSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVET-ISTALKERCQELGSDLVNHS 802
               +A R+   + +G  + E+ L    + +   +D     I      R  +L   +   +
Sbjct: 1466 MEGSAGRVRGEIEAGLGSFETVLDERLRTVRDLLDARSAEIRDTFDHRTDDLRGLMEGGA 1525

Query: 803  DKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTD 862
             +V +  + +   L TT A+R                   V     LLD  S++I+   D
Sbjct: 1526 GRVRNEFEASLGALDTTLAER-------------------VRTVRDLLDARSAEIRDTFD 1566

Query: 863  IAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYD-- 920
                +  D+   + ++ G VG   E           AS   +  T EE +  +    D  
Sbjct: 1567 ---HRTDDLRGLMEDVSGRVGGAFE-----------ASLGSLDTTLEERIRMVRELLDAR 1612

Query: 921  --ENRQTLDKKLSDHIDVLRQNLAGSENKIDG-----------AIGSASQFIRDILDENS 967
              E R TLD +  +    LR  + GS   + G           A+   ++ ++D+LD  +
Sbjct: 1613 SAEIRNTLDSRTGE----LRGLVDGSAGHVRGEFETGLGALRAALEEPARTVQDLLDSRA 1668

Query: 968  SRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLEN 1027
              I ++L   ++ + +TL    +    +L  ++ E+  LLD  A  L      + + L+ 
Sbjct: 1669 GEIRAMLDARSDDLRTTLEERSRAVQDILDHRTAEIRGLLDGHAGRLDEGFQGRILPLQA 1728

Query: 1028 NLKEQEK----SLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISL 1083
             L +  +    +L   +  +A      +  +  L  E + V+G +      + G+ +   
Sbjct: 1729 ALTDGARLFVETLEGGIGRAAGEVDARTRGLAHLFDERLGVLGDI------VDGRGQQVA 1782

Query: 1084 DSVNQKIQKCREFFGD---NIVAFMDEISKVMEISEKRISQRTQEIS------------- 1127
             +V ++ Q+ R  F +    + A +DE S  +     R+  +TQ ++             
Sbjct: 1783 QTVERRSQELRALFDEIHATLGALVDERSTAL---TGRLENQTQALATVFDERMRSLDGL 1839

Query: 1128 --------QQLLQNNDVITNQIIDSTS---------RVRGEIVDISNKFIETSRVLEQRE 1170
                     +L++N     +Q +++ S         R+R     ++N+    +   ++R+
Sbjct: 1840 VESRGGEFARLVENQAATLSQTVETRSEDFTARIDARLRAFATVVANRANALADAFDERQ 1899

Query: 1171 EKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGST 1230
            + + + +D      +R++  +D     H  +  ++ E++    K V + ++       +T
Sbjct: 1900 DAYTAQIDG---GTARMVATLDERARQHAAQFETVEERQ----KAVAALIEEGTARIAAT 1952

Query: 1231 V---FKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            +    +Q   + + F+   E+  S+ ++    M+ + +ER+ 
Sbjct: 1953 LDERARQQSAFAEAFDGQRESYASVIEQGTARMVAALEERAR 1994


>gi|163853864|ref|YP_001641907.1| hypothetical protein Mext_4468 [Methylobacterium extorquens PA1]
 gi|163665469|gb|ABY32836.1| hypothetical protein Mext_4468 [Methylobacterium extorquens PA1]
          Length = 2797

 Score =  135 bits (339), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 285/1640 (17%), Positives = 623/1640 (37%), Gaps = 232/1640 (14%)

Query: 316  VQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTL--- 372
            ++ + Q ++ ++D+  E L  T +V       R+++LS TL    R L    G   L   
Sbjct: 1257 LERTTQDLARRLDEGAERLD-TGVVA------RLDALSGTLEERTRHLDESFGIQALEAV 1309

Query: 373  -------------MLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSI----- 414
                         + G   D V++ L+ +S   ++A   H+  ++  F E+ +S+     
Sbjct: 1310 RLIESRTRTIDGELTGRIRDLVAL-LERRSGLAVEALGGHVEAIARLFDERAESLNHLFD 1368

Query: 415  ---TVTLNDVLQSLRISLQEKEDSF----------CSNLKSTTDN-------TLREVDNR 454
                    D+ Q  R++++  E              ++L +  D        TLR++  +
Sbjct: 1369 ERGGALAADLDQRGRVAVEGLEGRLSDITQALEQGGASLGALLDRRGTALLATLRDLMGQ 1428

Query: 455  TNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNME 514
             + L    T  L    ET  + I        D+L      ++G+  +++G      G+ E
Sbjct: 1429 VDGLLGEGTGRLGHAFETQASEIRTLLDSRADDLRGL---MEGSAGRVRGELEVGLGSFE 1485

Query: 515  DLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEE 574
             +    ++T+   LD ++    D    + +++  +      R+ +    S+ +L   L E
Sbjct: 1486 TVLDERLRTVRDLLDARSAEIRDTFDHRTDDLRGLMEGGAGRVRSEFEASLGALDTTLAE 1545

Query: 575  KRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREK----LFSNSLARVQSHFEETIAGH 630
            + + +   +  +S E+  +F+     +  ++ D        F  SL  + +  EE I   
Sbjct: 1546 RVRTVRDLLDARSAEIRDTFDHRTDDLRGLMEDVSGRVGGAFEASLGSLDTTLEERIR-M 1604

Query: 631  PQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFD 690
             + ++DS S    N  D          E +  +D S    A  V  +       L    +
Sbjct: 1605 VRELLDSRSTEIRNTLDSRT------GELRGLVDGS----AGHVRGEFETGLGALRAALE 1654

Query: 691  ESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKR 750
            E ++ +    +S   ++ T+          T   ++  V  IL + T  I  L   +A R
Sbjct: 1655 EPARTVQDLLDSRAGEIRTMLDARSDDLRITLEERARTVQDILDHRTAEIRGLLDGHAGR 1714

Query: 751  MEELLHSGSANIESELS--------AISKAMNKSIDDVETISTALK----ERCQELGSDL 798
            ++E        +++ L+         +   + ++  +V+  +  L     ER   LG  +
Sbjct: 1715 LDEGFQGRILPLQAALTEGARLFVETLEGGIGRAAGEVDARTRGLAHLFDERLGVLGDIV 1774

Query: 799  VNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQS-KFENNLVNQSHLLLDKLSSDI 857
                 +V  ++++  + L   F + + + + AL D +S      L NQ+  L       +
Sbjct: 1775 DGRGQQVAQTVERRSQELRALFDEIH-ATLGALVDERSTALTGRLENQTQALATVFDERM 1833

Query: 858  QKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILL 917
            + L  +  S+  + A  +      +  T+E  S+    +I A     A       + +  
Sbjct: 1834 RSLDGLVESRGGEFARLVENQAATLSQTVEARSEDFTARIDARLRAFATVVANRANALAD 1893

Query: 918  SYDENR---------------QTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDI 962
            ++DE +                TLD++   H                     A+QF  + 
Sbjct: 1894 AFDERQDAYTAQIDGGTARMVATLDERARQH---------------------AAQF--ET 1930

Query: 963  LDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQT 1022
            ++E    + +L+      + +TL       +R  Q+ +    +  D +    ++ +   T
Sbjct: 1931 VEERQKAVAALIEEGTARIAATL------DERARQQAA--FAEAFDGQRESYASVIEQGT 1982

Query: 1023 INLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEIS 1082
              +   L+++ +  +   +T     + ++  I+     +V+ +   +Q     +  L+  
Sbjct: 1983 ARMVAALEDRARRHAAQAETVEERQRAVTALIEEGTSRMVAALDERAQRQAAFAETLDGQ 2042

Query: 1083 LDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQII 1142
             D+    I++        +VA +DE +           QR   +++      D     I 
Sbjct: 2043 RDAYASVIEEGTA----RMVAALDERA-----------QRQAALTEAFDGQRDAYATLIE 2087

Query: 1143 DSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNES 1202
              T+R+   + + + +    +   ++++E + + +D      +R++  +D         +
Sbjct: 2088 QGTARMVAALEERARRHAVLAEAFDRQKEAYAALIDG---GTARMVAALDERAERQAALA 2144

Query: 1203 RSLIEQR---IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMEN----MESLFDK 1255
             +  E++      V D ++ + R LE        + +         M+     +  + D 
Sbjct: 2145 ETFDERQNAYAALVDDGIAQMGRMLEERARRHAAEVQARADALAETMDQRNGALARMIDG 2204

Query: 1256 NNDSMLLSFKERSNILDNILSQRSM-------EISDSISGAFHKEGNAVVNVIDQQIYNA 1308
               ++  +  ER   LD +++ +         E +D+I     +   A+   +D+    +
Sbjct: 2205 PAAALADALAEREQALDRLIADKGAPLVEALRERTDAIVVRTVESAKALRVALDEGAAAS 2264

Query: 1309 ANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGH 1368
            A+ + +    +  DV     RI +++  +  ++  A+++L  +++ L     +I      
Sbjct: 2265 ADTVAQAHERVRRDVAGFLTRIENANDGLKDLVGGASENLGAIEQGLAARVEQIQSALDR 2324

Query: 1369 IDTVLAESSKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKL 1428
            +    A++S     ++  L E S+ +L Q S +    D   + L++   + + A      
Sbjct: 2325 VAADTAQASDRVSTQVVALREASQGALAQASSLAETLDARGKALVERTGTHVGA------ 2378

Query: 1429 SLDKDANNLVDLTSRLVSKSSEAQKF---VMSILVDVKKIVEQADFLSDTVVKNMTDSIQ 1485
             L+  A NL  +  RL    S  Q     V+S L +  + +E       +V++       
Sbjct: 2379 -LEAAAGNLEAVEGRLAESLSSRQAVVEAVLSRLEERSQAIEAQTGRFGSVIEE------ 2431

Query: 1486 SSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQK 1545
                    TL   E R+R+    +  ++A +  +    +  +F  L+  +   S    + 
Sbjct: 2432 --------TLRAAEARARE----LSESVARVAREAGTAVAGDFERLRSGADAESARTAEA 2479

Query: 1546 ICSTIPNI-ENIFSTLEEKSDQ------SMQVFLDSLNNKVDSFTQKLSK--------TS 1590
            + S I      +  +    S Q       M      +  ++D+    L +        T 
Sbjct: 2480 VRSAIEEASAKMMQSFAAASGQFGDSVTRMNAMAAEIRRELDATRADLQRGVLDLPRETQ 2539

Query: 1591 DDIALTSRRIAEDL-------------NNSRDILKRDSVSLAKEAKESADTIRSAIEEQI 1637
            D  +   R +AE +             N S D+ +  + +   E + +A+  R+      
Sbjct: 2540 DATSEMRRVVAEQIDALNELSALVARSNRSVDVAQPAAQARGAEQRRTAEAGRTVSAAAP 2599

Query: 1638 NTLKDF---QKLITDSVKNNAASYNKGLHSDEYNISQVDKRPSGKKTKNNHAIKEWFNKI 1694
              +      +     + ++  AS      S       V  RP    T++N     W + +
Sbjct: 2600 APVSAPAPVRNAAPTAGRSQPASAPVRPASPAAVPGPVQGRPG---TRDNRG---WLSDL 2653

Query: 1695 LSSST------HSKGKSSSHIDISDKDSLS--SIDSLVENISKFIDYDAFVQLWKSYTLG 1746
            L+ ++       +    +       K  +   S+D++  +I++ +D+ A V+ W+ Y  G
Sbjct: 2654 LTRASLDDDGAEAVPAPAPAAAPEAKGPVERISLDAISTDIARMVDHQASVEFWQRYRQG 2713

Query: 1747 EDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQ 1806
            + ++F  RLYT++G++ F  +Q +Y+AD+  R  +DRY+  FE +L E+ +++ D+    
Sbjct: 2714 DTNLFDGRLYTVQGRQTFEQIQRRYRADAEFRRTVDRYVGEFERLLGEVTKNDRDTKRAD 2773

Query: 1807 EHIMSNYGKVYTMLVHASGR 1826
             ++ S  GKVYTML HASGR
Sbjct: 2774 AYLTSETGKVYTMLAHASGR 2793



 Score =  124 bits (310), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 123/604 (20%), Positives = 252/604 (41%), Gaps = 60/604 (9%)

Query: 104 AFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVV--PILLFFSFFIM 161
           A ++S +WL      L+    N        F      +   +V + +  PI+LF    ++
Sbjct: 121 AAIASFLWLNG----LVALAWNQSGGDLKTFITGLTALQAAVVATAIAGPIVLFLITAML 176

Query: 162 ISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASEL 221
             RA +M   ++++  +A+RL +PE +S++ + ++S  VR+E+  + + ++RA++RA EL
Sbjct: 177 AVRAHEMRLVARAVGEVAIRLAEPESFSTDAVLTMSQTVRREVAAVGDGVERALARAGEL 236

Query: 222 EKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSL 281
           E  VR EI  LE  Y+ +E+RI ++   L  +RE+I+    ++  +IA  HE+L  EL  
Sbjct: 237 ETLVRGEISTLERAYSDNEIRIRSLVDELIAQRESIVGSADRVRGAIAGSHENLSSELEG 296

Query: 282 TSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVI 341
            +E I   ++ A +     +D R   +TE    + +     +S++ D L+  L +TS   
Sbjct: 297 AAERIVAAINGAGERVTGALDARGTAITEALGEVGERVVGNVSTRGDDLVRQLTATS--- 353

Query: 342 TKDFDNRIESLSNTLNNSGRSLANQV--------GNYTLMLGNNTDKVSIALKEQSQQFM 393
            +     +E +  TL ++ +  A++V        G  T  L +N   V+ +L E     +
Sbjct: 354 -EGVRGGLEEIGTTLTSALQQRADEVTQAFERTGGALTRTLADNAGAVAQSLSETGTGLI 412

Query: 394 QAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDN 453
           +A       +   F    + +                  E++F S  + T      E+  
Sbjct: 413 EALDRQGGAVRETFERSTRGL------------------EEAFLS--RGT------ELTE 446

Query: 454 RTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQ-GCFADSHGN 512
           R       ITA   E  E  + +     +   ++++   ++L+  I+    G      G 
Sbjct: 447 RFAQTGGAITARFAETGEGLSRNFAATGAAISEDIAVRGASLRTEIEAAGTGVSELIEGR 506

Query: 513 MEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDML 572
             D   +     GS          D  S + + +      +  R   T+      L   +
Sbjct: 507 GRDAQAALALAAGS--------VADDFSTRIDRVRDAFLASATRAAETMDGRGLELAARI 558

Query: 573 EEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQ 632
           E    R+D  I  +   L S+ +++ ++V  ++++R        A+  +  E+ +AG   
Sbjct: 559 EAAASRVDDVIAVQGGALASNLDTAGERVVGLMTER-------AAQAAATVEQALAGLGA 611

Query: 633 SIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDES 692
           S   + + +  +L + +  L   L     +  + ++ +A      +  +   L  R  E+
Sbjct: 612 SFAANANGTAESLGETVARLGQDLDARTGAAQDGIRRNAETATASVGASVEALERRLREA 671

Query: 693 SKNI 696
           ++ +
Sbjct: 672 AEAM 675



 Score = 52.8 bits (125), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 142/775 (18%), Positives = 288/775 (37%), Gaps = 79/775 (10%)

Query: 537  DILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNS 596
            D ++ +    +Q  S   E +   L   + +L+D      +   + I  +S+E  +    
Sbjct: 992  DEVAARGEATTQALSRTAEDVGTELETRLGTLEDSFGRHGRGAAALIASQSDEAQARLEG 1051

Query: 597  SYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIM---VLA 653
            + ++V   I+       ++L R  + F ET     +++ +++ N    L + I    +LA
Sbjct: 1052 ASREVVLAIAGHVSQVGDTLHRSHAAFVETADSRTRAVEEALGNRLAALQETIARGDILA 1111

Query: 654  AALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQK 713
              ++ + ++L ++L +  T++   I    N L +   E ++    +  +   ++E++  +
Sbjct: 1112 DRIAGNAQTLGDTLDSRLTEIDRIIAVQGNALADSLAERARLASETVEARIGEMESLSAR 1171

Query: 714  HLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM 773
                  ++F                H+D      A  + E L   S+ I           
Sbjct: 1172 RAAEIGESF-----------AALVGHVDTRLGARANALNEALVLRSSEI----------- 1209

Query: 774  NKSIDDVETIST-ALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALA 832
             +++D+   I T AL  R +    D+ +    V   L      +     +        L 
Sbjct: 1210 ARTLDEGNRILTDALDRRIEGSAQDIADRGRSVGDVLAARAAEIAERLERTTQDLARRLD 1269

Query: 833  DNQSKFENNLVNQSHLLLDKLSSDIQKLT-------DIAYSKAIDVANSLT-----EIQG 880
            +   + +  +V +    LD LS  +++ T        I   +A+ +  S T     E+ G
Sbjct: 1270 EGAERLDTGVVAR----LDALSGTLEERTRHLDESFGIQALEAVRLIESRTRTIDGELTG 1325

Query: 881  NVG---VTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVL 937
             +      LE  S   +E +      +A+ F+E   ++   +DE    L   L     V 
Sbjct: 1326 RIRDLVALLERRSGLAVEALGGHVEAIARLFDERAESLNHLFDERGGALAADLDQRGRVA 1385

Query: 938  RQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQ 997
             + L G  + I  A+      +  +LD   + + + L      V+  L     +     +
Sbjct: 1386 VEGLEGRLSDITQALEQGGASLGALLDRRGTALLATLRDLMGQVDGLLGEGTGRLGHAFE 1445

Query: 998  EKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTL 1057
             ++ E+  LLD++A  L   +      +   L+    S   V+D    + + L D+    
Sbjct: 1446 TQASEIRTLLDSRADDLRGLMEGSAGRVRGELEVGLGSFETVLDERLRTVRDLLDARS-- 1503

Query: 1058 AQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEK 1117
                  +  +    T D+ G +E     V  + +      G       + +  V ++   
Sbjct: 1504 ----AEIRDTFDHRTDDLRGLMEGGAGRVRSEFEAS---LGALDTTLAERVRTVRDL--- 1553

Query: 1118 RISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSAL 1177
             +  R+ EI        D +   + D + RV G   + S   ++T+  LE+R       L
Sbjct: 1554 -LDARSAEIRDTFDHRTDDLRGLMEDVSGRV-GGAFEASLGSLDTT--LEERIRMVRELL 1609

Query: 1178 DSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKD----VLSNLDRALESYGSTVFK 1233
            DS S  I        +T+ S T E R L++     V+      L  L  ALE    TV  
Sbjct: 1610 DSRSTEIR-------NTLDSRTGELRGLVDGSAGHVRGEFETGLGALRAALEEPARTV-- 1660

Query: 1234 QFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISG 1288
                     ++    + ++ D  +D + ++ +ER+  + +IL  R+ EI   + G
Sbjct: 1661 -----QDLLDSRAGEIRTMLDARSDDLRITLEERARTVQDILDHRTAEIRGLLDG 1710



 Score = 45.8 bits (107), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 133/815 (16%), Positives = 294/815 (36%), Gaps = 109/815 (13%)

Query: 211  IDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIA- 269
            ++ A SR   +E+ + + +  L+    + ++  D I  N +   + + +  T++   IA 
Sbjct: 1079 VETADSRTRAVEEALGNRLAALQETIARGDILADRIAGNAQTLGDTLDSRLTEIDRIIAV 1138

Query: 270  ---EVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSK 326
                + +SL E   L SE +       I   +S+   R A++ E    +V      + ++
Sbjct: 1139 QGNALADSLAERARLASETVEAR----IGEMESLSARRAAEIGESFAALVGHVDTRLGAR 1194

Query: 327  IDQLLE--VLHSTSI---------VITKDFDNRIESLSNTLNNSGRSLANQV-------- 367
             + L E  VL S+ I         ++T   D RIE  +  + + GRS+ + +        
Sbjct: 1195 ANALNEALVLRSSEIARTLDEGNRILTDALDRRIEGSAQDIADRGRSVGDVLAARAAEIA 1254

Query: 368  ----------------GNYTLMLG--NNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSE 409
                            G   L  G     D +S  L+E+++   ++F     E       
Sbjct: 1255 ERLERTTQDLARRLDEGAERLDTGVVARLDALSGTLEERTRHLDESFGIQALEAVRLIES 1314

Query: 410  KQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTL----ENRITAF 465
            + ++I   L   ++ L   L+ +       L    +   R  D R  +L    + R  A 
Sbjct: 1315 RTRTIDGELTGRIRDLVALLERRSGLAVEALGGHVEAIARLFDERAESLNHLFDERGGAL 1374

Query: 466  LKEI-------VETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFL 518
              ++       VE     ++D +   +   +   + L      L     D  G ++ L  
Sbjct: 1375 AADLDQRGRVAVEGLEGRLSDITQALEQGGASLGALLDRRGTALLATLRDLMGQVDGLLG 1434

Query: 519  SNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQR 578
                 +G   + +      +L  + +++  +   +  R+   L   + S + +L+E+ + 
Sbjct: 1435 EGTGRLGHAFETQASEIRTLLDSRADDLRGLMEGSAGRVRGELEVGLGSFETVLDERLRT 1494

Query: 579  IDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSI 638
            +   +  +S E+  +F+       +   D   L      RV+S FE ++           
Sbjct: 1495 VRDLLDARSAEIRDTFD-------HRTDDLRGLMEGGAGRVRSEFEASLG---------- 1537

Query: 639  SNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIIC 698
                         L   L+E  +++ + L A + ++     +  + L    ++ S  +  
Sbjct: 1538 ------------ALDTTLAERVRTVRDLLDARSAEIRDTFDHRTDDLRGLMEDVSGRVGG 1585

Query: 699  SYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSG 758
            ++ +S   L+T  ++ +    +  +++S  +   L + T  +  L   +A  +       
Sbjct: 1586 AFEASLGSLDTTLEERIRMVRELLDSRSTEIRNTLDSRTGELRGLVDGSAGHVR------ 1639

Query: 759  SANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCT 818
                E+ L A+  A+ +      T+   L  R  E+ + L   SD +  +L++    +  
Sbjct: 1640 -GEFETGLGALRAALEEP---ARTVQDLLDSRAGEIRTMLDARSDDLRITLEERARTVQD 1695

Query: 819  TFAQRNDSFVNALADNQS------------KFENNLVNQSHLLLDKLSSDIQKLTDIAYS 866
                R  + +  L D  +              +  L   + L ++ L   I +      +
Sbjct: 1696 ILDHRT-AEIRGLLDGHAGRLDEGFQGRILPLQAALTEGARLFVETLEGGIGRAAGEVDA 1754

Query: 867  KAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTL 926
            +   +A+   E  G +G  ++   Q + + +   +  +   F+E  + +    DE    L
Sbjct: 1755 RTRGLAHLFDERLGVLGDIVDGRGQQVAQTVERRSQELRALFDEIHATLGALVDERSTAL 1814

Query: 927  DKKLSDHIDVLRQNLAGSENKIDGAIGS-ASQFIR 960
              +L +    L          +DG + S   +F R
Sbjct: 1815 TGRLENQTQALATVFDERMRSLDGLVESRGGEFAR 1849


>gi|49475519|ref|YP_033560.1| hypothetical protein BH07480 [Bartonella henselae str. Houston-1]
 gi|49238325|emb|CAF27549.1| hypothetical protein BH07480 [Bartonella henselae str. Houston-1]
          Length = 1520

 Score =  134 bits (338), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 282/1292 (21%), Positives = 549/1292 (42%), Gaps = 153/1292 (11%)

Query: 618  RVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHK 677
            RVQS    TI G  + + D    +T+N+   +  LA  LS++       L+    D+V K
Sbjct: 297  RVQS----TIKGTQEQLSDEFGLATSNIVRNVEKLAQTLSQT-------LQKQGEDLVAK 345

Query: 678  ITN----AENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGIL 733
            +++      NQL+ +F E++K I         +  T F    H   + F++ S       
Sbjct: 346  LSHTGDGVTNQLIEKFSETTKQI--------QQKNTEF---FHELGENFDDFSKR----- 389

Query: 734  KNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDV------------E 781
                      F NN K++E+  +  ++  E  ++ I+  +  + D              E
Sbjct: 390  ----------FDNNEKQIEKTFNEAASKAEMHIAKITTHIQAATDQTLYNIDEKFKTLDE 439

Query: 782  TISTALKERCQELGSDLVN---HSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKF 838
            TI+   K+  Q     ++     +DK+ S           TF  R  +   +L +     
Sbjct: 440  TITNRNKQSLQNFDEKIMQFDEQADKLSSKFDNVTSEAIETFENRLATVDLSLKEYSDSI 499

Query: 839  ENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKIS 898
              + +++S  L D    + +KL +   +  + +   L E   ++     N  + +L  I 
Sbjct: 500  IESFISRSQTLED----NAKKLGEFLETHVLKINEGLQERTADITNAFTNGHEIILSAID 555

Query: 899  ASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQF 958
             S   + +  +   S I     E  Q    +LSD   ++   L   +NKI   + + +  
Sbjct: 556  KSKESLREEIQHVDSAIFDIIQERSQDFKLQLSDQRALMADMLDNEKNKIADTLKNQT-- 613

Query: 959  IRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLST-- 1016
              DIL +N+S IE +L   N  +      +H        EK  E+I       SC +T  
Sbjct: 614  --DILAQNASNIEKVL-IDNIQIVDQHAENHVANMVQCTEKLQEVI-----AQSCNTTKD 665

Query: 1017 AVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDIS 1076
            A+  Q  N++        SL+     S S  + L+D  +TL Q + ++   +++S   + 
Sbjct: 666  ALEAQARNIDIRADALRDSLAI---NSFSLNEVLADQARTLEQRMETIYNLIAKSDIHVD 722

Query: 1077 GKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLL----- 1131
              L+  +D V   I    +   + +   +  +    EI +  +SQ   +  + L      
Sbjct: 723  VALKKQIDLVENAIIANNKSITETVQGHIKNLEGHTEILKNTLSQSNGKFFENLETQMGS 782

Query: 1132 --QNNDVITNQIIDSTSRVR-------GEIVDI----SNKFIETSRVLE-------QREE 1171
               N +V   +I +  + +        GE+ +     ++ F E S  L+       Q+ +
Sbjct: 783  FDANLEVRARKIFECAATLEEKLSEKIGEVCETIQTQTSAFAERSDTLQTSIILNNQQSQ 842

Query: 1172 KFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTV 1231
                AL++  DNI   L D  +T++++       +  +I +  DVLS+    + S  S V
Sbjct: 843  AMQQALETSVDNIRATLEDSVNTVTNN-------LHDKIIKASDVLSSTGEQIFSSVSNV 895

Query: 1232 FKQFKE-YVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAF 1290
              Q +   ++     + N++      ++ +L +  E++       +  S      ++   
Sbjct: 896  AVQAENILLESGNRIVSNVKQTVYDTSEKVLSALSEQTAHTMEAFTTASYNAQTLLNETI 955

Query: 1291 HKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNK 1350
            H    A+  V++++     ++++ L+  L   +  ++N + ++S    T IS     L +
Sbjct: 956  HTSATAIEEVLNKRCNILHDSMQNLKTKLGDQLSNVSNHLEEASNQTATQISGHVGKLTE 1015

Query: 1351 VDERLHQ----TTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQM-SEIVSKF 1405
            +   L+Q    TT+ I   T HI   L+ S++  E++I    E    SL Q  SE +   
Sbjct: 1016 LTNHLNQAAQNTTDSINHLTQHISEQLSLSTQDAEQRIYAQNESLVNSLTQTNSETLQTV 1075

Query: 1406 DKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSE-AQKFVMSILVDVKK 1464
                + L+K+  S++   +++  +  ++ N L+     +  K SE A  F        +K
Sbjct: 1076 TVMKEDLVKNISSIVAQLNQSIYNFSENNNILLSAVQNIDGKFSETANNFF-------RK 1128

Query: 1465 IVEQADFLS------DTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGN 1518
              + A+ LS      ++ V+ +    Q++F KI    S+    ++     I H L    N
Sbjct: 1129 THQAAEHLSASHQALNSSVEVLEGLSQNTFEKISHITSSFSEHAKTLSETI-HVLEQSEN 1187

Query: 1519 KTVKTIDSNFVTLKEKSYDL---SNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSL 1575
                T++    TL   S  L   SN + Q I      +   F   +E +  S   F  SL
Sbjct: 1188 SFNTTLEEKHNTLSALSNALILKSNEINQLIEHYENTLSLAFKRADENTRNSTYSFQQSL 1247

Query: 1576 NNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEE 1635
            N+ ++  + +    ++DI  ++  I  +L+   + L      L ++ KE+  TIR A+ E
Sbjct: 1248 NHLINEASTRFLGATEDIRRSADEIRSELSKINNDLNESVQKLPEKTKETTQTIRHALNE 1307

Query: 1636 QINTLKDFQKLITDSVKNN-----------AASYNKG-LHSDEYNISQVDKRPSGKKTKN 1683
            QI  LKD   +I  + + N           +++ NK  + S E     V  +P  ++ ++
Sbjct: 1308 QITALKDLVSVIQKNDQKNVKEQLIPTISSSSTLNKPDIASPEVIKKIVPPKPILQQDQS 1367

Query: 1684 NHAIKEWFNKILSSST---------HSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYD 1734
                 +W + +L  ++         H+    +S +    +   SS++SL   I + I ++
Sbjct: 1368 KKRQNKWVSNLLERASREEALYDEMHNDAVFTS-VQTKSRPVSSSLNSLAAGIVQAIKHN 1426

Query: 1735 AFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSE 1794
            A V+LW  Y  G+++I    LYT+ G+ +F  ++++Y +D   +N++++YI +FE++L +
Sbjct: 1427 AIVELWDHYRHGQENIVIDHLYTMNGRAIFETIKKKYISDVNFKNSVNQYIVDFEKLLRD 1486

Query: 1795 IAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +++++  S  V+++++S+ GKVYTML HASGR
Sbjct: 1487 VSRNSGSSNSVRKYLISDTGKVYTMLAHASGR 1518



 Score =  101 bits (251), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 227/1158 (19%), Positives = 473/1158 (40%), Gaps = 192/1158 (16%)

Query: 108  SLIWLACE--LGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRA 165
            S +W A    +   +  +  S + +   F   P  + +    + +PIL+ + F  +  R+
Sbjct: 141  SALWAAGGAFIAHRLAPFELSSLSNITTFFTSPTGLAV-AAGTTIPILMSWGFAQLTKRS 199

Query: 166  RDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTV 225
             ++H+ +  +   A RL +P+  S ++  +I   +R+E+  M E I+R + RA ELE  +
Sbjct: 200  NELHNIAVLMTNAAQRLSEPQHISEKQAVAIGQTIREEVAAMNEGIERTLERAVELEAII 259

Query: 226  RSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEE 285
            + E+  LE  Y ++E RI  + + L  ER AI+NH  ++ ++I    E L +E  L +  
Sbjct: 260  QGEVYHLEQAYAENESRIHTLIKELSNERIAILNHADRVQSTIKGTQEQLSDEFGLATSN 319

Query: 286  ISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDF 345
            I                           R V++ AQT+S  + +                
Sbjct: 320  I--------------------------VRNVEKLAQTLSQTLQK---------------- 337

Query: 346  DNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSN 405
              + E L   L+++G  + NQ       L     + +  +++++ +F      +  + S 
Sbjct: 338  --QGEDLVAKLSHTGDGVTNQ-------LIEKFSETTKQIQQKNTEFFHELGENFDDFSK 388

Query: 406  FFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAF 465
             F   +K I  T N+      + + +      +++++ TD TL  +D +  TL+  IT  
Sbjct: 389  RFDNNEKQIEKTFNEAASKAEMHIAK----ITTHIQAATDQTLYNIDEKFKTLDETITNR 444

Query: 466  LKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIG 525
             K+ ++ F+  I  F                   DKL   F +      + F + + T+ 
Sbjct: 445  NKQSLQNFDEKIMQFDE---------------QADKLSSKFDNVTSEAIETFENRLATVD 489

Query: 526  SNLDKKT-LLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIG 584
             +L + +  + E  +S+ Q                TL ++   L + LE    +I+  + 
Sbjct: 490  LSLKEYSDSIIESFISRSQ----------------TLEDNAKKLGEFLETHVLKINEGLQ 533

Query: 585  KKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNN 644
            +++ ++ ++F + ++ + + I   ++     +  V S   + I    Q     +S     
Sbjct: 534  ERTADITNAFTNGHEIILSAIDKSKESLREEIQHVDSAIFDIIQERSQDFKLQLS----- 588

Query: 645  LYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRF---DESSKNIICSYN 701
              D+  ++A  L   +  + ++LK     +    +N E  L++     D+ ++N + +  
Sbjct: 589  --DQRALMADMLDNEKNKIADTLKNQTDILAQNASNIEKVLIDNIQIVDQHAENHVANMV 646

Query: 702  SSNNKLETIFQKHLHSFNDTFNN-------KSDHVSGILKNSTQHIDDLFSNNAKRMEEL 754
                KL+ +  +  ++  D           ++D +   L  ++  ++++ ++ A+ +E+ 
Sbjct: 647  QCTEKLQEVIAQSCNTTKDALEAQARNIDIRADALRDSLAINSFSLNEVLADQARTLEQR 706

Query: 755  LHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQE 814
            + +    I      +  A+ K ID VE    A+    + +   +  H    + +L+   E
Sbjct: 707  METIYNLIAKSDIHVDVALKKQIDLVE---NAIIANNKSITETVQGH----IKNLEGHTE 759

Query: 815  LLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANS 874
            +L  T +Q N  F   L      F+ NL  ++  +               +  A  +   
Sbjct: 760  ILKNTLSQSNGKFFENLETQMGSFDANLEVRARKI---------------FECAATLEEK 804

Query: 875  LTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHI 934
            L+E  G V  T++  + A  E+   S+TL         ++I+L+ ++  Q + + L   +
Sbjct: 805  LSEKIGEVCETIQTQTSAFAER---SDTL--------QTSIILN-NQQSQAMQQALETSV 852

Query: 935  DVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNS--TLLRSHQKF 992
            D +R  L  S N +   +        D+L     +I S  S SN +V +   LL S  + 
Sbjct: 853  DNIRATLEDSVNTVTNNLHDKIIKASDVLSSTGEQIFS--SVSNVAVQAENILLESGNRI 910

Query: 993  ----DRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFK 1048
                 + + + S++++  L  + +    A +T + N +  L E        + TSA++ +
Sbjct: 911  VSNVKQTVYDTSEKVLSALSEQTAHTMEAFTTASYNAQTLLNE-------TIHTSATAIE 963

Query: 1049 --------YLSDSIQTLAQELVSVIGSMS--------QSTTDIS---GKLEISLDSVNQK 1089
                     L DS+Q L  +L   + ++S        Q+ T IS   GKL    + +NQ 
Sbjct: 964  EVLNKRCNILHDSMQNLKTKLGDQLSNVSNHLEEASNQTATQISGHVGKLTELTNHLNQA 1023

Query: 1090 IQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVR 1149
             Q       D+I      IS+ + +S       TQ+  Q++   N+ + N +  + S   
Sbjct: 1024 AQNT----TDSINHLTQHISEQLSLS-------TQDAEQRIYAQNESLVNSLTQTNSETL 1072

Query: 1150 GEIVDISNKFIET-SRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQ 1208
              +  +    ++  S ++ Q     + ++ +FS+N + ILL     I    +E+ +   +
Sbjct: 1073 QTVTVMKEDLVKNISSIVAQ----LNQSIYNFSEN-NNILLSAVQNIDGKFSETANNFFR 1127

Query: 1209 RIHEVKDVLSNLDRALES 1226
            + H+  + LS   +AL S
Sbjct: 1128 KTHQAAEHLSASHQALNS 1145


>gi|148256834|ref|YP_001241419.1| hypothetical protein BBta_5554 [Bradyrhizobium sp. BTAi1]
 gi|146409007|gb|ABQ37513.1| hypothetical protein BBta_5554 [Bradyrhizobium sp. BTAi1]
          Length = 1874

 Score =  134 bits (337), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 196/911 (21%), Positives = 376/911 (41%), Gaps = 92/911 (10%)

Query: 76  PANDLDNGGITHILQNI--GKNSLNI-ALRNAFMSSLIWL-ACEL---GFLIKFYTNSPM 128
           PAND D   I  +LQ I  G+ + ++  L  AF    IW+  C L   GFL        +
Sbjct: 81  PAND-DRETIGQLLQAIQKGRPTRSVYTLATAFAG--IWIVGCALITIGFL------PSL 131

Query: 129 DSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEY 188
            +    +    V+     V   P+LLF+    +  R +++   +QS+A +A+R  +PE  
Sbjct: 132 QALLGQSGGVLVLAGLSAVFFAPVLLFYFLASLAWRGQELRMIAQSMAQVAIRFSEPEGA 191

Query: 189 SSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQ 248
           +S+ + ++  A+R+E+  M + ++RAI+RA ELE  V +E+  LE  Y+ +E+RI  + Q
Sbjct: 192 ASDSIVTVGQAIRREVAAMGDGVERAIARAGELETLVANEVAALERAYSDNEVRIRALLQ 251

Query: 249 NLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKV 308
           ++  +R+ ++    Q+ ++I+ V   L+ +++L S+ I+  +     S    ++ R A +
Sbjct: 252 DIAHQRDNLVGQAEQVRSAISGVQIDLRHDIALISDAIASRVDEVAKSITGALEERGAHI 311

Query: 309 TEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVG 368
           T             +  +   LL+ L   S   T+   +  E L+ +LN     + ++  
Sbjct: 312 TAALGNAGDNMILALGERGGDLLDRLEEASAETTRAVLDASERLTTSLNFKTGHVHDEFA 371

Query: 369 NYT----LMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQS 424
           + +     ML    D+++   ++++   +   +    ++ +       S+ + L      
Sbjct: 372 DLSDRVHEMLNERIDRITSEFEQRTAAIVDGISVRTEQVHDSLKASGDSLLLELELRGGD 431

Query: 425 LRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFY 484
           L   + E      S + ++ +     +D   NTL  ++ +  +   +T +  I+ F    
Sbjct: 432 LVSKIDEASQRLSSQILASGEKASESLDATVNTLVAKVVSQTESTHDTLSTQISAFDELV 491

Query: 485 KDNLSEFESNLQGNIDKLQGCFADSH------------GNMEDLFLSNIQTIGSNLDKKT 532
           K+  +E       +   L G     H            G + +      Q I  NL    
Sbjct: 492 KNQGTELAERFARDSSTL-GALITRHITEFDRTVKTYGGEIVERMGQRTQEISENLKTYV 550

Query: 533 LLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCS 592
             F+  LS     I+        + E  L  SI S    L+ K +  D  +G + + L  
Sbjct: 551 DTFDTRLSTNSGEITATLDQRLSQFETNLQTSITSFDSSLDSKIKTFDDTVGGRLKTLEE 610

Query: 593 SFNSSYQKVSNVISDREKLFSNSL----ARVQSHFEETIAGHPQSIVDSISNSTNNLYDK 648
           SF++    V+  I  R    SNSL    A+V S  +  +     S+ D  + +  ++  +
Sbjct: 611 SFDNRATSVTATIEGRLGTLSNSLTDGAAQVLSAIDSRLTVLTTSLTDGSAQAIQSIDSR 670

Query: 649 IMVLAAALSE-SQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKL 707
           + VL ++L++ ++K+L+      A D   +I +  N +  R  E ++ +   +   +  +
Sbjct: 671 LNVLTSSLADGTEKALE------AID--GRIVSLSNIIDGRSSELTETVTARFQDIHQSI 722

Query: 708 ETI-------FQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSA 760
           ET          + +  F D   ++ + V+G +++S +   D     A    ELL   SA
Sbjct: 723 ETRVGSIARDIDQRVSQFEDLLGSRVEAVAGRIESSGRQASDELMTRA----ELL---SA 775

Query: 761 NIESELSAISKAMNK-SIDDVETISTALKERCQEL-------GSDL-------------- 798
           +I S +    +A+    ++  ETI T  +   Q L       GS L              
Sbjct: 776 SIRSHVEDAERALTDLVVNTSETIQTGARNAQQALLNVSTDVGSQLKTTSTEVERALAGA 835

Query: 799 -VNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDI 857
             N +D +LSS ++AQ  L T   +      +  AD     E  L          + +  
Sbjct: 836 GSNAADAILSSAREAQATLLTASGETATQIKSLTAD----VERTLTAAGSATAASILAGA 891

Query: 858 QKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISAS-----NTLVAKTFEECM 912
           +++     S + D A+ +  +  +V  +L     A  E I+A      +TL+A + E   
Sbjct: 892 REVQSTLVSASSDAADHVKSLAADVQHSLTGVGTATAEAITAGAREAQSTLLAASQEAAT 951

Query: 913 SNILLSYDENR 923
               L+ D  R
Sbjct: 952 QVKALTVDVQR 962



 Score =  100 bits (250), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 83/163 (50%), Gaps = 14/163 (8%)

Query: 1671 QVDKRPSGKKTKNNHAIKEWFNKIL-------SSSTHSKGKSSSHIDISDKDSLSSIDSL 1723
            +V+  P G           W + +L       +  T  +G+ S+     +      ++SL
Sbjct: 1717 RVEAPPMGPVADQGR--DNWLSDLLNRADNSTAGQTAPRGRGSATAQPGNP-----LESL 1769

Query: 1724 VENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDR 1783
              +I++ +D +   ++W  Y  GE   FSKRLYT  GQK F  +  +Y+AD   +  +DR
Sbjct: 1770 SLDIARLMDRNLAAEMWDRYQRGETKAFSKRLYTPAGQKAFDEVARKYRADRTFKQTVDR 1829

Query: 1784 YISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            YI+ FE +L ++A+ + +   ++  + S  G VYT+L HA+GR
Sbjct: 1830 YITEFERLLDDVARDDRNPQALRGQLTSETGLVYTLLAHAAGR 1872


>gi|319405768|emb|CBI79391.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 1529

 Score =  129 bits (324), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 177/325 (54%), Gaps = 31/325 (9%)

Query: 1529 VTLKEKSYDLS---NHMRQK---ICSTIPNIENIFSTLEEKSDQ----SMQVFLDSLNNK 1578
            +TL+EK   LS   N +  K   +   I + EN+ S   E++D+    S  +   +L+  
Sbjct: 1207 ITLQEKQNALSVLSNALVSKSDEVNQLIKHYENVLSLTFERTDENTRNSTHLMQRTLHEL 1266

Query: 1579 VDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQIN 1638
            ++  + + S+ +++I  ++  I  + +   + +      L ++AKE+  TIR A+ EQI 
Sbjct: 1267 INEASTRFSEAAENIRFSANEIRSEFSKINNDIDESIQKLPEKAKETTQTIRHALSEQIT 1326

Query: 1639 TLKDFQKLITDSVKNNAASYNKGLHSDEYNISQVDKR---------PSGKKTKNNHAIKE 1689
             LKD   ++ ++ K+ +A+    L +      +++K+         P   KTK N    +
Sbjct: 1327 ALKDLTNIMQNTEKDQSAATIPALLTSNSVTPEINKKIIPPQPVVQPGQNKTKQN----K 1382

Query: 1690 WFNKILSSSTHSK-------GKSSSHIDISDKDSLS-SIDSLVENISKFIDYDAFVQLWK 1741
            W + +L   +H +          SS  +    DS++ S++SLV +I + I+++A V+LW 
Sbjct: 1383 WVSDLLKRVSHEEILYSEKNNNFSSSPEQKKPDSMNESLNSLVNSIVQTINHNAAVELWN 1442

Query: 1742 SYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDD 1801
             Y  G+ +I  ++LYT  G+ +F  ++++Y  +   R+++ +YIS+FE++L +I++++ D
Sbjct: 1443 RYKRGQKNIVLEQLYTPNGKIIFETIRKKYLNNIDFRDSVSQYISDFEKLLRDISRNSGD 1502

Query: 1802 SPLVQEHIMSNYGKVYTMLVHASGR 1826
              L ++++ S+ GKVYTML HASGR
Sbjct: 1503 IRLARQYLTSDTGKVYTMLAHASGR 1527



 Score =  104 bits (259), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 267/1430 (18%), Positives = 591/1430 (41%), Gaps = 240/1430 (16%)

Query: 76   PANDLDNGGITHILQNIGKNSLNIALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYD-- 133
            PAND  +  +    +++ +N+++    +    S +W+     F+      S + S  +  
Sbjct: 112  PAND--DITVPFNFKSLKQNAVSRIYWSTTALSALWVTGG-AFIAHKLAPSGLSSLANII 168

Query: 134  -FAMRPEVITLFLVVSV---VPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYS 189
             F   P    L L V+    +PIL+ +    +I R+ ++ + +  +   A RL +P+  S
Sbjct: 169  AFVTSP----LGLAVAAGTTIPILMSWGGAQLIKRSNELRNIAILMTNAAQRLSEPQNIS 224

Query: 190  SEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQN 249
             +K  +I   +RKE+  M E I+R ++RA ELE  ++SE+  LE  Y+++E RI  + + 
Sbjct: 225  EKKAIAIGQTIRKEVAAMNEGIERTLNRAIELEAIIQSEVHNLERAYSENESRIYTLIKE 284

Query: 250  LKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVT 309
            L  ER AI+NH  ++ T I    E L +E  L + +I+ +                    
Sbjct: 285  LNNERTAILNHADRVQTVIKGTQEQLSDEFDLATSKIATN-------------------- 324

Query: 310  EKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGN 369
                  V++ AQT                  +T+    + E L   L+ +G  + NQ   
Sbjct: 325  ------VEKLAQT------------------LTQTLQKQGEDLVKKLSYAGDDVTNQ--- 357

Query: 370  YTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISL 429
                L    ++ ++ +++++ +F           +  F   +K +  T N+      + +
Sbjct: 358  ----LFEKFNETTLQVQQKNTEFFHVLGKTFDTFAERFDNNEKQLEKTFNETAAKAEMHI 413

Query: 430  QEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSI-----------T 478
             +      +++++ TD TL +VD +  TL+  I     + ++ F+  I           +
Sbjct: 414  AQ----LSTHIQTATDQTLSKVDEKFKTLDAAIIGRNNQSLQDFDEKIMQLDQQAYKLSS 469

Query: 479  DFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDI 538
             F +   + +  F   L G++D      +D+   + + F++  + + +N +K +   E  
Sbjct: 470  KFDNITSEAIEAFGKRL-GSVDLSLKKHSDT---IIESFVARSKELENNAEKLSNFLEAH 525

Query: 539  LSKKQNNISQITSMNTERLENT---LTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFN 595
             S+   N+ +IT+  T    N    +++++N+ K +L+E+ + +D+ I            
Sbjct: 526  ASQINVNLKEITTDITNVFTNGHDQISSAVNASKKVLQEEIKNVDNAI------------ 573

Query: 596  SSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAA 655
                   ++I +R + F   +A  +      +      I D++ +  + L   +  +   
Sbjct: 574  ------IDIIHERSQDFKTQIANQRDVMAIMLDSEKNKIADTLKDQIDVLTKNVSDVEKM 627

Query: 656  LSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHL 715
            LS++ + +D   K HAT++V        Q   +  ES   I  S  ++ N +E   +   
Sbjct: 628  LSQNIQIVDQHAKEHATNIV--------QCTEKLQES---ITQSCETTKNAVEEQIKN-- 674

Query: 716  HSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNK 775
                   + ++D            + D  + N+  + E+L   +  +E  +  I   + K
Sbjct: 675  ------IDIRAD-----------ALRDSLAINSFSLNEILADQARALEQRMETIHNLIAK 717

Query: 776  SIDDVETISTALKERCQELGSDLVNHSDKV-------LSSLKQAQELLCTTFAQRNDSFV 828
            S  D+  +  ALK++   + + ++N++  V       + +L+   +LL  T +Q ND  +
Sbjct: 718  S--DIH-VDMALKQQANLVENAIINNNKVVTETVQNHIKNLEGHTDLLKNTLSQSNDLLL 774

Query: 829  NALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLEN 888
            + L  +   F+ NL N++  + ++                                TLE 
Sbjct: 775  DTLQTHIGLFDENLENRARQVFER------------------------------AATLEE 804

Query: 889  HSQAMLEKISASNTLVAKTFEE---CMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSE 945
                 LEK+  +  +   TFEE    +   ++  +E+ QT+ K L +  D +R +L  S 
Sbjct: 805  TLSEKLEKVCETIDIKTSTFEERSDSLKRSMVLNNEHSQTIQKALEESADNIRISLESSV 864

Query: 946  NKIDGAIG----SASQFIRDILDENSSRIESLLSCSNNSVNSTLL--------------- 986
              I G++     + S+ +  I+   + + E+ L  + N   S+                 
Sbjct: 865  GAITGSVQEKFINISEKLASIMANETEKSEASLVAAGNQFISSFADVAIKATNIISESSN 924

Query: 987  RSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASS 1046
            R     ++ + E S++++  L  + +  + A +T T N +  + E   + +  V+     
Sbjct: 925  RITSNVEQTVHETSEKIVSTLTEQTTHTANAFATVTNNAQALINETIHASAEAVN----- 979

Query: 1047 FKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI----QKCREFFGDNIV 1102
             + L++    L Q +++   +++    +++  LE + D  ++KI     +  E  G    
Sbjct: 980  -QLLNERSNVLHQSMLAFENNLNHQLANVNNLLEEAKDQTSEKISGHMAQLTELTGYLNQ 1038

Query: 1103 AFMDEISKVMEISEK---RISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKF 1159
            A  +    +  ++++   ++S  TQE  Q++   N+ + N +    S     +  +    
Sbjct: 1039 ATYNTTESIGNLTQQICEQLSLSTQEAEQRIYAQNESLVNTLAQKNSETIQTMATVQEDL 1098

Query: 1160 I-ETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLS 1218
            I   S VLEQ  +  ++  ++     S IL+    ++    NE+ +      ++V + LS
Sbjct: 1099 INNVSAVLEQLNQSIYNIHEN-----SNILISTVQSLDGQLNETANNFFHNTNQVAEYLS 1153

Query: 1219 NLDRALESYGSTV-------FKQFKEYVQCFETNMENMES---LFDKNNDSMLLSFKERS 1268
              ++ L S   T+       F+Q       F  + + +     + +++ +++ ++ +E+ 
Sbjct: 1154 TSNQELNSNVETLQGLSQNTFEQISHITNNFGEHAKTLSEAIRVLEQSENTLNITLQEKQ 1213

Query: 1269 NILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITN 1328
            N L ++LS   +  SD ++       N +    ++   N  N+   ++  L   + + + 
Sbjct: 1214 NAL-SVLSNALVSKSDEVNQLIKHYENVLSLTFERTDENTRNSTHLMQRTLHELINEAST 1272

Query: 1329 RITDSSQDV-----------TTIISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESS 1377
            R +++++++           + I +D  +S+ K+ E+  +TT  I        T L + +
Sbjct: 1273 RFSEAAENIRFSANEIRSEFSKINNDIDESIQKLPEKAKETTQTIRHALSEQITALKDLT 1332

Query: 1378 KLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETK 1427
             + +   KD    +  +LL  + +  + +K    +I     +   Q++TK
Sbjct: 1333 NIMQNTEKDQSAATIPALLTSNSVTPEINKK---IIPPQPVVQPGQNKTK 1379


>gi|319404326|emb|CBI77921.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 1529

 Score =  126 bits (317), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 241/1123 (21%), Positives = 482/1123 (42%), Gaps = 203/1123 (18%)

Query: 783  ISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNL 842
            I+  LKE   ++ +   N  D++ S++  ++++L       +++ ++ + +    F+  +
Sbjct: 529  INVNLKEITTDISNVFTNGHDQIFSAVDASKKVLQEEIKNVDNAIIDIINERSQDFKTQI 588

Query: 843  VNQSHLLLDKLSSDIQKLTD-------IAYSKAIDVANSLTEIQGNVGVTLENHS----- 890
             NQ  ++   L S+  K+ D       +      DV  +L++    V    ++H+     
Sbjct: 589  ANQRDVMASMLDSENNKIADTLKDQIDVLTKNVSDVEKTLSQNIQIVDQHAKDHANNIIQ 648

Query: 891  --QAMLEKISASNTLVAKTFEECMSNILLSYDENRQTL-------DKKLSDHIDVLRQNL 941
              + + E I+ S        EE + NI +  D  R +L       ++ L+D    L Q +
Sbjct: 649  CTEKLQESITQSCDTTKNALEEQIKNIDIRADALRDSLAINSFALNEVLADQARTLEQRM 708

Query: 942  -------AGSENKIDGAIGSASQFIRD-ILDENSSRIESL------LSCSNNSVNSTLLR 987
                   A S+  +D A+   +  + + I + N +  E++      L    + + +TL +
Sbjct: 709  ETIHNIIAKSDIHVDMALKQQADLVENAITNNNKAVTETVQNHIKNLEGHTDLLKNTLSQ 768

Query: 988  SHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSF 1047
            SH  F   LQ +    + L D      +  V  +   LE  L E+ + +   +D   S+F
Sbjct: 769  SHDVFLDTLQTR----VGLFDENLESRARQVFERAATLEETLSEKLEKVCETIDMQTSTF 824

Query: 1048 KYLSDSIQ---TLAQELVSVI-GSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVA 1103
            +  S++++    L  E    I  ++ +S  +I   LE S+D+V   +QK           
Sbjct: 825  EERSNNLKKSIVLNNEHNQAIQKALEESADNIRLSLENSVDTVTDNVQK----------- 873

Query: 1104 FMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETS 1163
                  K   ISEK +S               +I N+    T +    +    N+FI   
Sbjct: 874  ------KFTNISEKLVS---------------IIANE----TEKSEASLATAGNQFI--- 905

Query: 1164 RVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRA 1223
                           SF+D    +++   + IS  +N     +EQ ++E           
Sbjct: 906  --------------SSFAD----VVIKATNIISESSNRIALNVEQTVNETS--------- 938

Query: 1224 LESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEIS 1283
             E   S + +Q       F T   N ++L ++       +    +  ++ +LS+RS    
Sbjct: 939  -EKVISALTEQTAHTANAFTTVSNNAQALINE-------TIHASAEAVNQLLSERS---- 986

Query: 1284 DSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISD 1343
                           NV+ Q + +  N L          +  + NR+ ++  + +  IS 
Sbjct: 987  ---------------NVLHQSMLDFQNNLSH-------QLANVNNRLEEAKDETSAKISG 1024

Query: 1344 ATDSLNKVDERLHQTTNRITET----TGHIDTVLAESSKLFEKKIKDLGEISRVSLLQM- 1398
              + L ++ + L+QT    TET    T  I   L+ S++  E++I    E    +L Q  
Sbjct: 1025 HMEQLTELTDYLNQTVYNTTETVSNLTQQIGEQLSLSTQEVEQRIYAQNESLVNTLTQKN 1084

Query: 1399 SEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSI 1458
            SE +       + LIK+   +++  +++  ++ +++N L+     L  + +E        
Sbjct: 1085 SETIQTMATVQEDLIKNVSGVIEQLNQSIYNIHENSNILISTVQSLDGQLNETAN----- 1139

Query: 1459 LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGN 1518
                       +F  +T    + + + +S  +++  +  ++  S++T   I H   + G 
Sbjct: 1140 -----------NFFHNT--NQVAEYLSTSNQELNSNVETLQGLSQNTFEQISHITNNFG- 1185

Query: 1519 KTVKTIDSNF-----------VTLKEKSYDLS---NHMRQK---ICSTIPNIENIFSTLE 1561
            +  KT+               +TL+EK   LS   N +  K   +   I + EN+ S   
Sbjct: 1186 EHAKTLSEAIRVLEQSENTLNITLQEKQNALSVLSNALISKSDEVNQLIKHYENVLSLTF 1245

Query: 1562 EKSDQ----SMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVS 1617
            E++D+    S  +   +L+  ++  + + S  +++I  ++  I  +L+   +        
Sbjct: 1246 ERADENTRNSTHLMQRTLHELINEASTRFSDAAENIRFSANEIRSELSKVNNDFNESIQK 1305

Query: 1618 LAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNA-ASYNKGLHSDE----YNISQV 1672
            L ++AKE+  TIR A+ EQI  LKD   ++ ++ K  +  + +  L S+      N   V
Sbjct: 1306 LPEKAKETTQTIRHALSEQIVALKDLTNIMHNTEKEQSTPTISPSLMSNSATSGVNKKIV 1365

Query: 1673 DKRP---SGK-KTKNNHAIKEWFNK-----ILSSSTHSKGKSSSHIDISDKDSLSSIDSL 1723
              +P   SG+ KTK N  + +   +     IL S   +   SS   + SD  +  S++SL
Sbjct: 1366 PPQPIVQSGQHKTKQNKWVSDLLERVSREEILYSEKDNNFSSSPEKEKSDSMN-ESLNSL 1424

Query: 1724 VENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDR 1783
            V +I + I+++A V+LW  Y  G+ +I ++ LYT  G+ +F  ++++Y  D   ++++++
Sbjct: 1425 VNSIVQTINHNAAVELWNRYKRGQKNIIAEHLYTPNGKIIFETIRKKYLNDIDFKDSVNQ 1484

Query: 1784 YISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            YIS FE++L +I++++ ++ L ++++ S+ GKVYTML H SGR
Sbjct: 1485 YISEFEKLLRDISRNSGNTHLARQYLTSDTGKVYTMLAHVSGR 1527



 Score =  103 bits (257), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 261/1327 (19%), Positives = 545/1327 (41%), Gaps = 204/1327 (15%)

Query: 108  SLIWLACELGFLIKFYTNSPMDSFYD---FAMRPEVITLFLVVSV---VPILLFFSFFIM 161
            S +W A    F+      S + S  +   F   P    L L V+    +PIL+ +    +
Sbjct: 142  SALW-ATGGAFIAHKLAPSGLSSLANIITFITSP----LGLAVAAGTTIPILMSWGVTQL 196

Query: 162  ISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASEL 221
            I R+ ++ + +  +   A RL +P+  S ++  +IS  +RKE+  M E I+R + RA EL
Sbjct: 197  IKRSNELRNIAILMTNAAQRLSEPQNISEKQAIAISQTLRKEVAAMNEGIERTLGRAVEL 256

Query: 222  EKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSL 281
            E  ++SE+  LE  Y+++E RI  + + L  ER AI+NH  ++ T I    E L +E  L
Sbjct: 257  EAIIQSEVHNLERAYSENESRIYTLIKELNNERTAILNHADRVQTVIKGTQEQLSDEFDL 316

Query: 282  TSEEISVHLSRAIDSFQSIVDVRIAKVTEK--------TTRIVQESAQT---ISSKIDQL 330
             + +I+ ++ +   +    +  +   + +K        T ++ ++  +T   +  K  + 
Sbjct: 317  ATSKIATNVEKLAQTLTQTLQQQGEDLVKKLSYAGDGVTNQLFEQFNETTLQVQQKNTEF 376

Query: 331  LEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQ 390
              VL  T     + FDN  + L  T + +       +      +   TD+   ++ E+ +
Sbjct: 377  FHVLGKTFDTFAERFDNNEKQLEKTFDETAAKAELHIAKLATRIQTATDQTLYSVDEKFK 436

Query: 391  QFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLRE 450
               +A      +    F EK K         L      L  K D+  S       N L  
Sbjct: 437  TLDEAIIDRNNQSLQDFDEKIKQ--------LDQQAYKLSSKFDNITSEAIEAFGNRLVN 488

Query: 451  VDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSH 510
            VD             LKE  +T    I  F +  K+        L+ N +KL G F ++H
Sbjct: 489  VD-----------LSLKEHSDTI---IESFVARSKE--------LENNAEKL-GNFLEAH 525

Query: 511  GNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKD 570
             +           I  NL + T    ++ +   + I      + + L+  + N  N++ D
Sbjct: 526  ASQ----------INVNLKEITTDISNVFTNGHDQIFSAVDASKKVLQEEIKNVDNAIID 575

Query: 571  MLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGH 630
            ++ E+ Q   + I  + + + S  +S   K+++ + D+  + + +++ V+          
Sbjct: 576  IINERSQDFKTQIANQRDVMASMLDSENNKIADTLKDQIDVLTKNVSDVEK--------- 626

Query: 631  PQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFD 690
                                     LS++ + +D   K HA +++        Q   +  
Sbjct: 627  ------------------------TLSQNIQIVDQHAKDHANNII--------QCTEKLQ 654

Query: 691  ESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKR 750
            ES   I  S +++ N LE   +          + ++D +   L  ++  ++++ ++ A+ 
Sbjct: 655  ES---ITQSCDTTKNALEEQIKN--------IDIRADALRDSLAINSFALNEVLADQART 703

Query: 751  MEELLHSGSANIESELSAISKAMNKSIDDVETIST----ALKERCQELGSDLVNHSDKVL 806
            +E+ + +    I      +  A+ +  D VE   T    A+ E  Q    +L  H+D   
Sbjct: 704  LEQRMETIHNIIAKSDIHVDMALKQQADLVENAITNNNKAVTETVQNHIKNLEGHTD--- 760

Query: 807  SSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDK-------LSSDIQK 859
                    LL  T +Q +D F++ L      F+ NL +++  + ++       LS  ++K
Sbjct: 761  --------LLKNTLSQSHDVFLDTLQTRVGLFDENLESRARQVFERAATLEETLSEKLEK 812

Query: 860  LTDIAYSKAIDVANSLTEIQGN---VGVTLEN-HSQAMLEKISASNTLVAKTFEECMSNI 915
            + +      ID+  S  E + N     + L N H+QA           + K  EE   NI
Sbjct: 813  VCE-----TIDMQTSTFEERSNNLKKSIVLNNEHNQA-----------IQKALEESADNI 856

Query: 916  LLSYDENRQT----LDKKLSDHIDVLRQNLAGSENKIDGAIGSAS-QFIRDILDENSSRI 970
             LS + +  T    + KK ++  + L   +A    K + ++ +A  QFI    D      
Sbjct: 857  RLSLENSVDTVTDNVQKKFTNISEKLVSIIANETEKSEASLATAGNQFISSFAD------ 910

Query: 971  ESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLK 1030
              ++  + N ++ +  R     ++ + E S+++I  L  + +  + A +T + N +  + 
Sbjct: 911  --VVIKATNIISESSNRIALNVEQTVNETSEKVISALTEQTAHTANAFTTVSNNAQALIN 968

Query: 1031 EQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
            E   + +  V+      + LS+    L Q ++    ++S    +++ +LE + D  + KI
Sbjct: 969  ETIHASAEAVN------QLLSERSNVLHQSMLDFQNNLSHQLANVNNRLEEAKDETSAKI 1022

Query: 1091 QKCRE-------FFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIID 1143
                E       +    +    + +S + +   +++S  TQE+ Q++   N+ + N +  
Sbjct: 1023 SGHMEQLTELTDYLNQTVYNTTETVSNLTQQIGEQLSLSTQEVEQRIYAQNESLVNTLTQ 1082

Query: 1144 STSRVRGEIVDISNKFIE-TSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNES 1202
              S     +  +    I+  S V+EQ  +  ++  ++     S IL+    ++    NE+
Sbjct: 1083 KNSETIQTMATVQEDLIKNVSGVIEQLNQSIYNIHEN-----SNILISTVQSLDGQLNET 1137

Query: 1203 RSLIEQRIHEVKDVLSNLDRALESYGSTV-------FKQFKEYVQCFETNMENMES---L 1252
             +      ++V + LS  ++ L S   T+       F+Q       F  + + +     +
Sbjct: 1138 ANNFFHNTNQVAEYLSTSNQELNSNVETLQGLSQNTFEQISHITNNFGEHAKTLSEAIRV 1197

Query: 1253 FDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANAL 1312
             +++ +++ ++ +E+ N L ++LS   +  SD ++       N +    ++   N  N+ 
Sbjct: 1198 LEQSENTLNITLQEKQNAL-SVLSNALISKSDEVNQLIKHYENVLSLTFERADENTRNST 1256

Query: 1313 KKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKV----DERLHQTTNRITETTGH 1368
              ++  L   + + + R +D+++++    ++    L+KV    +E + +   +  ETT  
Sbjct: 1257 HLMQRTLHELINEASTRFSDAAENIRFSANEIRSELSKVNNDFNESIQKLPEKAKETTQT 1316

Query: 1369 IDTVLAE 1375
            I   L+E
Sbjct: 1317 IRHALSE 1323


>gi|90422966|ref|YP_531336.1| hypothetical protein RPC_1455 [Rhodopseudomonas palustris BisB18]
 gi|90104980|gb|ABD87017.1| conserved hypothetical protein [Rhodopseudomonas palustris BisB18]
          Length = 1993

 Score =  126 bits (316), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 307/1598 (19%), Positives = 627/1598 (39%), Gaps = 248/1598 (15%)

Query: 341  ITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHI 400
            I +    R + +S TL          V  +   L +N   +S AL  +  QF   F + +
Sbjct: 530  IVERMGQRTQEISETLKT-------YVDTFDTRLTSNGGAISAALDNRLSQFETTFETRV 582

Query: 401  CEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLEN 460
              +      K KS    ++  L+SL ++   + +S            +  +D+R  TL +
Sbjct: 583  SGLDGSLDSKIKSFDAAVDGHLKSLELTFDTRANSV-----------IETIDSRIETLSS 631

Query: 461  RITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDK----LQGCFADSHGNMEDL 516
             +T    + VE+ +  ++  +     +L+E  +N   +ID     L     +   N  D 
Sbjct: 632  SLTDGAAQAVESIDTRLSQLT----QSLTEGAANAAESIDTRLSHLTQSLTEGAANATDA 687

Query: 517  FLSNIQTIGSNLDKKTLLFEDI----LSKKQNNISQITSMNTERLENTLTNSINSLKDML 572
              S +  +   L ++     D     LS+   + ++  +  T+ +E  +     +  +  
Sbjct: 688  VDSRLSELTKTLTERAAHATDAIDSRLSRLTTSFTESAADATDAIEGRIHRLTATFTEGS 747

Query: 573  EEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQ 632
                + ID+ +G+ +  L     ++ Q +   +S      ++   +     +  +A   Q
Sbjct: 748  ATATEAIDARLGRLTSALTDGAANATQAIDIRLSHLTMSLTDGATQAVHSIDSRLAHLTQ 807

Query: 633  SIVDSISNSTNNLYDKIM---------------VLAAALSESQKSLDNSLKAHATDVVHK 677
            S+ D  + + + +  +I                ++ A   E  + L+ S  A ATD+  +
Sbjct: 808  SLTDGTAQAVSAIDQRIADVTEAIDGRSSHLADIVTARFQEIHQGLETSAGAVATDIDIR 867

Query: 678  ITNAENQL-------VNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVS 730
            +T  E+ L       V R + S +N   S  +   +L    + H+     +  +      
Sbjct: 868  VTQFEDLLGSRVEAVVGRIESSGRNASDSLMARAEELSLGIKAHVEDAERSLTH------ 921

Query: 731  GILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKER 790
             ++ N+++ I       A+  +E L + SA + ++L   S  +  ++  V T        
Sbjct: 922  -LVVNTSETIQ----TGARAAQESLLAASAEVGAQLKLTSSEVENALTAVGT-------- 968

Query: 791  CQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLL 850
                     N +  ++SS + AQ  L    A       +  AD     E +L        
Sbjct: 969  ---------NAAGSIVSSARDAQATLLAASADAAGQVRSLAAD----VERSLSTAGSSTA 1015

Query: 851  DKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKI-----SASNTLVA 905
              L S  ++      + + +VAN +  +  ++  TL     A  + +     +A   LV 
Sbjct: 1016 TALLSGAREAQTTLVTTSAEVANQIRSLSADIERTLFAAGSATADSVLTGARAAQTALVT 1075

Query: 906  KTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDE 965
             + +       L+ D  R TL    S   + +  +   ++N +  A   A+  ++ +  +
Sbjct: 1076 ASSDASEHVKSLTADVER-TLSSAGSATAETILNSARDAQNALVTASSDAANHVKSLAID 1134

Query: 966  NSSRIESLLSCSNNSVNSTLLRSHQKF-DRLLQEKSDELIQLLDNKASCLSTAVSTQTIN 1024
                +E  LS + ++   ++L S ++  +RLL   SD                VS Q  +
Sbjct: 1135 ----VERTLSAAGSATADSILGSAREAQERLLSASSD----------------VSGQVKS 1174

Query: 1025 LENNLKEQEKSLSRV-VDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKL-EIS 1082
            L  ++   E++L+ V   T+A+      ++  TL        G +S    D+  +L  + 
Sbjct: 1175 LAGDV---ERTLTAVGTSTAAAILSGAREAQNTLVSASTETAGQVSALAEDVERRLSAVG 1231

Query: 1083 LDSVNQKIQKCREFFGDNIVAFMDEISKVMEIS---EKRISQRTQEISQQLLQNNDVITN 1139
            + +    +   RE     + A  D  + V  ++   E+ +++   + +  LL N   + +
Sbjct: 1232 IATAEAIVAGAREAQTSLVTASEDATNHVKSLAIDVERTLTKVGADTAASLLGNAREVQS 1291

Query: 1140 QIIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHT 1199
             ++  T+    ++  IS             E    +   + +D I     +  + + + +
Sbjct: 1292 TLVTVTAESASQMKAISADI----------ERNLATVTANTTDTIQASAANAQNALVAAS 1341

Query: 1200 NESRSLIEQRIHEV-KDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNND 1258
            NE+ + I+    E+ + V +    A  S+GST+  +  E V   +   + +  + D    
Sbjct: 1342 NEASTKIKTTSAEIERSVFA----ASGSFGSTMTGKTDELVSYVQQQTDRLAQMIDGKRG 1397

Query: 1259 SMLLSFKERSNIL----DNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKK 1314
            +++ +   R+N L    D + S+ +++  +S   AF      V N    ++    N   +
Sbjct: 1398 TLVDAIGGRTNQLTIDIDRVTSE-ALKAIESRGKAFST--TIVTN--STEVARTINGASE 1452

Query: 1315 LEALLIS----DVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHID 1370
            L    IS    D+E+ +    + S+ V         S++ V E   Q T++I  T    D
Sbjct: 1453 LATGAISKSLKDLEQASRTAIEQSRQV---------SISAVTE--MQETSKILRT----D 1497

Query: 1371 TV-----LAESSKLFEKKI----KDLGEISRVSLLQMSEIVSKF-DKNSQILIKSHDSLM 1420
            TV     L E + L ++ +    ++L  + R  + ++++ VS   D NSQ      + + 
Sbjct: 1498 TVALFERLREGNILLQEVLTGAHENLNSLERALVTRVADFVSTMNDVNSQ------NGVA 1551

Query: 1421 KAQSETKLSL--DKDANNLVDLTSRLVSKSSEAQKFVM--SILVDVKKIVEQADFLSDTV 1476
                E +L++   K +  LVDL        S +++F    + LV+   +VEQ++  +   
Sbjct: 1552 TQALEDQLTVFNTKTSRALVDL-------GSLSEQFAAHGNALVEAAALVEQSNRGTTAS 1604

Query: 1477 VKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLA-------DIGNKTVKTIDSNFV 1529
            V      ++S    ID   ++++ R      L+D +LA       DI     +T  +   
Sbjct: 1605 VAERKGELESLITTIDLRTADLDQRLSRFTGLLDESLAAAEERARDIARVVAETAGAGSA 1664

Query: 1530 TLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKT 1589
            T+  +   + +   Q+   T   +  ++     ++D   +   D  ++ V S  Q  S+ 
Sbjct: 1665 TIARQFEAVRSSAEQERRLTSEAMSELYQQGTREADAMFKQSADKFSSMVQSMKQMASEM 1724

Query: 1590 SDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLIT- 1648
             ++           L ++R+ L+R  + + +EA ES   +R  I +QI  L +  +++  
Sbjct: 1725 HNE-----------LESTREELRRGVLEIPQEAAESTAQMRKVIVDQIEALAELNRIVAR 1773

Query: 1649 -----DSVKNN-------------AASYNKG---------------LHSDEYNISQVDKR 1675
                 D V +              A   N+                L   +  +    +R
Sbjct: 1774 HGRGLDVVSSGRNAQREEEPMLAAAGGRNEAPLRQAPRGRDSSAATLPPPDLGLPSAPRR 1833

Query: 1676 ---PSGKKTKNNHAIKEWFNKILSSSTHS----KGKSSSHIDISDKDSLSSIDSLVENIS 1728
               P       +     W + +L+ + +       +S +        S + +DSL  +I 
Sbjct: 1834 TEAPPVSPADADQGRDGWLSDLLNRADNGNEREAPRSRTPQPAPQAASGNPLDSLSLDIG 1893

Query: 1729 KFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNF 1788
            + +D +   ++W  Y  GE   F+KRLYT  GQK F  +  +Y++D   +  +DRYI+ F
Sbjct: 1894 RLLDRNLAAEMWDRYQRGEAKAFTKRLYTPAGQKAFDEVGRKYRSDRNFKQTVDRYITEF 1953

Query: 1789 EEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            E +L E+A+      +++ H++S  G VYT+L HASGR
Sbjct: 1954 ERLLDEVARDERGPAVLRGHLVSETGLVYTLLAHASGR 1991



 Score =  118 bits (295), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 147/713 (20%), Positives = 294/713 (41%), Gaps = 49/713 (6%)

Query: 77  ANDLDNGGITHILQNI--GKNSLNI-ALRNAFMSSLIWLACELGFLIKFYTNSPMDSFYD 133
           AND D   I  +LQ I  G+ + N+  L + F    IWL       + F    P    + 
Sbjct: 80  AND-DRETIGQLLQAIQKGRPARNVYTLASVFAG--IWLVGAGLLTVAFL---PALQAFI 133

Query: 134 FAMRPEVITLFLVVSV--VPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSE 191
                 V+ L  + ++   P++LF+    +  R +++   +QS+A +A+R  +PE  +S+
Sbjct: 134 GQGSGGVLVLAGLAALFFAPVMLFYFLASLAWRGQELRMIAQSMAQVAIRFSEPEGATSD 193

Query: 192 KMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLK 251
            M ++  A+R+E+  M + ++RAI+RA ELE  V +E+  LE  Y+ +E+RI  + Q++ 
Sbjct: 194 SMVTVGQAIRREVAAMGDGVERAIARAGELETLVANEVSALERAYSDNEVRIRALLQDIA 253

Query: 252 QEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEK 311
            +R+ ++    Q+ ++I+ V   L+ +++L S+ I+  +     S    ++ R A +T  
Sbjct: 254 HQRDNLVGQAEQVRSAISGVQIDLRHDIALISDAIASRVDEVAKSITGALEERGAHITNA 313

Query: 312 TTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLN-------NSGRSLA 364
            +        T+  +   LL+     S   T+      E L+N+LN       N    LA
Sbjct: 314 LSTAGDHMILTLGERGGDLLDRFEEASSETTRAVLEASERLTNSLNFKTGHVHNEFVELA 373

Query: 365 NQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQS 424
           ++V +   ML    D+++   +++S   +   +    ++ +       S+ + L      
Sbjct: 374 DRVHD---MLNERIDRITGEFEQKSSSIVDGISERTEQVHDSLKNSSDSLLLELELRSGD 430

Query: 425 LRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFY 484
           L   + E  +   + + ++ D     +D   NTL  ++ +  +   +T +  ++ F    
Sbjct: 431 LVSKIDEAGNRLATQVLTSGDKASEALDVTVNTLVAKVVSQTENAHDTLSMQMSAFDELV 490

Query: 485 KDNLSEFESNLQGNIDKLQGCFADSH------------GNMEDLFLSNIQTIGSNLDKKT 532
           KD  SE       +   L G     H            G++ +      Q I   L    
Sbjct: 491 KDQGSELAERFARDSGTL-GALITRHISEFDRTVKTFGGDIVERMGQRTQEISETLKTYV 549

Query: 533 LLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCS 592
             F+  L+     IS        + E T    ++ L   L+ K +  D+ +    + L  
Sbjct: 550 DTFDTRLTSNGGAISAALDNRLSQFETTFETRVSGLDGSLDSKIKSFDAAVDGHLKSLEL 609

Query: 593 SFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGH----PQSIVDSISNSTNNLYDK 648
           +F++    V   I  R +  S+SL    +   E+I        QS+ +  +N+  ++  +
Sbjct: 610 TFDTRANSVIETIDSRIETLSSSLTDGAAQAVESIDTRLSQLTQSLTEGAANAAESIDTR 669

Query: 649 IMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLE 708
           +  L  +L+E   +  +++ +  +++   +T       +  D     +  S+  S     
Sbjct: 670 LSHLTQSLTEGAANATDAVDSRLSELTKTLTERAAHATDAIDSRLSRLTTSFTESAADAT 729

Query: 709 TIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSAN 761
              +  +H    TF   S         +T+ ID        R+   L  G+AN
Sbjct: 730 DAIEGRIHRLTATFTEGS-------ATATEAIDARLG----RLTSALTDGAAN 771


>gi|170748366|ref|YP_001754626.1| hypothetical protein Mrad2831_1948 [Methylobacterium radiotolerans
            JCM 2831]
 gi|170654888|gb|ACB23943.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
            2831]
          Length = 2487

 Score =  125 bits (315), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 267/1437 (18%), Positives = 552/1437 (38%), Gaps = 260/1437 (18%)

Query: 151  PILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEE 210
            P++LF    ++  RA++M   ++++  +A+RL +PE +S++ + ++S  VR+E+  + + 
Sbjct: 168  PVVLFVIAAMLAVRAQEMRLVARAVGEVAVRLAEPESFSTDAVLTMSQTVRREVAAVGDG 227

Query: 211  IDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAE 270
            ++RA++RA ELE  VR EI  LE  Y+ +E+RI ++   L  +REAI+ +  ++ ++I  
Sbjct: 228  VERALARAGELETLVRGEIATLERAYSDNEIRIRSLVDELVAQREAIVTNAERVRSAITG 287

Query: 271  VHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVT----EKTTRIVQESAQTISSK 326
             H+SL ++L   S+ I   ++ A +     ++ R A +T    E   R+V      ++++
Sbjct: 288  SHQSLSQDLEGASDRIVSAVTGAGERVTGALETRGAAITASLGEAGDRVV----NLMTAR 343

Query: 327  IDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALK 386
               L++ L +TS  +   F    E+L+       RS  ++ G  T               
Sbjct: 344  GSDLIDTLAATSHEVRGSFQEVGETLT-------RSFEDRAGTAT--------------- 381

Query: 387  EQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDN 446
                    AF +    ++   SE   ++T TL            E+  S  S+       
Sbjct: 382  -------GAFQAAGTALAERLSENAGALTRTL------------EETGSRVSDALERQAG 422

Query: 447  TLREVDNRTNT-LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGC 505
            T+RE   R+ T LE+   +   E+ E F     + ++ + +  S    ++ G    L+  
Sbjct: 423  TVRETFERSVTGLESAFLSRGSELTERFGAMGAEITARFAETGSALTQDIAGRGLALR-- 480

Query: 506  FADSHGNMEDLFLSNIQTI-GSNLD------KKTLLFEDILSKKQNNISQITSMNTERLE 558
                   +E   LS  +TI G   D             + L+ +   +        ER+ 
Sbjct: 481  -----AEIESAGLSVAETIEGRGRDAQAALALAASGAGETLAARAGAVRDDLVGTAERIA 535

Query: 559  NTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLF----SN 614
              L+    +L + ++    R+D  +  ++ +L     ++ ++    I+ R +        
Sbjct: 536  EALSERGGALAERMDGIAARLDETVTVRAADLEHRVAAAAERAGGSIAHRTETVAANLEA 595

Query: 615  SLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDV 674
            + A +   FE   A   QS+  ++   +  +  +     AAL     +  ++L+  A D 
Sbjct: 596  AFAALGQGFETGAASAVQSLRGTVEGLSGEIDGRTAEAVAALQRGADAATSALRGTAEDA 655

Query: 675  V---------------HKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQ---KHLH 716
                             ++ ++   L  R +E++  +  + + ++   ET  +     L 
Sbjct: 656  TGAVESRTLEAVRVFERRVADSAAALSARTEEAAAALRAAADQASQAAETQTRDAAARLA 715

Query: 717  SFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKS 776
               DT    S  V+G ++  T  +   F + A R             +EL A      + 
Sbjct: 716  EALDTLRTASGEVTGAVEAETAILTARFRDAADRA-----------GTELGA------RG 758

Query: 777  IDDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQS 836
             + V  +  AL     +L  +L   +     SL +A   +    A R      A  ++  
Sbjct: 759  TEAVAAVRAAL----DDLNRELAARTGDATGSLAEAARAISADLAARIGEMEAAFGEHGR 814

Query: 837  KFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQ--------GNVGV---T 885
                 L + +     ++S   + +     S+   +A++L++          G V     T
Sbjct: 815  GVAELLASHADETQARISGTGRDIVLAVASQGARIADTLSQTGASFAETADGRVRAIDET 874

Query: 886  LENHSQAMLEKISASNTL--------------VAKTFEECMSNILLSYDEN-RQTLDKKL 930
            L N   A+ E I+  + L              V    EE M  +L    E   +T+  + 
Sbjct: 875  LGNRLAALQETIARGDILADRINRDTAALGETVGARLEE-MDRLLTGKGEAVAETIATRA 933

Query: 931  SDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQ 990
             +   ++  +L G E +      + +  +  ++ +    I+  L    N+V+  L     
Sbjct: 934  REAGSLIETHLGGLETRSAERAAAIAAAVAALVGQ----IDDHLGSRANAVDEALRARTD 989

Query: 991  KFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSL-------------- 1036
            +  R++ E    L+++L+ + S L   ++  T  +   ++E                   
Sbjct: 990  EMGRIMAEGHRGLMEMLEGRTSGLGQDIARHTGEIARRIEESAGHFDTGVIGRLQAIAET 1049

Query: 1037 ----SRVVDTS--ASSF----------KYLSDSIQTLAQELVSVI--------GSMSQST 1072
                +R+VD S    +F          + + + +    ++LV++I        G+M++  
Sbjct: 1050 LDQRARLVDESFGVQAFEAIRLIEARTRAVDEELAGRTRDLVAMIADRTGGLDGAMAERV 1109

Query: 1073 TDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQ 1132
              ++G +E       + ++       D+++  +DE +   E ++  ++ RT+ +     +
Sbjct: 1110 RALTGTIE----EATRGLEAALANRADSMIRLVDERT---ESADAALAARTEAVHAAFAE 1162

Query: 1133 NNDVITNQIIDSTSRVRGEIVD--------ISNKFIETSRVL-----------EQREEKF 1173
              D++   I +  + + GE+ +        I  +  E +R+L           +QR E  
Sbjct: 1163 RADLLGRLIDERIAAMSGELDEKGRAVFGAIGGRITELARLLDRGGSSLAELIDQRGESV 1222

Query: 1174 HSALDSFSDNISRIL----LDVDHTISSHTNESRSLIEQRIHEVKDVL------------ 1217
             + L     +  R+L      + HT+SS T +   L+++ +  V  +L            
Sbjct: 1223 LAKLQQTIADAERMLDAGEGRLGHTLSSRTADISGLLDEGVRSVHTLLDDRTNQIRVMLD 1282

Query: 1218 -------SNLD-------RALESYGSTVF----KQFKEYVQCFETNMENMESLFDKNNDS 1259
                   + LD        AL+  G  +       F       +     + SLFD+    
Sbjct: 1283 DHAGTLAATLDGRMGPIHEALDGRGQAMVAALEGAFGSATGALDDRTRQLGSLFDERLGH 1342

Query: 1260 MLLSFKERSNILDNILSQRSM-------EISDSISGAFHKEGNAVVNVIDQQIYNAANAL 1312
            +      R N L + L+ R+        E   ++ G     G      +D +I +    L
Sbjct: 1343 LESLVDGRGNRLADTLTARAQALRTLFEEAQSALDGVVEGGGGRFAAAVDARIQSLRAVL 1402

Query: 1313 KKLEALLISDVE----KITNRITDSSQDVTTIISDATDSLNK-VDERLHQTTNRITETTG 1367
            ++  A + + VE    ++   +   +Q + T+  +A   L   VD R  +  + I   T 
Sbjct: 1403 EEAPAAVSALVETRERQLAATLDARTQRLQTLFEEAQAGLRDLVDGRGQEVADAIAARTE 1462

Query: 1368 HIDTVL----AESSKLFEKKIKDL--------GEISRVSLLQMSEIVSKFDKNSQIL 1412
             + T L    A+ + L + ++ DL        GEI R+   +  +I    +  +Q L
Sbjct: 1463 GLRTTLDAAPAQMADLLDTRLSDLQGLFERAQGEIDRLVDSRGRQIAGTIEHRTQAL 1519



 Score =  108 bits (270), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 71/108 (65%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            ++D++  +I+K I++   V LW+ Y  GE ++F  R+YT +G+  F  +Q +Y+ D+  R
Sbjct: 2376 ALDTISTDIAKMIEHRTAVDLWERYRRGEPNLFDPRIYTPQGRATFAEIQRRYRTDAEFR 2435

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             ++DRY+S FE +L ++ +++ D+     ++ S  GKVYTML HASGR
Sbjct: 2436 RSVDRYVSEFERLLGDVVKNDSDAKRTDAYLTSETGKVYTMLAHASGR 2483



 Score = 92.8 bits (229), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 186/1019 (18%), Positives = 379/1019 (37%), Gaps = 151/1019 (14%)

Query: 349  IESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSH---ICEM-S 404
            + ++   L++  R LA + G+ T  L      +S  L  +  +   AF  H   + E+ +
Sbjct: 762  VAAVRAALDDLNRELAARTGDATGSLAEAARAISADLAARIGEMEAAFGEHGRGVAELLA 821

Query: 405  NFFSEKQKSITVTLNDVL-----QSLRIS--LQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            +   E Q  I+ T  D++     Q  RI+  L +   SF      T D  +R +D    T
Sbjct: 822  SHADETQARISGTGRDIVLAVASQGARIADTLSQTGASFAE----TADGRVRAIDE---T 874

Query: 458  LENRITAFLKEIV------ETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQ---GCFAD 508
            L NR+ A  + I       +  N             L E +  L G  + +       A 
Sbjct: 875  LGNRLAALQETIARGDILADRINRDTAALGETVGARLEEMDRLLTGKGEAVAETIATRAR 934

Query: 509  SHGNMEDLFLSNIQTIGSNLDKKTLL--------FEDILSKKQNNISQITSMNTERLENT 560
              G++ +  L  ++T  +                 +D L  + N + +     T+ +   
Sbjct: 935  EAGSLIETHLGGLETRSAERAAAIAAAVAALVGQIDDHLGSRANAVDEALRARTDEMGRI 994

Query: 561  LTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQ 620
            +      L +MLE +   +  DI + + E+      S                       
Sbjct: 995  MAEGHRGLMEMLEGRTSGLGQDIARHTGEIARRIEESA---------------------- 1032

Query: 621  SHFEETIAGHPQSIVDSISNSTN--------NLYDKIMVLAAALSESQKSLDNSLKAHAT 672
             HF+  + G  Q+I +++               ++ I ++ A      +++D  L     
Sbjct: 1033 GHFDTGVIGRLQAIAETLDQRARLVDESFGVQAFEAIRLIEA----RTRAVDEELAGRTR 1088

Query: 673  DVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGI 732
            D+V  I +    L     E  + +  +   +   LE        S     + +++     
Sbjct: 1089 DLVAMIADRTGGLDGAMAERVRALTGTIEEATRGLEAALANRADSMIRLVDERTESADAA 1148

Query: 733  LKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQ 792
            L   T+ +   F+  A  +  L+    A +  EL    +A+  +I    T    L +R  
Sbjct: 1149 LAARTEAVHAAFAERADLLGRLIDERIAAMSGELDEKGRAVFGAIGGRITELARLLDRGG 1208

Query: 793  ELGSDLVNH-SDKVLSSLKQ----AQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSH 847
               ++L++   + VL+ L+Q    A+ +L     +   +  +  AD     +   V   H
Sbjct: 1209 SSLAELIDQRGESVLAKLQQTIADAERMLDAGEGRLGHTLSSRTADISGLLDEG-VRSVH 1267

Query: 848  LLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKI-----SASNT 902
             LLD  ++ I+ + D     A  +A +L    G +   L+   QAM+  +     SA+  
Sbjct: 1268 TLLDDRTNQIRVMLD---DHAGTLAATLDGRMGPIHEALDGRGQAMVAALEGAFGSATGA 1324

Query: 903  LVAKT------FEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAI-GSA 955
            L  +T      F+E + ++    D     L   L+     LR     +++ +DG + G  
Sbjct: 1325 LDDRTRQLGSLFDERLGHLESLVDGRGNRLADTLTARAQALRTLFEEAQSALDGVVEGGG 1384

Query: 956  SQF----------IRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQ 1005
             +F          +R +L+E  + + +L+      + +TL    Q+   L +E    L  
Sbjct: 1385 GRFAAAVDARIQSLRAVLEEAPAAVSALVETRERQLAATLDARTQRLQTLFEEAQAGLRD 1444

Query: 1006 LLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVSVI 1065
            L+D +   ++ A++ +T  L   L      ++ ++DT  S  + L +  Q     LV   
Sbjct: 1445 LVDGRGQEVADAIAARTEGLRTTLDAAPAQMADLLDTRLSDLQGLFERAQGEIDRLVDSR 1504

Query: 1066 GSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQE 1125
            G        I+G +E       Q +Q   E     I   ++E        E R+++  +E
Sbjct: 1505 GRQ------IAGTIE----HRTQALQATIEGVNPAIAGLLEE-------RETRLAETLKE 1547

Query: 1126 ISQQLLQNNDVITNQ---IIDSTSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSD 1182
             + +L    D + N+   +++ T R      D+S +       L    E+  +A++   +
Sbjct: 1548 RTGELQTLFDRVQNRLGALVEGTGR------DVSERVDARVETLRATFEQARAAIEGLLE 1601

Query: 1183 NISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTVFKQF------- 1235
            +  + L      +++    + +L+E  + + +  L  LD A+E    T+ + F       
Sbjct: 1602 DRGQAL------VAAAEGRTGALVE--VFDAR--LRALDGAVEDRTGTLVETFDARLRAL 1651

Query: 1236 --------KEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSI 1286
                       V+ F+  +  ++   +    +++ +F  R   LD ++  R+  ++ ++
Sbjct: 1652 DGAVEDRTGALVETFDARLRALDGAVEGRTGTLVETFDARLRALDGVVEGRTAALAQAV 1710



 Score = 48.1 bits (113), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 51/256 (19%), Positives = 100/256 (39%), Gaps = 38/256 (14%)

Query: 255  EAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTR 314
            E +  H   L  +++    +L   +   +E +     R   +  ++VD R     E  +R
Sbjct: 1785 EQVDAHNAALAETLSRREAALAGLIDARTEALGAGFERRATALGALVDAR----GEALSR 1840

Query: 315  IVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLML 374
             + ESA+T+   I++                  R  +L  ++  SGR++ + +  +   L
Sbjct: 1841 RLAESAETLVRAIEE------------------RGGALLASVEGSGRAVGDSLEGHVERL 1882

Query: 375  GNNTDK----VSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQ 430
                D     +S AL ++++   +        ++    E+ + + V      + LR +++
Sbjct: 1883 RGAIDGPMMDLSRALSDRAEAIERTLAETGVPLAESLRERTEELAVQSRASAELLRAAVE 1942

Query: 431  EKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSE 490
            +      S L  T D   RE           + A L+ I E  N ++TD  +    NL  
Sbjct: 1943 DGAGRTLSELFETNDRMGRE-----------LGALLQRI-EAANTALTDLVAGADTNLGA 1990

Query: 491  FESNLQGNIDKLQGCF 506
             E  L G I+++QG  
Sbjct: 1991 IEQGLAGRIEQVQGAL 2006


>gi|299131819|ref|ZP_07025014.1| Apolipoprotein A1/A4/E [Afipia sp. 1NLS2]
 gi|298591956|gb|EFI52156.1| Apolipoprotein A1/A4/E [Afipia sp. 1NLS2]
          Length = 1421

 Score =  122 bits (307), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 130/258 (50%), Gaps = 36/258 (13%)

Query: 1602 EDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITD------------ 1649
            ++L+ +R  L+R  + L +EA ES   +R  I +QI  L +  +++              
Sbjct: 1165 QELDATRADLRRGVLELPQEASESTAQMRKVIVDQIEALAELNRIVARHGRGLDVAATTR 1224

Query: 1650 ------SVKN--NAASYNKGL-HSDEYNISQVD-KRPSGKKTK--------NNHAIKEWF 1691
                  +V N  NAA   +   +    N+   D   P+G++T+        ++ A   W 
Sbjct: 1225 QEEPAMAVANSRNAAPAPRSRDYGSASNLPPPDLGAPNGRRTEAPSVSPAGSDQARDGWL 1284

Query: 1692 NKILS---SSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGED 1748
            + +L+   ++ + +G+SS     +   S + +D+L  +IS+ +D D   ++W  Y  GE 
Sbjct: 1285 SDLLNRTDATVNERGRSS---QTARAPSGNPLDALSLDISRLVDRDLAAEMWDRYQRGER 1341

Query: 1749 DIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEH 1808
              F+KRLYT  GQK F  +  +Y+AD A +  +DRYI+ FE +L E+++       ++ H
Sbjct: 1342 KAFNKRLYTPSGQKAFDEVARKYRADRAFKQTVDRYINEFERLLDEVSRDERGPAALRGH 1401

Query: 1809 IMSNYGKVYTMLVHASGR 1826
            + S  G VYT+L HA+GR
Sbjct: 1402 LTSETGLVYTLLAHAAGR 1419



 Score =  122 bits (306), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 190/936 (20%), Positives = 405/936 (43%), Gaps = 157/936 (16%)

Query: 73  GFYPANDLDNGGITHILQNIGKNSLNIALRNAFMSSLI----WLACELGFLIKFYTNSPM 128
           G   AND D   I  +LQ++ +       R+A+  + I    W+A   GFLI  +  S +
Sbjct: 55  GRQAAND-DREAIGAVLQSLQRGRPR---RSAYTFAAIFSGLWIAA-AGFLIVSFLPS-L 108

Query: 129 DSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEY 188
           ++          +     V V P++LF+    +  R++++   +QS+A +A+R  +PE  
Sbjct: 109 EAMVGSNGGALALVGLACVFVTPLILFYFIASVSWRSQELSMIAQSMAQMAVRFSEPEHV 168

Query: 189 SSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQ 248
           +S+ M ++  A+R+E+  M + ++RAI+RA ELE  V +E+  LE  Y+ +E+RI  + Q
Sbjct: 169 ASDAMVTVGQAIRREVAAMGDGVERAIARAGELEALVTNEVSALERAYSDNEVRIRALLQ 228

Query: 249 NLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS------------------EEISVHL 290
           ++  +R+ ++    Q+  +I+ V   L++++++ S                  EE S H+
Sbjct: 229 DISTQRDNLVGQAEQVRNAISGVQIDLRQDIAIISDAIAARVDEVTNNITHMLEERSDHI 288

Query: 291 SRAI------------DSFQSIVDVRIAKVTEKTTRIVQESAQTISSKI----------- 327
           + A             +    ++D R+ + + +T   V E+++ +++ +           
Sbjct: 289 TGAFAAAGDNMIIALGERGGDLLD-RLEEASNQTANAVLEASEQLTANLNFKTSHIHDEF 347

Query: 328 ----DQLLEVLHSTSIVITKDFDN-----------RIESLSNTLNNSGRSLANQVGNYTL 372
               D + E+L+     IT DF+            R E + +TL NSG SL N++   ++
Sbjct: 348 AELADNIHELLNDRVERITGDFEQRANSIVDGITLRTEQVHDTLKNSGDSLLNEMELRSI 407

Query: 373 MLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEK 432
            L    D+ S  L +           HI   S+  SE   S+ VT+N             
Sbjct: 408 DLAAKVDEASTRLAD-----------HILTSSDKVSE---SLDVTIN------------- 440

Query: 433 EDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFE 492
             +  + + S T++T   + +R  + E  +     E+ E F        +    +++EF+
Sbjct: 441 --TLVAKVASQTESTHEALSSRIASFETLMREQGGELAEKFARDSGTLGALITRHVAEFD 498

Query: 493 SNLQ---GNIDKLQG----CFADSHGNMEDLFLSNIQTIGS----NLDKKTLLFEDILSK 541
             ++   G I +  G      +DS     D F + + T G+     LD++  +F+  L  
Sbjct: 499 RTVKTYGGEIVERMGQHTQGISDSLKAYVDTFDTRVTTHGAQIRDTLDERLGVFQSALD- 557

Query: 542 KQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKV 601
                S++T+     LE +L  +I S  + ++++   ++S   +++E +  + ++    +
Sbjct: 558 -----SRVTT-----LEVSLDTTIKSFDNTIDQRLSALESSFDRRAETVTQAIDAQSTAL 607

Query: 602 SNVISDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYD-KIMVLAAALSESQ 660
           ++ +S R   F      +++H     AG   S +++      NL D ++   A+ +  S 
Sbjct: 608 ADTLSTR---FGEMQKGIENH-----AGSVASDIEARVVRFENLLDIRVESAASRVEASG 659

Query: 661 KSLDNSLKAHATDVVH----KITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLH 716
           +    +L +   ++      ++ ++E  L N   E+S+ I     ++   L  +      
Sbjct: 660 QKASETLISRTEEITQSIKARVEDSERSLTNLAVETSEAIQSGARNAQQSLLAL------ 713

Query: 717 SFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKS 776
                    S  V   L+ +T  ++     +A+  E  L   S N  +++ + S  + ++
Sbjct: 714 ---------SGEVGSQLRATTTEMERTIQTSARETESTLFLASNNASAQIKSASAEIERT 764

Query: 777 I-DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQ 835
           I    E+    L  + +E+   +   +D++ + L + +  L      + +     L D  
Sbjct: 765 IATGTESFGQTLSNKVEEITGGVREQTDRIAAILDEKRAPLTEAITAKTEQLAAILGDRS 824

Query: 836 SKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQ---GNVGVTLENHSQA 892
            +    +  +S  L++ LS+   K  + A++ +    ++L  I+    +  V L N S  
Sbjct: 825 GQLSLMIDGKSAQLVEALST---KTHEFAHTISGATTSALKAIETQSSDFTVQLMNQSSD 881

Query: 893 MLEKISASNTL----VAKTFEECMSNILLSYDENRQ 924
           +  +I+A++ L    V +  ++  ++   + D++RQ
Sbjct: 882 ISRQITAASELATGSVGRALKDVETSTRAAIDQSRQ 917


>gi|319407330|emb|CBI80973.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 1529

 Score =  122 bits (306), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 94/322 (29%), Positives = 174/322 (54%), Gaps = 25/322 (7%)

Query: 1529 VTLKEKSYDLS---NHMRQK---ICSTIPNIENIFSTLEEKSDQ----SMQVFLDSLNNK 1578
            VTLKEK   LS   N +  K   +   I + EN+ S   E++D+    S  +   +L+  
Sbjct: 1207 VTLKEKQNALSILSNALVSKSDEVNQLIKHYENVLSLTFERADENTRNSTHLMQRTLHEL 1266

Query: 1579 VDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQIN 1638
            ++  + + S  +++I  ++  I  +L+   +        L ++AKE+  TIR A+ EQI 
Sbjct: 1267 INEASTRFSDAAENIRFSANEIRSELSKINNDFDESIQKLPEKAKETTQTIRHALSEQIV 1326

Query: 1639 TLKDFQKLITDSVKNNAASYNKGL-----HSDEYNISQVDKRP---SGK-KTKNNHAIKE 1689
             LK+   ++ ++ K+ +      L      + E N   V  +P   SG+ KTK N  + +
Sbjct: 1327 ALKNLTNIVQNTEKDQSTPTMSPLLMSNNATPEINKKIVPPQPIVQSGQNKTKQNKWVSD 1386

Query: 1690 WFNK-----ILSSSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYT 1744
               +     IL S   +   SS   + SD  +  S++SLV +I + I+++A V+LW  Y 
Sbjct: 1387 LLERVSREEILYSEKDNDFSSSPKQEKSDSMN-ESLNSLVNSIVQTINHNAAVELWNRYK 1445

Query: 1745 LGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPL 1804
             G+ +I ++ LYT  G+ +F  ++++Y  D   ++++++YIS FE++L +I++++ ++ L
Sbjct: 1446 RGQKNIIAEHLYTPNGKIIFETIRKKYLNDIDFKDSVNQYISEFEKLLRDISRNSGNTHL 1505

Query: 1805 VQEHIMSNYGKVYTMLVHASGR 1826
             ++++ S+ GKVYTML H SGR
Sbjct: 1506 ARQYLTSDTGKVYTMLAHVSGR 1527



 Score = 99.8 bits (247), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 261/1347 (19%), Positives = 544/1347 (40%), Gaps = 244/1347 (18%)

Query: 108  SLIWLACELGFLIKFYTNSPMDSFYD---FAMRPEVITLFLVVSV---VPILLFFSFFIM 161
            S +W A    F+      S + S  +   F   P    L L V+    +PIL+ +    +
Sbjct: 142  SALW-ATGGAFIAHKLAPSGLSSLANIITFVTSP----LGLAVAAGTTIPILMSWGVTQL 196

Query: 162  ISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASEL 221
            I R+ ++ + +  +   A RL +P+  S ++  +I   +RKE+  M E I+R + RA EL
Sbjct: 197  IKRSNELRNIAILMTNAAQRLSEPQNISEKQAIAIGQTLRKEVAAMNEGIERTLGRAVEL 256

Query: 222  EKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSL 281
            E  ++SE+  LE  Y+++E RI  + + L  ER AI+NH  ++ T I    E L +E  L
Sbjct: 257  EAIIQSEVHNLERAYSENESRIYTLIKELNNERTAILNHADRVQTVIKGTQEQLSDEFDL 316

Query: 282  TSEEISVHLSRAIDSFQSIVDVRIAKVTEK--------TTRIVQESAQT---ISSKIDQL 330
             + +I+ ++ +   +    +  +   + +K        T ++ ++  +T   +  K  +L
Sbjct: 317  ATSKIATNVEKLAQTLTQTLQQQGEDLVKKLSYAGDGVTNQLFEQFNETTLQVQQKNTEL 376

Query: 331  LEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQ 390
              VL  T     + FDN  + L  T + +       +      + + T++   ++ E+ +
Sbjct: 377  FHVLGKTFDTFAERFDNNEKQLEKTFDETAAKAELHIAKLATRIQDATNQTLYSVDEKFK 436

Query: 391  QFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLRE 450
               +A      +    F EK K +                   D     L S  DN   E
Sbjct: 437  TLDEAIIDRNNQSLQDFDEKIKQL-------------------DQQAYKLSSKFDNITSE 477

Query: 451  VDNRTNTLENRITAF---LKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFA 507
                    ENR+      LKE  +T    I  F +  K+        L+ N +KL G F 
Sbjct: 478  A---IEAFENRLVNVDLSLKEHSDTI---IESFVARSKE--------LENNAEKL-GNFL 522

Query: 508  DSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINS 567
            ++H +           I  NL + T    ++ +   + I      + + L+  + N  N+
Sbjct: 523  EAHASQ----------ISVNLKEITTDISNVFTSGHDQIFSAVDASKKVLQEEIKNVDNA 572

Query: 568  LKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETI 627
            + D++ E+ Q     I  + + + S  +S   K+++ + D+  + + +++ V+       
Sbjct: 573  IIDIINERSQDFKIQIANQRDVMASMLDSENNKIADTLKDQIDVLAQNVSDVEK------ 626

Query: 628  AGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVN 687
                                        LS++ + +D   K HA +++        Q   
Sbjct: 627  ---------------------------MLSQNIQIVDEHAKDHANNII--------QCTE 651

Query: 688  RFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNN 747
            +  ES   I  S +++ N LE   +          + ++D +            D  + N
Sbjct: 652  KLQES---ITQSCDTTKNALEEQIKN--------IDIRADALR-----------DSLAIN 689

Query: 748  AKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKV-- 805
            +  + E+L   +  +E  +  I   + KS  D+  +  ALK++   + + ++N++  V  
Sbjct: 690  SFALNEVLADQARTLEQRMETIHNIIAKS--DIH-VDMALKQQTDLVENAIINNNKIVTE 746

Query: 806  -----LSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKL 860
                 + +L+   +LL  T +Q ND F++ L      F+ NL  ++  + ++        
Sbjct: 747  TFQNHIKNLEGHTDLLKNTLSQSNDVFLDTLQTRIGLFDENLEGRARQVFER-------- 798

Query: 861  TDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNI---LL 917
                                    TLE      LEK+  +  +   TFEE   N+   ++
Sbjct: 799  ----------------------AATLEETLSEKLEKVCETIDMQTSTFEERSDNLKKSIV 836

Query: 918  SYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCS 977
              +E+ Q + K L +  D +R +L   EN +D A  +  + + +I    S ++ S+++  
Sbjct: 837  LNNEHNQVIQKALEESADNIRISL---ENSVDTAANNVQEKLTNI----SEKLVSIIANE 889

Query: 978  NNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLS 1037
                 ++L  +  +F     + + +   ++   ++ ++  V  QT+N     +  EK +S
Sbjct: 890  TEKSEASLTAAGSQFISSFADIAIKATNIISESSNRIALNVE-QTVN-----ETSEKVIS 943

Query: 1038 RVVDT---SASSFKYLSDSIQTLAQELVSVIGS------------MSQSTTDISGKLEIS 1082
             + +    +A++F  +S++ Q L  E +                 + QS  D    L   
Sbjct: 944  ALTEQTAHTANAFTTVSNNAQALINETIHASAEAVNQLLNERSNVLHQSMLDFQNNLSHQ 1003

Query: 1083 LDSVNQKIQKCREFFGDNIVAFMDEISKV-------------------MEISEKRISQRT 1123
            L +VN ++++ R      I   M++++++                    +I E+ +S  T
Sbjct: 1004 LANVNSRLEEARNETSAKISGHMEQLTELTDYLNQAVYNTTETVSNLTQQIGEQ-LSLST 1062

Query: 1124 QEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIE-TSRVLEQREEKFHSALDSFSD 1182
            QE+ Q++   N+ + + +    S     +  +    I+  S VLEQ  +  ++  ++   
Sbjct: 1063 QEVEQRIYAQNESLVSTLTQKNSETIQTMATVQEDLIKNVSGVLEQLNQSIYNIHEN--- 1119

Query: 1183 NISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTV-------FKQF 1235
              S IL+    ++    NE+ +      ++V   LS  ++ L S   T+       F+Q 
Sbjct: 1120 --SNILISTVQSLDGQLNETANNFFHNSNQVTQYLSTSNQELNSNVETLQGLSQNTFEQI 1177

Query: 1236 KEYVQCFETNMENMES---LFDKNNDSMLLSFKERSNILDNILSQRSMEISDSISGAFHK 1292
                  F  + + +     + +++ +++ ++ KE+ N L +ILS   +  SD ++     
Sbjct: 1178 SHITNNFGEHAKTLSEAIRVLEQSENTLNVTLKEKQNAL-SILSNALVSKSDEVNQLIKH 1236

Query: 1293 EGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKV- 1351
              N +    ++   N  N+   ++  L   + + + R +D+++++    ++    L+K+ 
Sbjct: 1237 YENVLSLTFERADENTRNSTHLMQRTLHELINEASTRFSDAAENIRFSANEIRSELSKIN 1296

Query: 1352 ---DERLHQTTNRITETTGHIDTVLAE 1375
               DE + +   +  ETT  I   L+E
Sbjct: 1297 NDFDESIQKLPEKAKETTQTIRHALSE 1323


>gi|218532809|ref|YP_002423625.1| Apolipoprotein A1/A4/E [Methylobacterium chloromethanicum CM4]
 gi|218525112|gb|ACK85697.1| Apolipoprotein A1/A4/E [Methylobacterium chloromethanicum CM4]
          Length = 2797

 Score =  122 bits (306), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 121/621 (19%), Positives = 246/621 (39%), Gaps = 94/621 (15%)

Query: 104 AFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVV--PILLFFSFFIM 161
           A ++S +WL      L+    N        F      +   +V + +  PI+LF    ++
Sbjct: 121 AAIASFLWLNG----LVALAWNQSGGDLKTFITGLTALQAAVVATAIAGPIVLFLITAML 176

Query: 162 ISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASEL 221
             RA +M   ++++  +A+RL +PE +S++ + ++S  VR+E+  + + ++RA++RA EL
Sbjct: 177 AVRAHEMRLVARAVGEVAIRLAEPESFSTDAVLTMSQTVRREVAAVGDGVERALARAGEL 236

Query: 222 EKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSL 281
           E  VR EI  LE  Y+ +E+RI ++   L  +RE+I+    ++  +IA  HE+L  EL  
Sbjct: 237 ETLVRGEISTLERAYSDNEIRIRSLVDELIAQRESIVGSADRVRGAIAGSHENLSSELEG 296

Query: 282 TSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTS--- 338
            +E I   ++ A +     +D R   +TE    + +     +S++ D L+  L +TS   
Sbjct: 297 AAERIVAAINGAGERVTGALDARGTAITEALGEVGERVVGNVSTRGDDLVRQLTATSEGV 356

Query: 339 --------IVITKDFDNRIESLSNTLNNSG----RSLANQVGNYTLMLGNNT-------D 379
                     +T     R + ++     +G    R+LA+  G     L           D
Sbjct: 357 RGGLEEIGTTLTSALQQRADEVTQAFERTGGALTRTLADNAGAVAQSLSETGTGLIEALD 416

Query: 380 KVSIALKE----QSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDS 435
           +   A++E     ++   +AF S   E++  F++   +IT               E  + 
Sbjct: 417 RQGGAVRETFERSTRGLEEAFLSRGTELTERFAQTGGAITA-----------RFAETGEG 465

Query: 436 FCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNL 495
              N  +T      ++  R  +L   I A    + E       D  +           + 
Sbjct: 466 LSRNFAATGAAISEDIAVRGASLRTEIEAAGTGVSELIEGRGRDAQAALALAAGSVADDF 525

Query: 496 QGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTE 555
              ID+++           D FL++       +D + L                      
Sbjct: 526 STRIDRVR-----------DAFLASATHAAETMDGRGL---------------------- 552

Query: 556 RLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNS 615
                       L   +E    R+D  I  +   L S+ +++ ++V  ++++R       
Sbjct: 553 -----------ELAARIEAAASRVDDVIAVQGGALASNLDTAGERVVGLMTER------- 594

Query: 616 LARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVV 675
            A+  +  E+ +AG   S   + + +  +L + +  L   L     +  + ++ +A    
Sbjct: 595 AAQAAATIEQALAGLGASFAANANGTAESLGETVARLGQDLDARTGAAQDGIRRNAETAT 654

Query: 676 HKITNAENQLVNRFDESSKNI 696
             +  +   L  R  E+++ +
Sbjct: 655 ASVGASVEALERRLREAAEAM 675



 Score =  113 bits (283), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 73/108 (67%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S+D++  +I++ +D+ A V+ W+ Y  G+ ++F  RLYT++G++ F  +Q +Y+AD+  R
Sbjct: 2686 SLDAISTDIARMVDHQASVEFWQRYRQGDTNLFDGRLYTVQGRQTFEQIQRRYRADAEFR 2745

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
              +DRY+  FE +L E+ +++ D+     ++ S  GKVYTML HASGR
Sbjct: 2746 RTVDRYVGEFERLLGEVTKNDRDTKRADAYLTSETGKVYTMLAHASGR 2793



 Score = 91.3 bits (225), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 193/1110 (17%), Positives = 418/1110 (37%), Gaps = 176/1110 (15%)

Query: 275  LKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVL 334
            + +ELS  S E +  L+RA +     V  R     E     ++     ++++ +     L
Sbjct: 946  IGDELSARSAEATASLARAAEQAGGEVGGRTESALEALRETLRRLGDEVAARGEATTRAL 1005

Query: 335  HSTSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQ 394
              T+  +  + + R+ +L ++    GR  A        ++ + +D+    L+  S++ + 
Sbjct: 1006 SRTAEDVGTELETRLGTLEDSFGRHGRGAAA-------LIASQSDEAQARLEGASREVVL 1058

Query: 395  AFTSHICEMSN-------FFSEKQKSITVTLNDVLQSLRISLQEK-------EDSFCSN- 439
            A   H+ ++ +        F E   S T  + + L +   +LQE         D    N 
Sbjct: 1059 AIAGHVSQVGDTLHRSHAAFVETADSRTRAVEEALGNRLAALQETIARGDILADRIAGNA 1118

Query: 440  --LKSTTDNTLREVDN----RTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFE- 492
              L  T D+ L E+D     + N L + +    +   ET    I +  S      +E   
Sbjct: 1119 QTLGDTLDSRLTEIDRIIAVQGNALADSLAERARLASETVEARIGEMESLSARRAAEIGE 1178

Query: 493  --SNLQGNIDKLQGCFADS-------------------------------HGNMEDLFLS 519
              + L G++D   G  A++                                G+ +D+   
Sbjct: 1179 SFAALVGHVDTRLGARANALNEALVLRSSEIARTLDEGNRILTDALDRRIEGSAQDIA-D 1237

Query: 520  NIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRI 579
              +++G  L  +     + L +   ++++      ERL+  +   +++L   LEE+ + +
Sbjct: 1238 RGRSVGDVLAARAAEIAERLERTTQDLARRLDEGAERLDTGVVARLDALSGTLEERTRHL 1297

Query: 580  DSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSIV---D 636
            D   G ++ E      S  + +   ++ R +     L R      E + GH ++I    D
Sbjct: 1298 DESFGIQALEAVRLIESRTRTIDGELTGRIRDLVALLERRSGLAVEALGGHVEAIARLFD 1357

Query: 637  SISNSTNNLYD-KIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKN 695
              + S N+L+D +   LAA L +  +     L+   +D+   +      L    D     
Sbjct: 1358 ERAESLNHLFDERGGALAADLDQRGRVAVEGLEGRLSDITQALEQGGASLGALLDRRGTA 1417

Query: 696  IICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELL 755
            ++ +      +++ +  +        F  ++  +  +L +    +  L   +A R+   L
Sbjct: 1418 LLATLRDLMGQVDGLLGEGTGRLGHAFETQAGQIRTLLDSRADDLRGLMEGSAGRVRGEL 1477

Query: 756  HSGSANIESELSAISKAMNKSIDDVET-ISTALKERCQELGSDLVNHSDKVLSSLKQAQE 814
             +G  + E+ L    + +   +D     I      R  +L   +   + +V +  + +  
Sbjct: 1478 EAGLGSFETVLDERLRTVRDLLDARSAEIRDTFDHRTDDLRGLMEGGAGRVRNEFEASLG 1537

Query: 815  LLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANS 874
             L TT A+R                   V     LLD  S++I+   D    +  D+   
Sbjct: 1538 ALDTTLAER-------------------VRTVRDLLDARSAEIRDTLD---HRTDDLRGL 1575

Query: 875  LTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYD----ENRQTLDKKL 930
            + ++ G VG   E           AS   +  T EE +  +    D    E R TLD + 
Sbjct: 1576 MEDVSGRVGGAFE-----------ASLGSLDTTLEERIRMVRELLDARSAEIRNTLDSRT 1624

Query: 931  SDHIDVLRQNLAGSENKIDG-----------AIGSASQFIRDILDENSSRIESLLSCSNN 979
             +    LR  + GS   + G           A+   ++ ++D+LD  +  I ++L   ++
Sbjct: 1625 GE----LRGLVDGSAGHVRGEFETGLGALRAALEEPARTVQDLLDSRAGEIRTMLDARSD 1680

Query: 980  SVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEK----S 1035
             +  TL    +    +L  ++ E+  LLD  A  L      + + L+  L E  +    +
Sbjct: 1681 DLRKTLEERARTVQDILDHRTAEIRGLLDGHAGRLDEGFQGRILPLQAALTEGARLFVET 1740

Query: 1036 LSRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCRE 1095
            L   +  +A      +  +  L  E + V+G +      + G+ +    +V ++ Q+ R 
Sbjct: 1741 LEGGIGRAAGEVDARTRGLAHLFDERLGVLGDI------VDGRGQQFAQTVERRSQELRA 1794

Query: 1096 FFGD---NIVAFMDEISKVMEISEKRISQRTQEIS---------------------QQLL 1131
             F +    + A +DE S  +     R+  +TQ ++                      +L+
Sbjct: 1795 LFDEIHATLGALVDERSTAL---TGRLENQTQALATVFDERMRSLDGLVESRGGEFARLV 1851

Query: 1132 QNNDVITNQIIDSTS---------RVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSD 1182
            +N     +Q +++ S         R+R     ++N+    +   ++R++ + + +D    
Sbjct: 1852 ENQAASLSQTVEARSEDFTARIDARLRAFATVVANRANALADAFDERQDAYTAQIDG--- 1908

Query: 1183 NISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYGSTV---FKQFKEYV 1239
              +R++  +D     H  +  ++ E++    K V + ++       +T+    +Q   + 
Sbjct: 1909 GTARMVATLDERARQHAAQFETVEERQ----KAVAALIEEGTARIAATLDERARQQAAFA 1964

Query: 1240 QCFETNMENMESLFDKNNDSMLLSFKERSN 1269
            + F+   E+  +L ++    M+ + +ER+ 
Sbjct: 1965 EAFDGQQESYATLIEQGTARMVAALEERAR 1994



 Score = 58.2 bits (139), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 211/1189 (17%), Positives = 426/1189 (35%), Gaps = 231/1189 (19%)

Query: 297  FQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNR-------- 348
             Q+ +D R A+VT+   R  +     + ++ ++ L  L  T   I ++   R        
Sbjct: 858  VQNEIDGRSAEVTDALARTAERVGGEVGARTEESLRSLRETLGRIGEELSTRGAETSAAL 917

Query: 349  ------------------IESLSNTLNNSGRSLANQVGNYTLMLGNNTDKVSIALKEQSQ 390
                              + SL + L   G  L+ +    T  L    ++    +  +++
Sbjct: 918  ARAAEQAGGEVNSRTEASLRSLRDALAQIGDELSARSAEATASLARAAEQAGGEVGGRTE 977

Query: 391  QFMQAFTSHICEMSNFFSEKQKSITVTLN----DVLQSLRISLQEKEDSFCSNLKSTTDN 446
              ++A    +  + +  + + ++ T  L+    DV   L   L   EDSF  + +     
Sbjct: 978  SALEALRETLRRLGDEVAARGEATTRALSRTAEDVGTELETRLGTLEDSFGRHGRGAAAL 1037

Query: 447  TLREVDNRTNTLENR-------ITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNI 499
               + D     LE         I   + ++ +T + S   F           E  L   +
Sbjct: 1038 IASQSDEAQARLEGASREVVLAIAGHVSQVGDTLHRSHAAFVETADSRTRAVEEALGNRL 1097

Query: 500  DKLQGCFADSHGN-MEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLE 558
              LQ   A   G+ + D    N QT+G  LD +              I +I ++    L 
Sbjct: 1098 AALQETIA--RGDILADRIAGNAQTLGDTLDSRL-----------TEIDRIIAVQGNALA 1144

Query: 559  NTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLAR 618
            ++L        + +E +   ++S   +++ E+  SF +    V   +  R    + +L  
Sbjct: 1145 DSLAERARLASETVEARIGEMESLSARRAAEIGESFAALVGHVDTRLGARANALNEALVL 1204

Query: 619  VQSHFEETIAGHPQSIVDS----ISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDV 674
              S    T+    + + D+    I  S  ++ D+            +S+ + L A A ++
Sbjct: 1205 RSSEIARTLDEGNRILTDALDRRIEGSAQDIADR-----------GRSVGDVLAARAAEI 1253

Query: 675  VHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILK 734
              ++      L  R DE ++           +L+T     L           D +SG L+
Sbjct: 1254 AERLERTTQDLARRLDEGAE-----------RLDTGVVARL-----------DALSGTLE 1291

Query: 735  NSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQEL 794
              T+H+D+ F   A     L+ S +  I+ EL+                      R ++L
Sbjct: 1292 ERTRHLDESFGIQALEAVRLIESRTRTIDGELTG---------------------RIRDL 1330

Query: 795  GSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLS 854
             + L   S   + +L    E +   F +R +S  +   +       +L  +  + ++ L 
Sbjct: 1331 VALLERRSGLAVEALGGHVEAIARLFDERAESLNHLFDERGGALAADLDQRGRVAVEGLE 1390

Query: 855  SDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSN 914
                +L+DI          +L +   ++G  L+    A+L  +      V     E    
Sbjct: 1391 G---RLSDIT--------QALEQGGASLGALLDRRGTALLATLRDLMGQVDGLLGEGTGR 1439

Query: 915  ILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLL 974
            +  +++     +   L    D LR  + GS  ++ G + +       +LDE    +  LL
Sbjct: 1440 LGHAFETQAGQIRTLLDSRADDLRGLMEGSAGRVRGELEAGLGSFETVLDERLRTVRDLL 1499

Query: 975  SCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEK 1034
               +  +  T       FD     ++D+L  L++  A  +          L+  L E+ +
Sbjct: 1500 DARSAEIRDT-------FD----HRTDDLRGLMEGGAGRVRNEFEASLGALDTTLAERVR 1548

Query: 1035 SLSRVVDTSASSFK----YLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKI 1090
            ++  ++D  ++  +    + +D ++ L +++   +G          G  E SL S++  +
Sbjct: 1549 TVRDLLDARSAEIRDTLDHRTDDLRGLMEDVSGRVG----------GAFEASLGSLDTTL 1598

Query: 1091 QKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRG 1150
            +              + I  V E+    +  R+ EI   L      +   +  S   VRG
Sbjct: 1599 E--------------ERIRMVREL----LDARSAEIRNTLDSRTGELRGLVDGSAGHVRG 1640

Query: 1151 E----IVDISNKFIETSR----VLEQREEKFHSALDSFSDNISRILLDVDHTISS----H 1198
            E    +  +     E +R    +L+ R  +  + LD+ SD++ + L +   T+       
Sbjct: 1641 EFETGLGALRAALEEPARTVQDLLDSRAGEIRTMLDARSDDLRKTLEERARTVQDILDHR 1700

Query: 1199 TNESRSLI-----------EQRIHEVKDVLS------------NLDRA------------ 1223
            T E R L+           + RI  ++  L+             + RA            
Sbjct: 1701 TAEIRGLLDGHAGRLDEGFQGRILPLQAALTEGARLFVETLEGGIGRAAGEVDARTRGLA 1760

Query: 1224 ------LESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQ 1277
                  L   G  V  + +++ Q  E   + + +LFD+ + ++     ERS  L   L  
Sbjct: 1761 HLFDERLGVLGDIVDGRGQQFAQTVERRSQELRALFDEIHATLGALVDERSTALTGRLEN 1820

Query: 1278 RSMEISD-------SISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNRI 1330
            ++  ++        S+ G     G     +++ Q   AA+  + +EA      E  T RI
Sbjct: 1821 QTQALATVFDERMRSLDGLVESRGGEFARLVENQ---AASLSQTVEA----RSEDFTARI 1873

Query: 1331 TDSSQDVTTIISDATDSL-NKVDERLHQTTNRITETTGHIDTVLAESSK 1378
                +   T++++  ++L +  DER    T +I   T  +   L E ++
Sbjct: 1874 DARLRAFATVVANRANALADAFDERQDAYTAQIDGGTARMVATLDERAR 1922


>gi|260463973|ref|ZP_05812169.1| kinesin-like protein [Mesorhizobium opportunistum WSM2075]
 gi|259030348|gb|EEW31628.1| kinesin-like protein [Mesorhizobium opportunistum WSM2075]
          Length = 1080

 Score =  122 bits (305), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 83/110 (75%)

Query: 1717 LSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSA 1776
            + S++SL  +I++ ID+DA ++LW  Y  GE D+F++RLYT+KGQ+ F  ++ +Y+A++ 
Sbjct: 969  VESLNSLSVDIARAIDHDASIELWNRYRRGERDVFTRRLYTLKGQQTFDEIRRKYQAEAE 1028

Query: 1777 LRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
             R A+DRY  +FE++L ++++++ D+ + Q ++ S+ GKVYTML HASGR
Sbjct: 1029 FRAAVDRYCDDFEKLLKDVSRNDRDNIMAQTYLTSDTGKVYTMLAHASGR 1078



 Score = 75.5 bits (184), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 176/876 (20%), Positives = 349/876 (39%), Gaps = 173/876 (19%)

Query: 875  LTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHI 934
            LTE +G++   +  H    + K++    ++++  EE +  +     E R+ +D+ LS HI
Sbjct: 59   LTESRGDIDGIIAGH----VGKLAEGRDMLSRALEEDLGKLA----ETRKDVDRSLSGHI 110

Query: 935  DVLRQNLAGSENKIDGAIGSASQFIRD-------ILDENSSRIESLLSCSNNSVNSTLLR 987
            D     +A     I  AI +  + I +       I++E +  +E  LS   ++V + L +
Sbjct: 111  D----QIAARSTDISTAIAADVEKIEEAFSRQTGIIEERAGTMERALSTGVDNVRNVLEK 166

Query: 988  SHQKFDRLLQEKSDELIQLLDNKASCL---------------STAVSTQTINLENNLKEQ 1032
            S       L+EK  E+   L  +A                  S A+  +  ++    ++ 
Sbjct: 167  SAVFVAGALREKVLEVTSALHEQAGAAFSDADRKIAERAEQTSAALLARAEDIARTFEDA 226

Query: 1033 EKSL-SRVVDTSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQ 1091
            ++ L +R  DTS +      D+  TL          ++   ++I+G    + D  +QK+ 
Sbjct: 227  DRRLHARAEDTSNALLARADDTSSTLLARAHETADQLAARASEIAG----TFDMADQKLA 282

Query: 1092 KCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLL-QNNDVITNQIIDSTSRVRG 1150
               +   D + A  +EI+   + +++++  R  E +Q L  +  D++ N           
Sbjct: 283  ARAQETADQLSARANEIAGTFDAADQKLVARAVETAQSLAARAGDILRN----------- 331

Query: 1151 EIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRI 1210
                    F    + L  R  +   AL + + ++ RI    D  + S           RI
Sbjct: 332  --------FESADQRLGVRIGESAEALAARASDLGRIFDAADQQLVS-----------RI 372

Query: 1211 HEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFK----- 1265
             E  D LSN         S + + F+E  Q   + + +  S   ++  +++ +F      
Sbjct: 373  AEGSDALSN-------RASEIGRIFEEADQRLVSRIADSTSTIGEHAQTIVGAFANTEQR 425

Query: 1266 --ERSNILDNILSQRSMEISDSISGA---FHKEGNAVVNVIDQQIYNAANALKKLEALLI 1320
              +R+      L+  + EI  +++GA         A    +++Q+ N  N L      + 
Sbjct: 426  VADRARQTGQELAVHAREIEQALAGADERLASSAAAAAARVEEQVANVENRLAYTAETM- 484

Query: 1321 SDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTG----HIDTVLAES 1376
               +++  +++ +   + +  +   ++   V + + Q+TN   +T G     ++T+LA  
Sbjct: 485  --GQRLNEQVSSAEAQLVSRANVIAETFTAVGQHIGQSTNDAAKTIGANTRELNTMLAAR 542

Query: 1377 SKLFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDA-- 1434
            S           E+S++       +V +F +    L KS + + +  +E KL  +  A  
Sbjct: 543  S----------AEMSKILDETARPLVERFAQGGSELQKSMEEVTERATE-KLRSENAALV 591

Query: 1435 NNLVDLTSRLVSKSSEAQKFVMSILVDV-----------KKIVEQADFLSDTVVKNMTDS 1483
            N L   T+  +S    A+  +   + D+            +++EQA      V + +T S
Sbjct: 592  NALASRTAETLSAVEGARSSLSDSVADLIGRMTKSSSQLGQLIEQAAVNLGEVDERLTGS 651

Query: 1484 IQSSFIKIDGTLSNIETRSRDTVRLIDHN---LADIGNKT---VKTIDSNF--------- 1528
             QS     +       +    + RL+D N   L D+ + T   V +I + F         
Sbjct: 652  TQSFAATTEKAAQTFAS----SARLVDSNTTRLTDLSSSTLREVASIATKFDEHSRLLAS 707

Query: 1529 --------------------------VTLKEKSYDLSNHMRQ---KICSTIPNIENIFST 1559
                                      V L +KS DL   MR     +  T+ N E     
Sbjct: 708  ASDLLSSAQSNLEHTLERQSSLEDLAVGLVKKSEDLERVMRSFENLVGQTLQNAEG---- 763

Query: 1560 LEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRDSVSLA 1619
               K+ +S     +++ + VDS T++ +  ++++  T+  I  +L+ +R  LK+  + + 
Sbjct: 764  ---KTMESADKIRNAITDVVDSATKRFADATEEMRRTAGSIKSELDLTRAELKKGVIEMP 820

Query: 1620 KEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNA 1655
            +EAKES   IR A+ EQIN LK+   ++  S +   
Sbjct: 821  EEAKESTSAIRRAVSEQINALKELSDIVAKSGRGGG 856


>gi|170744123|ref|YP_001772778.1| hypothetical protein M446_6067 [Methylobacterium sp. 4-46]
 gi|168198397|gb|ACA20344.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 3296

 Score =  120 bits (302), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 113/536 (21%), Positives = 220/536 (41%), Gaps = 81/536 (15%)

Query: 151 PILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEE 210
           P+LLFF   ++  RA++M   ++++  +A+RL +PE +S++ + ++S AVR+E+  + + 
Sbjct: 162 PVLLFFIAAMLAVRAQEMRLVARAVGDVAIRLAEPEAFSTDAVLTMSQAVRREVAAVGDG 221

Query: 211 IDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAE 270
           ++RA++RA ELE  VR EI  LE  Y+ +E+RI  +   L  +REAI+ +  ++  +I  
Sbjct: 222 VERALARAGELETLVRGEISTLERAYSDNEIRIRALVDELVAQREAIVANAERVRGAIQG 281

Query: 271 VHESLKEELSLTS-----------EEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQES 319
            H++L +EL   +           E ++  L    +   + +  R  ++T       +  
Sbjct: 282 THQTLTQELDTAASRIVAAVDGVGERVTGSLGARGEEITAALGRRGEEITASLAETGERV 341

Query: 320 AQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTL------------NNSG---RSLA 364
           AQ +S + D L++ L +T   +        ++L+ TL            + SG    +LA
Sbjct: 342 AQAVSGEGDGLVQRLAATGETVKAGLGEAGDALAATLQARTEAVTQAIGHTSGLLTAALA 401

Query: 365 NQVGNYTLMLGNNTDKVSIALKEQSQQFMQAF------------------TSHICEMSNF 406
           +  G    +LG     V  AL  + +Q  + F                  T+   E  N 
Sbjct: 402 DSAGEVARVLGETGSGVIEALNREGEQVRETFARSAATLEERLLARGEDLTTRFAETGNA 461

Query: 407 ----FSEKQKSITVTLNDVLQSLR-----------ISLQEKEDSFCSNLKSTTDNTLREV 451
               F+    ++   L+D   +LR            +L+         L ST+D  L   
Sbjct: 462 ITHRFAASGSALAAHLDDRSVALREEIEGAGTRVVEALERSGREASGALGSTSDAVLDAF 521

Query: 452 DNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHG 511
             R   L   + A ++E  +       D S   +D +   E  +              HG
Sbjct: 522 AARAARLREEVAALVEEAAQAIGVHAADLSGRLEDTIGRVEQAIV------------VHG 569

Query: 512 NMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDM 571
              +  L+         D+    F  +++++  + +   +  TE L+N+L     +    
Sbjct: 570 GALERGLAE------GGDR----FAGLMAERAASAAASFAGATESLQNSLDGRTGAAIAA 619

Query: 572 LEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETI 627
           L    + I  +I  ++ E    F  + +  +  +  R +  + ++    S   ET+
Sbjct: 620 LRRTAEEIGREIDARAAEAEEVFRRAAETAAGAVGARTETAAEAIRAAGSGTAETV 675



 Score =  118 bits (296), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 85/138 (61%), Gaps = 1/138 (0%)

Query: 1690 WFNKILSSSTHSKGKS-SSHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGED 1748
            W + +LS ++  +  + +     + ++ L +IDS+  NI++ ID+ A V LW+ Y  GE 
Sbjct: 3155 WLSDLLSRASQDEAPAEAGAAQRTGEEGLGTIDSISGNIARMIDHQAAVSLWERYRAGES 3214

Query: 1749 DIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEH 1808
            ++F++ LYT  G++ F  ++ +Y+++   R  +DRY+  FE +L E+++++ D      +
Sbjct: 3215 NLFTRDLYTAAGKQTFDEIRRRYQSEPEFRRTVDRYVREFERLLGEVSRADKDPRRANAY 3274

Query: 1809 IMSNYGKVYTMLVHASGR 1826
            + S  GKVYTML HASGR
Sbjct: 3275 LTSETGKVYTMLAHASGR 3292



 Score = 77.8 bits (190), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 226/1226 (18%), Positives = 460/1226 (37%), Gaps = 235/1226 (19%)

Query: 261  GTQLCTSIAEVHESLK---EELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEK------ 311
            G +L    AE  E+L+   E L+  +EE +  ++R+ ++    VD R+A V E       
Sbjct: 1402 GARLGRRAAEADEALRRSVEVLAARAEEAAGAIARSAETATGAVDARLAGVAEAFLQAAE 1461

Query: 312  --TTRIVQESAQ---TISSKIDQLLEVLHSTSIV-------ITKDFDNRIESLSNTLNNS 359
               TR+   S +   T+   ++ L E   + +         I ++   RI ++      S
Sbjct: 1462 AAETRVAARSGEADATLRRSVESLAERAETAAAAIGQAAEEIGRELTARIGTVETAFGGS 1521

Query: 360  GRSLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVT-- 417
            GR       +   ++G + D+    L    +  + A TS    +++      +++  T  
Sbjct: 1522 GR-------DVVALIGQHADETQARLAGVGRDIVLAVTSQGARVNDALVRTGETLASTAE 1574

Query: 418  -----LNDVLQSLRISLQE---KEDSFCSNLKSTTD-------NTLREVDNRTNTLENRI 462
                 L++VL +   +LQ+   + D     +   T        + L E+D R  T+E R 
Sbjct: 1575 TSGKALDEVLTNRLAALQDLIARGDILADRISRDTGAISETVVSRLEEID-RVITVEGRA 1633

Query: 463  TA--------FLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNME 514
             A           ++VET   ++ + S+     LS    +L G +DK  G  A +   + 
Sbjct: 1634 VADRIAERTREASDLVETRLGALEERSAKRTAELSASFDSLVGQVDKHLGARATA---LN 1690

Query: 515  DLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEE 574
            +  +     I   +           ++    ++Q      + L   +T  I ++ D L  
Sbjct: 1691 EALIVRAGEIARAM-----------AEGGREVAQALDARADELARAVTAQIQAMSDALGA 1739

Query: 575  KRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSI 634
            +   I    G+++EEL +  +    +    +  R    + +L       EE   G  Q I
Sbjct: 1740 RAGEIGGAFGRRTEELAARLDEGAARFDERVLARLDGVAAALDARSRVIEEAFGGQAQEI 1799

Query: 635  VDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVV----HKITNAENQLVNRFD 690
            +  +   T                  ++LD  L   A D+V    H    A   L  +  
Sbjct: 1800 LRQVEART------------------RALDEELGRRARDLVDLVEHHGGAASRDLAGQ-- 1839

Query: 691  ESSKNIICSYNSSNNKLETIFQKHLHSF-----------NDTFNNKSDHVSGILKNSTQH 739
               + I  ++ +    L  + ++ + +             DTF  ++  V G ++  T+ 
Sbjct: 1840 --GEAIRAAFETGAESLSRLVEERVAALAAGLDERRRLIEDTFGARTQEVLGEIEARTRA 1897

Query: 740  IDDLFSNNAKRMEELL-----HSGSANIESELSAISKAMNKSIDD-VETISTALKERCQE 793
            +D+      +R  +L+     HSG+A+   +L+  ++A+  + +   E +S  ++ER   
Sbjct: 1898 LDEELG---RRTRDLVGFVETHSGAAS--RDLAGHAEAIRAAFEGRAEGLSRLVEERTAA 1952

Query: 794  LGSDLVNHSDKVLSSLKQAQELLCTTF-----------AQRNDSFVNALADNQSKFENNL 842
            L ++L      +  ++ Q    L   F            +R +S +  L +  ++ E +L
Sbjct: 1953 LAAELDERGRAMFGTVGQRMTDLARLFDRGGASLAELLERRGESVIGRLQEAVAEAERSL 2012

Query: 843  VNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTE--------IQGNV----------GV 884
             +    L + ++     L ++       +A  L +        +QG V          G 
Sbjct: 2013 ESGGARLQEGVAGRTGVLAELLDRGTASLAEVLEQRGEALVGRLQGAVAEAERALDAGGT 2072

Query: 885  TLEN----HSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQN 940
             L+      + A+   + A    V   FE+ +  +    DE   T+   L    ++LR  
Sbjct: 2073 RLQEGVAARTAALTTLLDARGGAVDAAFEDRLRRLGSLVDEQATTIHALLDGQAEILRAA 2132

Query: 941  LAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKS 1000
            L   + +I        + + D+LD+ ++ +  LL     ++   L         LL E+ 
Sbjct: 2133 L---DERI--------RALHDLLDQRAAAMRGLLDGQAGALGHVLDERVGALQGLLSERG 2181

Query: 1001 DELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQE 1060
              L QL + +   L+ A+  +T +L      +  +L  +V+   S+   L+++++  A  
Sbjct: 2182 QGLAQLFETRVGDLTGALDARTRDLATLFDRRLAALDLLVERRGSA---LAETVEARANA 2238

Query: 1061 LVSVI----GSMSQSTTD----ISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEISKVM 1112
            L S++     + +++  D    +SG+L+  +  + + + +  E F               
Sbjct: 2239 LASLVDDRAAAFARTVDDRAASLSGQLQARIHDLGRAVDERAEAF--------------- 2283

Query: 1113 EISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISNKFIETSR----VLEQ 1168
                             L++       Q++D  + +R       +  +E  R    +LE 
Sbjct: 2284 ---------------SGLVEGRRAAFAQLLDGGAGLR-------DLLVENERAIAALLES 2321

Query: 1169 REEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIEQRIHEVKDVLSNLDRALESYG 1228
            R+      +   + +++  LLD    I S T      + Q    + D +   D A+ +  
Sbjct: 2322 RQAALAREMHERTASLA-ALLDERVRILSGT------LAQGGQALADAMGAGDSAVAALQ 2374

Query: 1229 STVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSNILDNILSQRSMEISDSIS- 1287
            + V        +  E + + + SLFD     +L   + R   L   L  R  E ++ ++ 
Sbjct: 2375 ARVAT----LSEAVEGSTQALVSLFDGRATELLALIETRGGALGAALQSRIAEFAEVVAQ 2430

Query: 1288 --GAFHK--EGN--AVVNVIDQQIYNAANALKK----LEALLISDVEKITNRITDSSQDV 1337
               AF    EG   A+  V+D +    A  L+     L+  + +  +   + I   +Q +
Sbjct: 2431 RDAAFRALVEGGAEALGRVLDARGEALAARLQGQIAALDGTVAAGADAFAHTIEARAQAL 2490

Query: 1338 TTIISDATDSL-NKVDERLHQTTNRI 1362
             +++ +  D+L   VDER    T RI
Sbjct: 2491 ASVLQERGDALAGSVDERSAAFTARI 2516



 Score = 67.8 bits (164), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 192/1192 (16%), Positives = 437/1192 (36%), Gaps = 182/1192 (15%)

Query: 197  SSAVRKEIVLMTEEIDRAIS------------RASELEKTVRSEIEVLENNYTK--SEMR 242
            + A+ + +V   EEIDR I+            R  E    V + +  LE    K  +E+ 
Sbjct: 1609 TGAISETVVSRLEEIDRVITVEGRAVADRIAERTREASDLVETRLGALEERSAKRTAELS 1668

Query: 243  ------IDNITQNLKQER----EAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSR 292
                  +  + ++L        EA+I    ++  ++AE    + + L   ++E++  ++ 
Sbjct: 1669 ASFDSLVGQVDKHLGARATALNEALIVRAGEIARAMAEGGREVAQALDARADELARAVTA 1728

Query: 293  AIDSFQSIVDVRIAKVTEKTTRIVQESA-----------QTISSKIDQLLEVLHSTSIVI 341
             I +    +  R  ++     R  +E A           + + +++D +   L + S VI
Sbjct: 1729 QIQAMSDALGARAGEIGGAFGRRTEELAARLDEGAARFDERVLARLDGVAAALDARSRVI 1788

Query: 342  TKDFDNRIESLSNTLNNSGRSLANQVGNYTL----MLGNNTDKVSIALKEQSQQFMQAFT 397
             + F  + + +   +    R+L  ++G        ++ ++    S  L  Q +    AF 
Sbjct: 1789 EEAFGGQAQEILRQVEARTRALDEELGRRARDLVDLVEHHGGAASRDLAGQGEAIRAAFE 1848

Query: 398  SHICEMSNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNT 457
            +    +S    E+  ++   L++  + +       ED+F +     T   L E++ RT  
Sbjct: 1849 TGAESLSRLVEERVAALAAGLDERRRLI-------EDTFGAR----TQEVLGEIEARTRA 1897

Query: 458  LENRITAFLKEIVETFNNSITDFSSFYKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLF 517
            L+           E       D   F + +      +L G+ + ++  F      +  L 
Sbjct: 1898 LD-----------EELGRRTRDLVGFVETHSGAASRDLAGHAEAIRAAFEGRAEGLSRLV 1946

Query: 518  LSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQ 577
                  + + LD++       + ++  +++++                 SL ++LE   +
Sbjct: 1947 EERTAALAAELDERGRAMFGTVGQRMTDLARL-----------FDRGGASLAELLE---R 1992

Query: 578  RIDSDIGKKSEELCS---SFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQSI 634
            R +S IG+  E +     S  S   ++   ++ R  + +  L R  +   E +    +++
Sbjct: 1993 RGESVIGRLQEAVAEAERSLESGGARLQEGVAGRTGVLAELLDRGTASLAEVLEQRGEAL 2052

Query: 635  VDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSK 694
            V  +                A++E++++LD    A  T +   +      L    D    
Sbjct: 2053 VGRLQG--------------AVAEAERALD----AGGTRLQEGVAARTAALTTLLDARGG 2094

Query: 695  NIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEEL 754
             +  ++     +L ++  +   + +   + +++ +   L    + + DL    A  M  L
Sbjct: 2095 AVDAAFEDRLRRLGSLVDEQATTIHALLDGQAEILRAALDERIRALHDLLDQRAAAMRGL 2154

Query: 755  LHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGS------------------ 796
            L       + +  A+   +++ +  ++ +   L ER Q L                    
Sbjct: 2155 L-------DGQAGALGHVLDERVGALQGL---LSERGQGLAQLFETRVGDLTGALDARTR 2204

Query: 797  DLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALA----DNQSKFENNLVNQSHLLLDK 852
            DL    D+ L++L    E   +  A+  ++  NALA    D  + F   + +++  L  +
Sbjct: 2205 DLATLFDRRLAALDLLVERRGSALAETVEARANALASLVDDRAAAFARTVDDRAASLSGQ 2264

Query: 853  LSSDIQKLTDIAYSKAID----VANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTF 908
            L + I  L      +A+D      + L E +      L +    + + +  +   +A   
Sbjct: 2265 LQARIHDL-----GRAVDERAEAFSGLVEGRRAAFAQLLDGGAGLRDLLVENERAIAALL 2319

Query: 909  EECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSS 968
            E   + +     E   +L   L + + +L   LA              Q + D +    S
Sbjct: 2320 ESRQAALAREMHERTASLAALLDERVRILSGTLA-----------QGGQALADAMGAGDS 2368

Query: 969  RIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENN 1028
             + + L     +++  +  S Q    L   ++ EL+ L++ +   L  A+ ++       
Sbjct: 2369 AV-AALQARVATLSEAVEGSTQALVSLFDGRATELLALIETRGGALGAALQSRIAEFAEV 2427

Query: 1029 LKEQEKSLSRVVDTSASSFKYLSDS-IQTLAQELVSVIGSMSQSTTDISGKLEISLDSVN 1087
            + +++ +   +V+  A +   + D+  + LA  L   I ++  +    +     ++++  
Sbjct: 2428 VAQRDAAFRALVEGGAEALGRVLDARGEALAARLQGQIAALDGTVAAGADAFAHTIEARA 2487

Query: 1088 QKIQKCREFFGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSR 1147
            Q +    +  GD +   +DE S        RI  R +  +  +    + + +   D  S 
Sbjct: 2488 QALASVLQERGDALAGSVDERSAAF---TARIDGRMRAFAALVAARGEALAD-AFDDRSD 2543

Query: 1148 VRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRSLIE 1207
                +VD   +    ++ L++R   F +A D   + ++                  +LI+
Sbjct: 2544 AYAALVD--TRMAALTQALDERAAAFQAAFDERQEGLT-------GGFDRRAAALAALID 2594

Query: 1208 QRIHEVKDVLSNLDR----ALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLS 1263
            QR   +   L+   R    AL+  G+ + +   E V         +  + D    ++  +
Sbjct: 2595 QRSATLARSLAEAAREMVQALDGPGADLARSLDERVG-------TLAEIVDGRGQALGRT 2647

Query: 1264 FKERSNILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKL 1315
             +  +  L   +  R  ++   +       G AVV  +DQQ+     AL+ L
Sbjct: 2648 LEASTRTLQEAIDARGQDLVARL----EASGQAVVGGLDQQVA----ALRGL 2691


>gi|218512794|ref|ZP_03509634.1| hypothetical protein Retl8_03420 [Rhizobium etli 8C-3]
          Length = 262

 Score =  120 bits (302), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 136/254 (53%)

Query: 1340 IISDATDSLNKVDERLHQTTNRITETTGHIDTVLAESSKLFEKKIKDLGEISRVSLLQMS 1399
            +++ A + L  VD RL +TT R  ++      ++  S++L E K+  L +IS  +L Q+ 
Sbjct: 4    MMNRAAEQLTSVDGRLGETTTRFADSATKAAEMVNASTRLLEGKVDRLSDISGQTLAQVG 63

Query: 1400 EIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSIL 1459
             I+ +FD++S++L ++   L  AQS    +L++  + L  L+  LV +SSE +K ++ + 
Sbjct: 64   GIIGRFDEHSKVLTQASQLLGAAQSNLASTLEERESALQALSVSLVQRSSEIEKTMLGLG 123

Query: 1460 VDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNK 1519
              ++ + E+A+  S+ V  N+   +QSSF  I   L+  E R+++    +   +   G++
Sbjct: 124  GMIETVFERAEQRSNQVTGNLRQGVQSSFADIGRILTETEKRAQEAAETMRQAITRAGDE 183

Query: 1520 TVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKV 1579
               TID  F  ++ +S DLSN +R  + +++  +E + +     SD + Q   +SL   +
Sbjct: 184  ANTTIDGTFANVERRSGDLSNRIRGGLTASLSEVERMLAEAGRASDGAAQTMRESLREAI 243

Query: 1580 DSFTQKLSKTSDDI 1593
            +    + S  ++DI
Sbjct: 244  EDAVGRFSGATEDI 257


>gi|312113232|ref|YP_004010828.1| hypothetical protein Rvan_0447 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218361|gb|ADP69729.1| hypothetical protein Rvan_0447 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 1034

 Score =  120 bits (301), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 111/464 (23%), Positives = 195/464 (42%), Gaps = 58/464 (12%)

Query: 58  LSKNFKQASNKQTYSGFYPAND--LDNGGITHILQN-IGKNSLNIALRNAFMSSLIWLAC 114
           +S N    S         PAND     GG+ + LQ    ++   IAL    ++S +W A 
Sbjct: 73  ISSNAPARSGGAKRVAARPANDDMPSIGGLIYALQQRPSRSPFLIAL----VASGVWFA- 127

Query: 115 ELGFLIKF--YTNS--PMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHD 170
            LG L+ +  +  S    ++  D    P V  +   V V+PI LF+   I++ RA+++  
Sbjct: 128 -LGMLVSWAVFQKSFDGAETTADMIANPAVFGVVATV-VIPIALFWFLAILVWRAQELRL 185

Query: 171 ASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIE 230
            S ++  +A+RL +P+  + + + S+   VR+++  M + I RA+ RA ELE  V +E+ 
Sbjct: 186 MSSAMTEVAVRLAEPDRMAEQSVASLGQTVRRQVAAMNDAISRALGRAGELEALVHNEVA 245

Query: 231 VLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHL 290
            LE +YT++E RI N+   L  EREA+ N+  ++  ++  +   +  E++  SE+ +  L
Sbjct: 246 ALERSYTENENRIRNLINELASEREALANNSERVSEALRGIGTQVTREITAASEKATQSL 305

Query: 291 SRAIDSFQSIVDVRIAKV---------------TEKTTRIVQESAQTISSKIDQLLEVLH 335
             A ++       R  K+                E+  RI  +    ++    Q  E L 
Sbjct: 306 GHASNTMSEAFATRGQKITAAVTAAGVAIDEKLAERGARITDQ----LTKHGAQAAEALR 361

Query: 336 STSIVITKDFDNRIESLSNTLNNSGRSLANQVGNYTLMLG-------------------- 375
            +S+ +T+      +  +  ++  G SL   V   +  +G                    
Sbjct: 362 ISSLEVTRAIQETSDRTAAAISAKGNSLVTSVIGMSERVGREIPVLLEKLGTEQTRLSGI 421

Query: 376 -----NNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISLQ 430
                 N   +  AL E++Q      T     +    SE  +SI  TL + +Q L   L 
Sbjct: 422 IDGATRNLAALETALAEKTQSLDATLTDKTSVLQTVLSEHSRSIDTTLAERIQGLETILS 481

Query: 431 EKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFN 474
            +  +F  NL        + +  RT  LE  +      I ET +
Sbjct: 482 RRTHNFEVNLSERAKQLDQALAARTQALETSVGKHSTNIRETLD 525



 Score = 67.0 bits (162), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 61/109 (55%), Gaps = 1/109 (0%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKR-LYTIKGQKVFLNLQEQYKADSAL 1777
            S D  + +I+  ID    +++W+    GE +I  +R  Y  + Q V   +  +Y+ D   
Sbjct: 923  SSDFTMGDIAACIDERRVMEVWQRLKRGETEILKQRGFYNRQAQGVVDRVLRRYETDKTF 982

Query: 1778 RNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            R+ ++RY+ +FE+ML ++++S+     VQ  + S  G++Y +L H SGR
Sbjct: 983  RSIVERYLGDFEKMLQDLSRSDPRGGSVQSRLASEEGRIYFVLSHISGR 1031


>gi|92116874|ref|YP_576603.1| hypothetical protein Nham_1318 [Nitrobacter hamburgensis X14]
 gi|91799768|gb|ABE62143.1| conserved hypothetical protein [Nitrobacter hamburgensis X14]
          Length = 1850

 Score =  118 bits (295), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 150/740 (20%), Positives = 307/740 (41%), Gaps = 52/740 (7%)

Query: 76  PANDLDNGGITHILQNI--GKNSLNIALRNAFMSSLIWLACEL---GFLIKFYTNSPMDS 130
           PAND D   I  ILQ I  G+ + NI    +  + +  L   L    FL          S
Sbjct: 80  PAND-DRETIGQILQAIQNGRPARNIYTLASLFAGIWILGAGLLTISFLPSLQAAMGQGS 138

Query: 131 FYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEEYSS 190
               A+   +I LF      P+LLF+    +  R +++   +QS+A +A+R  +PE  +S
Sbjct: 139 GGTLAL-AGLIALFFA----PVLLFYFLASLAWRGQELRMIAQSMAQVAIRFSEPEGLAS 193

Query: 191 EKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNL 250
           + + ++  A+R+E+  M + ++RAI+RA ELE  V +E+  LE  Y+ +E+RI  + Q++
Sbjct: 194 DSVVTVGQAIRREVAAMGDGVERAIARAGELETLVANEVAALERAYSDNEVRIRALLQDI 253

Query: 251 KQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTE 310
             +R+ ++    Q+ ++I+ V   L+ +++L S+ I+  +          ++ R   +T 
Sbjct: 254 ALQRDNLVGQAEQVRSAISGVQIDLRHDIALISDAIASRVDEVAKGITGALEERGEHITT 313

Query: 311 KTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLN-NSGR------SL 363
             +         +  +   LL+ L   S   T+   +  E L+++LN  +G        L
Sbjct: 314 ALSNAGDTMILALGERGGDLLDRLEEASAETTRAVLDASERLNSSLNFKTGHVHDEFVEL 373

Query: 364 ANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQ 423
           A++V +   ML    D+++   +++S   +   +    ++ +       S+ V L     
Sbjct: 374 ADRVHD---MLNERIDRITGEFEQKSASIVDGISDRTEQVHDSLKNSSDSLLVELELRGG 430

Query: 424 SLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSF 483
            L   + E  +   + + S  D     +D   NTL   +    +   +T +  ++ F   
Sbjct: 431 DLANKIDEAGNRLATRILSCGDKASEALDVTVNTLVANVVTRTETAHDTLSLQMSAFDQL 490

Query: 484 YKDNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFE----DIL 539
            KD  +E               FA   G +  L   +I    S  D+    F     D L
Sbjct: 491 VKDQGAELAEK-----------FARDSGTLGTLITRHI----SEFDRTVKTFGGEIVDRL 535

Query: 540 SKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQ 599
            ++  +I++      +  +  LT++   +   L+++  + ++ +      L +SF++  +
Sbjct: 536 GQRTEDIAETMKTYVDTFDTRLTSNGGEISAALDQRLAQFETSLQSSVTNLDASFDAKIK 595

Query: 600 KVSNVISDR----EKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAA 655
                +  R    E+ F +    V    +  +     S+ D  +++  ++  ++  LA +
Sbjct: 596 SFDESVDGRLRILEQTFDSRAKSVAETIDSRLGTLTSSLSDGAAHAIGSIESRLTHLATS 655

Query: 656 LSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHL 715
           L+E       ++    + +   I      L +      + I    +     + T  +  +
Sbjct: 656 LTEGATQAVAAIDGRISGMTETIDGRSAYLADAITARFQEIHQGLDERVGFVATAIETRV 715

Query: 716 HSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAM-N 774
             F D   ++ + V+G  ++S +   D       R EEL    S  I+S +    +++ N
Sbjct: 716 AQFEDLLGSRIEAVAGRFESSGRQASDTL---LARAEEL----SLGIKSHVDDAERSLIN 768

Query: 775 KSIDDVETISTALKERCQEL 794
             ++  ETI T  +   Q L
Sbjct: 769 LVVNTSETIQTGARTAQQSL 788



 Score =  117 bits (292), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 96/382 (25%), Positives = 168/382 (43%), Gaps = 74/382 (19%)

Query: 1491 IDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLK---EKSYDLSNHMRQKIC 1547
            +D +L+  E R+RD  R++    A+        I   F  ++   E+   L++    +IC
Sbjct: 1495 LDESLAAAEERARDIARVV----AETAGAGSAAISRQFEAVRATTEEERRLTSESMSEIC 1550

Query: 1548 STIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNS 1607
                  E   S L++ +D            K  +  Q + + S ++         +L  +
Sbjct: 1551 QRA--TEEAGSMLKQSAD------------KFAALVQGMKQMSAEMHT-------ELEAT 1589

Query: 1608 RDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLIT------DSVKNN------- 1654
            R+ L+R  + + +EA ES   +R  I +QI  L +  +++       D V +        
Sbjct: 1590 RNDLRRGVLEMPQEAAESTAQMRKVIVDQIEALAELNRIVARHGHGFDVVSSGRAGAQRE 1649

Query: 1655 -----AASYNKGLHSDEY-----------NISQVD-KRPSGKKTK--------NNHAIKE 1689
                 AA+  +G  +              N+ Q D   PS ++T+         +     
Sbjct: 1650 EEPMMAAAGGRGATTTRSASRTRDSGTASNLPQPDLGIPSSRRTEAPPVNPASGDDGGDG 1709

Query: 1690 WFNKILSSSTHSKGKSSSHID----ISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTL 1745
            W + +L+    +    + HI          + + +DSL  +IS+ +D +   ++W  Y  
Sbjct: 1710 WLSDLLN---RADTNGNDHIPRGRPAPQAAAANPLDSLSLDISRLMDRNLAGEMWDRYQR 1766

Query: 1746 GEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSP-L 1804
            GE   FSKRLYT  GQK F  +  +Y+AD A +   DRYI+ FE +L E+A+     P +
Sbjct: 1767 GERKAFSKRLYTPAGQKAFDEVARKYRADRAFKQTADRYIAEFERLLDEVARDEQQEPSV 1826

Query: 1805 VQEHIMSNYGKVYTMLVHASGR 1826
            +++H+MS  G VYT+L HA+GR
Sbjct: 1827 IRDHLMSETGLVYTLLAHAAGR 1848


>gi|188584168|ref|YP_001927613.1| hypothetical protein Mpop_4982 [Methylobacterium populi BJ001]
 gi|179347666|gb|ACB83078.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 2665

 Score =  117 bits (292), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 84/350 (24%), Positives = 161/350 (46%), Gaps = 32/350 (9%)

Query: 104 AFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVV--PILLFFSFFIM 161
           A ++S +WL      L+    N        F      +   +V + +  PI+LF    ++
Sbjct: 121 AAIASFLWLNG----LVALAWNQSGGDLKAFITGLTALQAAVVATAIAGPIVLFLITAML 176

Query: 162 ISRARDMHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASEL 221
             RA +M   ++++  +A+RL +PE +S++ + ++S  VR+E+  + + ++RA++RA EL
Sbjct: 177 AVRAHEMRLVARAVGEVAIRLAEPESFSTDAVLTMSQTVRREVAAVGDGVERALARAGEL 236

Query: 222 EKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSL 281
           E  VR EI  LE  Y+ +E+RI ++   L  +RE+I+    ++  +I   HE+L  EL  
Sbjct: 237 ETLVRGEISTLERAYSDNEIRIRSLVDELIAQRESIVGSADRVRGAITGSHENLSSELEG 296

Query: 282 TSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVI 341
            +E I   ++ A +     +D R   +T     + +     +S++ D L+  L +TS  +
Sbjct: 297 AAERIVAAINGAGERVTGALDARGEAITAALGEVGERVVGNVSTRGDDLIRQLTATSEGV 356

Query: 342 TKDFDNRIESLSNTLNNSG---------------RSLANQVGNYTLMLGNNT-------D 379
               +    SL+ TL                   R+LA+  G     L           D
Sbjct: 357 RSGLEEIGGSLTTTLQQRADEVTQAFERTGGALTRTLADNAGAVAQSLSQTGTGLIEALD 416

Query: 380 KVSIALKE----QSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSL 425
           +   A++E     ++   +AF S   E+++ F++   +IT    +  + L
Sbjct: 417 RQGGAVRETFERSTRGLEEAFLSRGTELTDRFAQTGGAITARFAETGEGL 466



 Score =  112 bits (279), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 72/108 (66%)

Query: 1719 SIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALR 1778
            S+D++  +I++ +D+ A V+ W+ Y  G+ ++F  RLYT +G++ F  +Q +Y+AD+  R
Sbjct: 2554 SLDAISTDIARMVDHQASVEFWQRYRQGDANLFDGRLYTAQGRQTFEQIQRRYRADAEFR 2613

Query: 1779 NAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
              +DRY+  FE +L E+ +++ D+     ++ S  GKVYTML HASGR
Sbjct: 2614 RTVDRYVGEFERLLGEVTKNDRDTKRADAYLTSETGKVYTMLAHASGR 2661



 Score = 72.8 bits (177), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 253/1548 (16%), Positives = 587/1548 (37%), Gaps = 269/1548 (17%)

Query: 216  SRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEV---- 271
            SR   +++ + S +  L+    + ++  D I+ N +         G  L + + E+    
Sbjct: 1040 SRTRAVDEALGSRLAALQETIARGDILADRISGNAQ-------TLGATLDSRLGEIDRII 1092

Query: 272  -------HESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTIS 324
                    +SL E   L  E +       I   +++   R  ++ E    +V      + 
Sbjct: 1093 AVQGNALADSLAERARLAGETVEAR----IGEMEALSARRATEIGESFAALVGHVDTRLG 1148

Query: 325  SKIDQLLE--VLHSTSI---------VITKDFDNRIESLSNTLNNSGRS----LANQVGN 369
            ++ + L E  VL ++ I         ++T   D RIE  +  + + GRS    LA +   
Sbjct: 1149 ARANALNETLVLRASEIARTLDEGNRILTDALDRRIEGSAQDIADRGRSVGDVLAARAAE 1208

Query: 370  YTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSLRISL 429
                L   T  ++  L E +++      + +  +S    E+ +++  +    +Q+L    
Sbjct: 1209 IADRLERTTQDLARRLDEGAERLDTGVVARLDSISGTLEERARTLDESFG--IQAL---- 1262

Query: 430  QEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYKDNLS 489
                              +R ++ RT T++  +T  ++++V              +  L+
Sbjct: 1263 ----------------EAVRLIEGRTRTIDGELTTRIRDLVALLER---------RSGLA 1297

Query: 490  EFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQI 549
              E+ L G+++ +   F +   ++  LF      + ++LD++     D L+ + + I+Q 
Sbjct: 1298 -VEA-LGGHVETIARLFDERAESLNHLFDERGGALAADLDQRGRATVDGLNGRLSEITQA 1355

Query: 550  TSMNTERLENTL----TNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVI 605
                   L   L    T  + +L+D++ +    +D  +G+ +  L  +  +   ++ +++
Sbjct: 1356 LEQGGASLGALLDRRGTALLAALRDLVGQ----VDGLLGEGTGRLGHALEAQAGEIRSLL 1411

Query: 606  SDR----EKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQK 661
              R      L      RV+  FE  +                        +  AL E  +
Sbjct: 1412 DSRADDLRGLMEGGAGRVRGEFEAGLG----------------------AVETALEERLR 1449

Query: 662  SLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDT 721
            ++ + L+A + ++     +  + L    +  +  +  ++++S   LET+ ++ LH+  + 
Sbjct: 1450 TVRDLLEARSHEIRDTFDHRTDDLRGLMEGGAGQVRGAFDASLGALETVLEERLHTVREL 1509

Query: 722  FNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVE 781
             + +S  +   L + T  +  L   +A  +           E+ L A+  A+ +      
Sbjct: 1510 LDARSHEIRETLDSRTGTLRSLVDGSAGHVR-------GEFETGLDALRAALEEP---AR 1559

Query: 782  TISTALKERCQELGSDLVNHSDKVLSSLKQ----AQELL-CTTFAQRN--DSFVNALADN 834
            T+   L  R  E+ + L    D + ++L++     QE+L   T   R   D  V  L + 
Sbjct: 1560 TVQDLLDSRTGEIRAMLDARGDDLRTTLEERTRTVQEILDHRTGEIRGLLDGHVGRLDEG 1619

Query: 835  -QSK---FENNLVNQSHLLLDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHS 890
             Q +    +  L   + L ++ L   I + T    ++   +AN   E  G +G  ++   
Sbjct: 1620 FQGRILPLQAALTEGARLFVEMLEGGIGRATSEVDARTRGLANLFDERLGVLGDLVDGRG 1679

Query: 891  QAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHIDVLRQNLAGSENKIDG 950
            Q + + +      +   F+E  + +    DE    L  +L +                  
Sbjct: 1680 QQVAQTVETRAQELRALFDEIHARLGTLVDERATALTGRLDNQ----------------- 1722

Query: 951  AIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQEKSDELIQLLDNK 1010
                 +Q +  + DE    ++ L+     +    +        R +  +S+E    +D +
Sbjct: 1723 -----TQALAALFDERMQSLDGLVERRGGAFAQVVENQAAALARTVDTRSEEFTARIDAR 1777

Query: 1011 ASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSD--SIQTLAQ-----ELVS 1063
                +T V+ +   L +   E++ + + ++D   +      D  + Q +AQ     E   
Sbjct: 1778 LRAFATVVANRANALADAFDERQDAYAALIDEGMARMVAALDERARQHVAQFETVEERQK 1837

Query: 1064 VIGSMSQSTTDISGKLEISLDSVNQK-------IQKCREFFGD-------NIVAFMDE-- 1107
             + ++ +  T    ++  +LD   Q+           RE +          +VA ++E  
Sbjct: 1838 AVAALVEEGT---ARIAAALDERAQRQAALADAFDGQREAYAGLIEQGTARMVAALEERA 1894

Query: 1108 ----------------ISKVMEISEKRI-------SQRTQEISQQLLQNNDVITNQIIDS 1144
                            +++++E    R+       +QR   ++       +   + I   
Sbjct: 1895 HRHAAQAETVEERQRAVAELIEAGTARLVSALDERAQRQAALADAFDGQREAYASLIEQG 1954

Query: 1145 TSRVRGEIVDISNKFIETSRVLEQREEKFHSALDSFSDNISRILLDVDHTISSHTNESRS 1204
            T+R+   + + + +    +   ++++E + + +D      +R++  +D        E + 
Sbjct: 1955 TARMVSALEERARRHAVLAEAFDRQKEAYAALIDG---GTARMVAALDERA-----ERQV 2006

Query: 1205 LIEQRIHE--------VKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMEN----MESL 1252
             + +R  E        V+D ++ + R LE        + +   +     M+     +  L
Sbjct: 2007 ALAERFDERQTAYAALVEDGIARMGRMLEERAHRHAAEVQARAEALAETMDQHNGALARL 2066

Query: 1253 FDKNNDSMLLSFKERSNILDNILSQRSM-------EISDSISGAFHKEGNAVVNVIDQQI 1305
             D    S+  +  ER   LD +++ +         E +D+I     +   A+   +D+  
Sbjct: 2067 IDGPAASLAEALAEREQALDRLIADKGTPLVEALRERTDAIVVRTVESAKALRAALDEGA 2126

Query: 1306 YNAANALKKLEALLISDVEKITNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITET 1365
              +A+ + +    +  DV     RI +++  +  ++  A+++L  V++ L     R+ + 
Sbjct: 2127 AASADTVAQAHDRVRRDVAGFLTRIENANDGLKDLVGGASENLAAVEQGL---AARVEQI 2183

Query: 1366 TGHIDTVLAESSKLFEK---KIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKA 1422
               +D V A++++  ++   ++  L + S+ +L Q S++    D   + L++   + + A
Sbjct: 2184 QSALDRVAADTAQASDRVSTQVVALRDASQGALAQASDLAETLDARGRALVERTGTHVGA 2243

Query: 1423 QSETKLSLDKDANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTD 1482
             +E        A  L  +  RL    S  Q  V ++L    ++ E++       ++  T 
Sbjct: 2244 LTEA-------AGTLEAVEGRLAESLSSRQAVVEAVL---SRLEERSQ-----AIEAQTG 2288

Query: 1483 SIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHM 1542
               S    I+ TL   E R+R+    +  ++A    +    +  +F  L+  + + S   
Sbjct: 2289 RFGSV---IEETLRAAEARARE----LSESVARAAREAGTAVAGDFARLRSGADEESART 2341

Query: 1543 RQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAE 1602
               + S I          E  S + M+ F  +     DS  +  +  ++        I  
Sbjct: 2342 AGAVRSAI----------EAASAKMMESFAAASGQFGDSVARMNAMAAE--------IRR 2383

Query: 1603 DLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDS 1650
            +L+ +R  L+R  + L +E +++   +R  + EQI+ L +   L+  S
Sbjct: 2384 ELDATRADLQRGVLELPRETQDATSEMRRVVAEQIDALNELAALVARS 2431


>gi|209884495|ref|YP_002288352.1| hypothetical protein OCAR_5355 [Oligotropha carboxidovorans OM5]
 gi|209872691|gb|ACI92487.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 1508

 Score =  116 bits (291), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 199/1002 (19%), Positives = 385/1002 (38%), Gaps = 168/1002 (16%)

Query: 76  PANDLDNGGITHILQNIGKN-SLNIALRNAFMSSLIWLACELGFLIKFY---------TN 125
           PA + D   I  +LQ + ++   + +   A + S +W+      +  F          TN
Sbjct: 57  PAANDDREAIGSVLQTLQRSRPRHSSYLFAGIFSALWVVAAAFLIFAFLPSLQAMIGSTN 116

Query: 126 SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDP 185
             M +    A           V V P++LF+    +  R++++   +QS+A +A+R  +P
Sbjct: 117 GGMLALVGLA----------CVFVTPLILFYFIASVSWRSQELSMIAQSMAQMAVRFSEP 166

Query: 186 EEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDN 245
           E  +++ M ++  A+R+E+  M + ++RAI+RA ELE  V +E+  LE  Y+ +E+RI  
Sbjct: 167 EHVANDAMVTVGQAIRREVAAMGDGVERAIARAGELEALVTNEVSALERAYSDNEVRIRA 226

Query: 246 ITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTS------------------EEIS 287
           +  ++  +R+A++    Q+  +I+ V   L++++++ S                  EE S
Sbjct: 227 LLDDISAQRDALVGQAEQVRNAISGVQIDLRQDIAIISDAIASRVDEVTNNITHMLEERS 286

Query: 288 VHLSRAI------------DSFQSIVDVRIAKVTEKTTRIVQESAQTISSKI-------- 327
            H++ A             +    ++D R+ + + +T   V E+++ +++ +        
Sbjct: 287 DHITGAFAAAGDNMIIALGERGGDLLD-RLEEASNQTANAVLEASEQLTANLNFKTSHIQ 345

Query: 328 -------DQLLEVLHSTSIVITKDFDN-----------RIESLSNTLNNSGRSLANQVGN 369
                  D + E+L+     IT DFD            R E + +TL NSG SL  ++  
Sbjct: 346 EEFAELADNIHELLNERVERITGDFDQRANTIVDGITLRTEQVHDTLKNSGDSLLTEMDL 405

Query: 370 YTLMLGNNTDKVSIALKE--------------------------QSQQFMQAFTSHICEM 403
               L    D+VS  L E                          Q++   +A  S I   
Sbjct: 406 RAADLAARVDEVSNRLAERILISGEKTSEALDVTVNTLVAKVVGQTESSHEALVSGISSF 465

Query: 404 SNFFSEKQKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRIT 463
            N   E+   +         +L   +      F   ++S     +  +   T ++ +   
Sbjct: 466 ENLIREQGSELAEKFARDSGTLGALITRHVAEFDRTVRSYGGEIVDRMGQHTQSIADN-- 523

Query: 464 AFLKEIVETFNNSITDFSSFYKDNLSE----FESNLQGNIDKLQGCFADSHGNMEDLFLS 519
             LK  V+TF+  +T   +  +D L E    F+S L   +  L+               +
Sbjct: 524 --LKTYVDTFDTRVTAHGAQIRDTLDERLGAFQSALDSRVTTLEVSLD-----------T 570

Query: 520 NIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRI 579
            I++  S +D++    E    K+   ++Q     +  L +TLT     ++  LE     +
Sbjct: 571 TIKSFDSTIDQRLSSLELSFDKRAEAVTQTIDAQSTALADTLTTRFGEMQKGLETHAGSV 630

Query: 580 DSDIGK-----------KSEELCSSFNSSYQKVSNVISDREKLFSNSL-ARVQSHFEETI 627
            SDI             + E   +   +S QK    +  R +  + S+ +RV+   E T+
Sbjct: 631 ASDIEARVVRFENLLDIRVESAANRIEASGQKAGETLVSRTEELTQSIKSRVEDS-ERTL 689

Query: 628 AGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVN 687
                   ++I     +    ++ L+         + + L+  A D+   +  +  +   
Sbjct: 690 TNLVAETSEAIQLGARSAQQSLLALSG-------EVGSQLRGTAGDIERAVQASAREAEG 742

Query: 688 RFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNN 747
               +S N      S+  ++E        SF      K D ++G ++  T+++  +    
Sbjct: 743 ALFLASNNASAHIKSTAAEIERTIAGGTESFGLALTGKIDAITGGVREQTEYLTLILDEK 802

Query: 748 AKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLS 807
              + E +   +A  E   +AI +  N+ +       TAL  +  +    L   +     
Sbjct: 803 RTPLTEAI---AAKTELLAAAIGEKNNELV-------TALDAKADQFAETLNAKTGLFAE 852

Query: 808 SLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSK 867
           +L     LL  T A R       L+   ++    L  +S  L   L    ++LT      
Sbjct: 853 TLTTKTGLLSETLAARTGELAETLSGKSNELAQTLTLKSGELTQVLDGTSRQLTQALDGS 912

Query: 868 AIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLD 927
              + ++L    G +   L   S A    I A+ T   K+ E    +  +          
Sbjct: 913 TSQLTSTLDSKSGQLVEALNTRSNAFAHAIGAATTSALKSIETQSGDFTV---------- 962

Query: 928 KKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSR 969
           + +S   D+ RQ  A SE     A GS S+ ++D+  E S+R
Sbjct: 963 QMMSHSSDISRQIAAASEL----ATGSVSKALKDV--EASTR 998



 Score =  116 bits (290), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 267/1409 (18%), Positives = 564/1409 (40%), Gaps = 243/1409 (17%)

Query: 557  LENTLTNSINSLKDMLEEKRQRIDS---DIGKKSEELCSSFNSSYQKVSNVISDREKLFS 613
            LE  +TN +++L+    +   RI +   DI  + + L        ++V N IS       
Sbjct: 202  LEALVTNEVSALERAYSDNEVRIRALLDDISAQRDALVGQ----AEQVRNAISG------ 251

Query: 614  NSLARVQSHFEETIAGHPQSIVDSISNSTNN----LYDKIMVLAAALSESQKSLDNSLKA 669
                 VQ    + IA    +I   +   TNN    L ++   +  A + +  ++  +L  
Sbjct: 252  -----VQIDLRQDIAIISDAIASRVDEVTNNITHMLEERSDHITGAFAAAGDNMIIALGE 306

Query: 670  HATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHV 729
               D++ ++  A NQ  N   E+S+ +  + N   + ++  F +   + ++  N + + +
Sbjct: 307  RGGDLLDRLEEASNQTANAVLEASEQLTANLNFKTSHIQEEFAELADNIHELLNERVERI 366

Query: 730  SGILKNSTQHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKE 789
            +G        I D  +   +++ + L +   ++ +E+   +  +   +D+V   S  L E
Sbjct: 367  TGDFDQRANTIVDGITLRTEQVHDTLKNSGDSLLTEMDLRAADLAARVDEV---SNRLAE 423

Query: 790  RCQELGSDLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLL 849
            R       ++   +K   +L      L      + +S   AL    S FEN +  Q   L
Sbjct: 424  R-------ILISGEKTSEALDVTVNTLVAKVVGQTESSHEALVSGISSFENLIREQGSEL 476

Query: 850  LDKLSSDIQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLE-----------KIS 898
             +K + D   L  +      +   ++    G +   +  H+Q++ +           +++
Sbjct: 477  AEKFARDSGTLGALITRHVAEFDRTVRSYGGEIVDRMGQHTQSIADNLKTYVDTFDTRVT 536

Query: 899  ASNTLVAKTFEECMSNILLSYDENRQTLDKKLSDHI----DVLRQNLAGSENKIDGAIGS 954
            A    +  T +E +     + D    TL+  L   I      + Q L+  E   D    +
Sbjct: 537  AHGAQIRDTLDERLGAFQSALDSRVTTLEVSLDTTIKSFDSTIDQRLSSLELSFDKRAEA 596

Query: 955  ASQFI-------RDILDENSSRIESLLSCSNNSVNSTLLRSHQKFDRLLQ---EKSDELI 1004
             +Q I        D L      ++  L     SV S +     +F+ LL    E +   I
Sbjct: 597  VTQTIDAQSTALADTLTTRFGEMQKGLETHAGSVASDIEARVVRFENLLDIRVESAANRI 656

Query: 1005 QLLDNKAS-CLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFKYLSDSIQTLAQELVS 1063
            +    KA   L +     T ++++ +++ E++L+ +V  ++ + +  + S Q   Q L++
Sbjct: 657  EASGQKAGETLVSRTEELTQSIKSRVEDSERTLTNLVAETSEAIQLGARSAQ---QSLLA 713

Query: 1064 VIGSMSQSTTDISGKLEISLDS--------------------------VNQKIQKCREFF 1097
            + G +       +G +E ++ +                          + + I    E F
Sbjct: 714  LSGEVGSQLRGTAGDIERAVQASAREAEGALFLASNNASAHIKSTAAEIERTIAGGTESF 773

Query: 1098 GDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDISN 1157
            G  +   +D I+         + ++T+ ++  L +    +T  I   T  +   I + +N
Sbjct: 774  GLALTGKIDAITG-------GVREQTEYLTLILDEKRTPLTEAIAAKTELLAAAIGEKNN 826

Query: 1158 KFIETSRVLEQREEKFHSALDS----FSDNISRILLDVDHTISSHTNESRSLIEQRIHEV 1213
            + +     L+ + ++F   L++    F++ ++     +  T+++ T E    +  + +E+
Sbjct: 827  ELVT---ALDAKADQFAETLNAKTGLFAETLTTKTGLLSETLAARTGELAETLSGKSNEL 883

Query: 1214 KDVLS----NLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
               L+     L + L+  G++     ++  Q  + +   + S  D  +  ++ +   RSN
Sbjct: 884  AQTLTLKSGELTQVLD--GTS-----RQLTQALDGSTSQLTSTLDSKSGQLVEALNTRSN 936

Query: 1270 ILDNILSQRSMEISDSI---SGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKI 1326
               + +   +     SI   SG F  +  +  + I +QI  A+       +  + DVE  
Sbjct: 937  AFAHAIGAATTSALKSIETQSGDFTVQMMSHSSDISRQIAAASELATGSVSKALKDVEAS 996

Query: 1327 TNRITDSSQDVTTIISDATDSLNKVDERLHQTTNRITETTGHIDTV-----LAESSKLFE 1381
            T    D S+ V      AT ++ ++ E     T++I  T    DTV     L E + L +
Sbjct: 997  TRAAIDQSRQV------ATAAVTEMQE-----TSKILRT----DTVALFERLREGNILLQ 1041

Query: 1382 KKI----KDLGEISRVSLLQMSEIVSKF----DKNSQILIKSHDSLMKAQSETKLSLDKD 1433
            + +    ++L  + R  + ++++ V+      D+NS       + L      T  +L+  
Sbjct: 1042 EVLTGAHENLNSLERALVTRVADFVTALNDVTDRNSSSTTALEEHLRTFNESTTSALE-- 1099

Query: 1434 ANNLVDLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDG 1493
               L  L+++  S           +L +  + VE+++       +  + S+      +D 
Sbjct: 1100 --GLTSLSTQFESHGR--------LLTEAVRQVEESN-------ERTSQSVGERQTLMDQ 1142

Query: 1494 TLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIP-- 1551
             ++ I+TR+ D    +D  L            S FV+L E+S + +  +R +  + +   
Sbjct: 1143 LVTTIDTRTVD----LDERL------------SRFVSLLEESLN-AAELRARDIARVVAE 1185

Query: 1552 -----------NIENIFSTLEEKSDQSMQ----VFLDSLNNKVDSFTQKLSKTSDDIALT 1596
                         E +   +EE+  Q+++    ++     +    F Q   K SD +   
Sbjct: 1186 SAGASSSAVGRQFEAVRVAVEEERRQTLEAMGEIYDRGTQDAAAMFGQASEKFSDVVHAM 1245

Query: 1597 SRRIAE---DLNNSRDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLI------ 1647
                AE   +L+++R  L+R  + L +EA ES   +R  I +QI  L +  +++      
Sbjct: 1246 KEMAAELHRELDSTRADLRRGVLELPQEAAESTAQMRKVIVDQIEALAELNRIVARHGRG 1305

Query: 1648 --------------------TDSVKNNAASYNKG----LHSDEYNISQVDKR---PSGKK 1680
                                T+S        + G    L   +   +Q  +R   P    
Sbjct: 1306 LDVAPRQREEEPVMVAAGGRTESRPAAPRGRDYGSASSLPPPDLGATQPQRRAEAPPVSP 1365

Query: 1681 TKNNHAIKEWFNKILS---SSTHSKGKSSSHIDISDKDSLSSIDSLVENISKFIDYDAFV 1737
              ++ A   W + +L+   ++   +G+++   +         +++L  +I++ +D D   
Sbjct: 1366 AGSDQARDGWLSDLLNRTDATVTERGRTARPAN--------PLEALSLDITRLVDRDLAA 1417

Query: 1738 QLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQ 1797
            ++W  Y  GE   F+KRLYT  GQK F  +  +Y+AD   +  +DRYI+ FE +L ++++
Sbjct: 1418 EMWDRYQRGERKAFNKRLYTPAGQKAFDEVARKYRADRGFKQTVDRYITEFERLLDDVSR 1477

Query: 1798 SNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
                  +++ H++S  G VYT+L HA+GR
Sbjct: 1478 DERGPAVLRNHLVSETGLVYTLLAHAAGR 1506


>gi|218462325|ref|ZP_03502416.1| hypothetical protein RetlK5_23870 [Rhizobium etli Kim 5]
          Length = 536

 Score =  115 bits (289), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 108/547 (19%), Positives = 237/547 (43%), Gaps = 52/547 (9%)

Query: 411 QKSITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIV 470
           +++I  TL+DVL  L  +L EK  SF  +L+ST D+ + ++D R+   E R+   + ++ 
Sbjct: 5   ERTIGGTLDDVLSKLNSALDEKGASFRQSLQSTADDAVMDLDLRSGFFEERLQTTVAQLS 64

Query: 471 ETFNNSITDFSSFYK-----------DNLSEFESNLQGNIDKLQG--------------- 504
             F+  + +F+S +            ++L+     L G  D + G               
Sbjct: 65  TAFDERVAEFTSAFDKRTGSLDTKLMESLARINETLTGGSDSIDGILNSGIDRIGSSMTD 124

Query: 505 -------CFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERL 557
                    A SH  +E+   +  + I + L  +T      L    +NIS   +  T  L
Sbjct: 125 HSLALATALATSHEVLENTLGTRSEEITTALTSRTGELTSALQNATSNISLALASGTSDL 184

Query: 558 ENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLA 617
           +N L       +D L      + + +   ++E+ ++F    + +S V++ R    S +L 
Sbjct: 185 QNNLQARSAEFRDTLRATTTELTAAVAAGTQEVTTAFGGRAEALSGVLTARTAEISEALG 244

Query: 618 RVQSHFEETIAGHPQSIVDSISNSTNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHK 677
                 +  +A    ++VD                  AL+      + +L   +  +++ 
Sbjct: 245 AAHGRIDSVMAERGGALVD------------------ALTSHHGRFEEALSTRSDAIINA 286

Query: 678 ITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNST 737
           +    ++L    DE +  +  S N S  ++E   +    +  +  +   D +S  L    
Sbjct: 287 VAGTHDRLAETLDEKAMALAISLNESQARIEDTLETRSATLLNAVSGTHDRLSETLDEKA 346

Query: 738 QHIDDLFSNNAKRMEELLHSGSANIESELSAISKAMNKSID-DVETISTALKERCQELGS 796
             +    + +  R+++ L + SA   + +S+  + +++++D     ++T+L ER   +  
Sbjct: 347 MALAISLNESQSRLKDTLETRSAAFLNAVSSTHERLSETLDTKAAALTTSLDERHARIED 406

Query: 797 DLVNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSD 856
            L   ++ +LS++   ++ L  T  ++  +   +L + Q++ E+ L  +S  LL+ +S  
Sbjct: 407 ALGTRAEALLSTIAGTRDRLAETLDEKAMTLAISLNEGQARIEDTLETRSAALLNAVSGT 466

Query: 857 IQKLTDIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNIL 916
             +  +    +A  +A SL+E Q  +  TLE  S A+++ +S ++  +A+T +E    + 
Sbjct: 467 HDRFAEALDGRASAIAASLSETQARIENTLETRSAALMDAVSGTHDRLAETLDEKAMALA 526

Query: 917 LSYDENR 923
           +S +E++
Sbjct: 527 ISLNESQ 533



 Score = 92.0 bits (227), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 123/607 (20%), Positives = 249/607 (41%), Gaps = 87/607 (14%)

Query: 517  FLSNIQTIGSNLDKKTLLFEDILSKKQNNISQITSMNTERLENTLTNSINSL---KDMLE 573
             +S  +TIG  LD       D+LSK  + + +  +   + L++T  +++  L       E
Sbjct: 1    MISGERTIGGTLD-------DVLSKLNSALDEKGASFRQSLQSTADDAVMDLDLRSGFFE 53

Query: 574  EKRQRIDSDIGKKSEELCSSFNSSYQKVSNVISDREKLFSNSLARVQSHFEETIAGHPQS 633
            E+ Q   + +    +E  + F S++ K +  +  +      SLAR+     ET+ G   S
Sbjct: 54   ERLQTTVAQLSTAFDERVAEFTSAFDKRTGSLDTK---LMESLARIN----ETLTGGSDS 106

Query: 634  IVDSISNST-----NNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNR 688
            I D I NS      +++ D  + LA AL+ S + L+N+L   + ++   +T+   +L + 
Sbjct: 107  I-DGILNSGIDRIGSSMTDHSLALATALATSHEVLENTLGTRSEEITTALTSRTGELTSA 165

Query: 689  FDESSKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNA 748
               ++ NI  +  S  + L+   Q     F DT    +  ++  +   TQ +   F   A
Sbjct: 166  LQNATSNISLALASGTSDLQNNLQARSAEFRDTLRATTTELTAAVAAGTQEVTTAFGGRA 225

Query: 749  KRMEELLHSGSANIESELSAISKAMNKSIDDVETISTALKERCQELGSDLVNHSDKVLSS 808
                                            E +S  L  R  E+             +
Sbjct: 226  --------------------------------EALSGVLTARTAEISE-----------A 242

Query: 809  LKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQKLTDIAYSKA 868
            L  A   + +  A+R  + V+AL  +  +FE  L  +S  +++ ++    +L +    KA
Sbjct: 243  LGAAHGRIDSVMAERGGALVDALTSHHGRFEEALSTRSDAIINAVAGTHDRLAETLDEKA 302

Query: 869  IDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDENRQTLDK 928
            + +A SL E Q  +  TLE  S  +L  +S ++  +++T +E    + +S +E++  L  
Sbjct: 303  MALAISLNESQARIEDTLETRSATLLNAVSGTHDRLSETLDEKAMALAISLNESQSRLKD 362

Query: 929  KLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSVNSTLLRS 988
             L          ++ +  ++   + + +  +   LDE  +RIE  L     ++ ST+  +
Sbjct: 363  TLETRSAAFLNAVSSTHERLSETLDTKAAALTTSLDERHARIEDALGTRAEALLSTIAGT 422

Query: 989  HQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVDTSASSFK 1048
                        D L + LD KA  L+ +++     +E+ L+ +  +L   V  +   F 
Sbjct: 423  R-----------DRLAETLDEKAMTLAISLNEGQARIEDTLETRSAALLNAVSGTHDRF- 470

Query: 1049 YLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCREFFGDNIVAFMDEI 1108
                     A+ L     +++ S ++   ++E +L++ +  +        D +   +DE 
Sbjct: 471  ---------AEALDGRASAIAASLSETQARIENTLETRSAALMDAVSGTHDRLAETLDEK 521

Query: 1109 SKVMEIS 1115
            +  + IS
Sbjct: 522  AMALAIS 528



 Score = 72.0 bits (175), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 85/419 (20%), Positives = 174/419 (41%), Gaps = 22/419 (5%)

Query: 257 IINHGTQLCTSIAEVHESLKEELSLTSEEISV-------HLSRAIDSFQSIVDVRIAKVT 309
           + +H   L T++A  HE L+  L   SEEI+         L+ A+ +  S + + +A  T
Sbjct: 122 MTDHSLALATALATSHEVLENTLGTRSEEITTALTSRTGELTSALQNATSNISLALASGT 181

Query: 310 EKTTRIVQ-ESAQ---TISSKIDQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSLAN 365
                 +Q  SA+   T+ +   +L   + + +  +T  F  R E+LS  L         
Sbjct: 182 SDLQNNLQARSAEFRDTLRATTTELTAAVAAGTQEVTTAFGGRAEALSGVLTA------- 234

Query: 366 QVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQSL 425
           +    +  LG    ++   + E+    + A TSH        S +  +I   +      L
Sbjct: 235 RTAEISEALGAAHGRIDSVMAERGGALVDALTSHHGRFEEALSTRSDAIINAVAGTHDRL 294

Query: 426 RISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSFYK 485
             +L EK  +   +L  +       ++ R+ TL N ++     + ET +      +    
Sbjct: 295 AETLDEKAMALAISLNESQARIEDTLETRSATLLNAVSGTHDRLSETLDEKAMALAISLN 354

Query: 486 DNLSEFESNLQGNIDKLQGCFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNN 545
           ++ S  +  L+          + +H  + +   +    + ++LD++    ED L  +   
Sbjct: 355 ESQSRLKDTLETRSAAFLNAVSSTHERLSETLDTKAAALTTSLDERHARIEDALGTRAEA 414

Query: 546 ISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVI 605
           +    +   +RL  TL     +L   L E + RI+  +  +S  L ++ + ++ + +  +
Sbjct: 415 LLSTIAGTRDRLAETLDEKAMTLAISLNEGQARIEDTLETRSAALLNAVSGTHDRFAEAL 474

Query: 606 SDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLY----DKIMVLAAALSESQ 660
             R    + SL+  Q+  E T+     +++D++S + + L     +K M LA +L+ESQ
Sbjct: 475 DGRASAIAASLSETQARIENTLETRSAALMDAVSGTHDRLAETLDEKAMALAISLNESQ 533


>gi|27380998|ref|NP_772527.1| hypothetical protein blr5887 [Bradyrhizobium japonicum USDA 110]
 gi|27354164|dbj|BAC51152.1| blr5887 [Bradyrhizobium japonicum USDA 110]
          Length = 1903

 Score =  115 bits (288), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 118/552 (21%), Positives = 241/552 (43%), Gaps = 66/552 (11%)

Query: 110 IWLACELGFLIKFYTN--SPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARD 167
           +WLA      + F  +  + M       +   +I +F      PI+LF+    ++ R ++
Sbjct: 118 VWLAACAALTVGFLPSIQAAMGQSGGVLVIAGLIAMFFA----PIMLFYFLASLVWRGQE 173

Query: 168 MHDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRS 227
           M   +Q++A +A+R  +PE  +S+ M ++  A+R+E+  M + I+RAI+RA ELE  V +
Sbjct: 174 MRMIAQAMAQVAIRFSEPEGSASDSMVTVGQAIRREVAAMGDGIERAIARAGELETLVAN 233

Query: 228 EIEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEIS 287
           E+  LE  Y+ +E+RI  + Q++  +R+ ++    Q+ ++I+ V   L+ +++L S+ I+
Sbjct: 234 EVAALERAYSDNEVRIRALLQDIAHQRDNLVGQAEQVRSAISGVQIDLRHDIALISDAIA 293

Query: 288 VHLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDN 347
             +     S    ++ R A +T   +         +  +   LL+ L   S   T+   +
Sbjct: 294 SRVDEVAKSITGALEERGAHITGALSNAGDNMILALGERGGDLLDRLEEASNETTRAVLD 353

Query: 348 RIESLSNTLN-NSGR------SLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHI 400
             E L+ +LN  +G        LA++V     ML    D+++   +++S   +   +   
Sbjct: 354 ASERLTTSLNFKTGHVHDEFVDLADRVHE---MLNERIDRITGEFEQRSAAIVDGISERT 410

Query: 401 CEMSNFFSEKQKS-----------ITVTLNDVLQSLRISLQEKEDSFCSNLKSTTDNTLR 449
            ++ +       S           ++  ++D    L   +    D     L +T +  + 
Sbjct: 411 EQVHDSLKNSSDSLLLELELRSNDLSAKIDDAGNRLANQIMTSGDKASDALDATVNTLVA 470

Query: 450 EVDNRTNT----LENRITAF-------LKEIVETFNNSITDFSSFYKDNLSEFESNLQ-- 496
           +V ++T T    L  +++AF         E+VE F        +    ++SEF+  ++  
Sbjct: 471 KVVSQTETAHDSLSLQMSAFDELVKNQGTELVEKFARDSGTLGALITRHISEFDRTVKTF 530

Query: 497 -GNIDKLQG-----------CFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQN 544
            G + +  G            + D   N +  F S+   I + LD++ + FE  + ++  
Sbjct: 531 GGEVVERMGQRTQDIAETLKTYVD---NFDTRFTSHGGRITAVLDQRLMQFETTVGERVA 587

Query: 545 NISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNV 604
           N           L+++L   I SL   ++   +  D  +G +   L  SF++  + V+  
Sbjct: 588 N-----------LDDSLNGKITSLDSTIDGHIKTFDQQLGGRVTALEQSFDTRARSVTET 636

Query: 605 ISDREKLFSNSL 616
           I  R    + SL
Sbjct: 637 IDGRLNTLAASL 648



 Score =  110 bits (275), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 91/425 (21%), Positives = 189/425 (44%), Gaps = 72/425 (16%)

Query: 1459 LVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNIETRSRDTVRLIDHNLADIGN 1518
            LV+  ++VE    LS+   KN T S+      ++  ++ I+ R+ D    +D  L    +
Sbjct: 1492 LVEAAQVVE----LSN---KNTTASLAERKQALESLVTTIDLRTAD----LDQRL----S 1536

Query: 1519 KTVKTIDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNN- 1577
            +    +D +    +E++ D++  + +   +    I   F  +   S++  +  LD++++ 
Sbjct: 1537 RFTGLLDESLAAAEERARDIARVVAETAGAGSAAITRQFEAVRAASEEEHRQTLDAMHDI 1596

Query: 1578 ------KVDSFTQKLSKTSDDIALTSRRIAEDLNN----SRDILKRDSVSLAKEAKESAD 1627
                  + D+  ++ ++   ++  + +++A +++N    +R+ L+R  + + +EA ES  
Sbjct: 1597 YRQTTDEADAMFKQSTEKFSNLVSSMKQMAFEMHNELEATRNELRRGVLEMPQEAAESTA 1656

Query: 1628 TIRSAIEEQINTLKDFQKLIT------DSVKNNAASYNK---------GLHSDEYNI--- 1669
             +R  I +QI  L +  +++       D      AS  +         G  S E  +   
Sbjct: 1657 QMRKVIVDQIEALAELNRIVAQHGRGLDVSTAGRASVQRQEEPLLAAVGARSTETRLRDT 1716

Query: 1670 ----------------SQVDKRPSGKKTKNNHAIKEWFNKILSSSTHSKGKSSSHIDISD 1713
                            S+  + P      N+     W + +L+ +  ++G  +       
Sbjct: 1717 GSASTLPPPDLGMPATSRRTEAPPVAPAGNDQGRDGWLSDLLNRTDANQGAPNGREAPRG 1776

Query: 1714 K------------DSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQ 1761
            +             S + ++SL  +I + +D +   ++W  Y  GE+  F+KRLYT  GQ
Sbjct: 1777 RQPAPAPQPQAPQGSSNPLESLSLDIGRLMDRNLAAEMWDRYQRGENKAFTKRLYTPAGQ 1836

Query: 1762 KVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLV 1821
            K F  +  +Y+AD   +  +DRY++ FE +L E+A+       ++ H+ S  G VYT+L 
Sbjct: 1837 KAFDEVARKYRADRNFKGTVDRYVAEFERLLDEVARDGRGPQELRSHLTSETGLVYTLLA 1896

Query: 1822 HASGR 1826
            HA+GR
Sbjct: 1897 HAAGR 1901


>gi|192292846|ref|YP_001993451.1| hypothetical protein Rpal_4480 [Rhodopseudomonas palustris TIE-1]
 gi|192286595|gb|ACF02976.1| conserved hypothetical protein; putative methyl-accepting
           chemotaxis protein [Rhodopseudomonas palustris TIE-1]
          Length = 2025

 Score =  114 bits (284), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 166/817 (20%), Positives = 340/817 (41%), Gaps = 84/817 (10%)

Query: 56  TTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNI--GKNSLNI-ALRNAFMSSLIW- 111
           T  + +F+ A+ +   S   PAND D   I  +LQ++  G+ + N+  L   F    +W 
Sbjct: 66  TPPAPSFEPAAERSFAS--RPAND-DRETIGQLLQSLQKGRTTRNVYTLATIFAG--VWV 120

Query: 112 ---LACELGFLIKFYTNSPMDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDM 168
              +   + FL          S    A+       F      P++LF+    +  R +++
Sbjct: 121 FGGIILTVSFLPALQALVGQGSGGTLALAGLAALFF-----APVMLFYFLASLAWRGQEL 175

Query: 169 HDASQSIAGIALRLIDPEEYSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSE 228
              +QS+A +A+R  +PE  +S+ + ++  A+R+E+  M + ++RAI+RASELE  V +E
Sbjct: 176 RMIAQSMAQVAIRFSEPEIAASDSVVTVGQAIRREVAAMGDGVERAIARASELEALVANE 235

Query: 229 IEVLENNYTKSEMRIDNITQNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISV 288
           +  LE  Y+ +E+RI  + Q++  +R+ ++    Q+ ++I+ V   L+ +++L S+ I+ 
Sbjct: 236 VSALERAYSDNEVRIRALLQDIAHQRDNLVGQAEQVRSAISGVQIDLRHDIALISDAIAS 295

Query: 289 HLSRAIDSFQSIVDVRIAKVTEKTTRIVQESAQTISSKIDQLLEVLHSTSIVITKDFDNR 348
            +     S  S ++ R A +T             +  +  +LL+ L   S   T+   + 
Sbjct: 296 RVDEVAKSITSALEERGAHITSALGHAGDNMILALGERGGELLDRLEEASSETTRAVLDA 355

Query: 349 IESLSNTLN-NSGR------SLANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHIC 401
            E L+ +LN  +G        LA++V +   M+    D+++   +++S   +   +    
Sbjct: 356 SERLTTSLNFKTGHVHAEFVELADRVHD---MMNERLDRITTDFEQRSSTIIDGISERTE 412

Query: 402 EMSNFFSEKQKSITVT-----------LNDVLQSLRISLQEKEDSFCSNLKSTTDNTLRE 450
           ++ +       S+ +            ++D    L   +    D     L  T +  + +
Sbjct: 413 QVQDSLKNSGDSLLLELELRSTDLVNKIDDAGHRLADQILTSGDKASEALDVTVNTLVAK 472

Query: 451 VDNRT----NTLENRITAF-------LKEIVETFNNSITDFSSFYKDNLSEFESNLQ--- 496
           V ++T    +TL  +++AF         E+ E F        +    ++SEF+  ++   
Sbjct: 473 VVSQTEATHDTLSIQMSAFDDLVKLQGTELAEKFARDSGTLGALITRHISEFDRTVKTFG 532

Query: 497 GNIDKLQG-----------CFADSHGNMEDLFLSNIQTIGSNLDKKTLLFEDILSKKQNN 545
           G I +  G            + D   N +    +    I + LD +   FE +   +  +
Sbjct: 533 GEIVERMGQRTQDINETLKTYVD---NFDQRVATGSGEITARLDDRLHQFESLFDTRVGS 589

Query: 546 ISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSFNSSYQKVSNVI 605
           +        + L++T+ N +NSL+ +L+ + + +  +I  + E+L S+ ++        I
Sbjct: 590 LDGAIDNRLKALDDTVGNHLNSLERILDTRTEAVTGNIDGRIEKLASTLSTGAANAVEAI 649

Query: 606 SDREKLFSNSLARVQSHFEETIAGHPQSIVDSISNSTNNLY----DKIMVLAAALSESQK 661
             R    + +L+   S   + I G   ++  ++S    N      D+I  L   LS    
Sbjct: 650 DSRIVQLNTTLSTGTSSAADIIDGRIATLTTTLSTGAANAVEVIDDRITTLTTTLSTGTV 709

Query: 662 SLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYNSSNNKLETIFQKHLHSFNDT 721
               ++ +  T + H +T+   Q ++  D     +  + +S    L T         +D 
Sbjct: 710 QAIEAIDSRLTHLTHSLTDGTAQAIDAIDRRIGAVTETIDSRTANLSTTVSARFQEIHDG 769

Query: 722 FNNKSDHVSGILKNSTQHIDDLFSNN----AKRMEELLHSGSANIESELSAISKAMNKSI 777
             N+   V   +       +DL  +     A R E      S  + +    +S+ +  ++
Sbjct: 770 LENRVTAVINDVDLRVSQFEDLLGSRIEAVAGRFESSGREASEMLMTRAEELSQGIKTNV 829

Query: 778 DDVETISTALKERCQELGSDLVNHSDKVLSSLKQAQE 814
            D E   T L          +V+ SD + SS + A+E
Sbjct: 830 ADAERTLTHL----------VVSTSDTIRSSTQSARE 856



 Score =  105 bits (262), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/360 (21%), Positives = 158/360 (43%), Gaps = 57/360 (15%)

Query: 1524 IDSNFVTLKEKSYDLSNHMRQKICSTIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFT 1583
            +D +    +E++ D++  + +   +   +I   F  +   ++Q  ++ +++++      T
Sbjct: 1664 LDESLAAAEERARDVARIVAETAGAGSASITQQFEAVRSAAEQERRLTVEAMHQVYKQGT 1723

Query: 1584 QK---LSKTSDD--------IALTSRRIAEDLNNSRDILKRDSVSLAKEAKESADTIRSA 1632
            Q+   L K S D        I   +  +  +L ++R+ L+R  + + +EA ES   +R  
Sbjct: 1724 QEADALFKQSADRFTSIVQGIKQMAAEMQHELESTREELRRGVLEIPQEAAESTAQMRKV 1783

Query: 1633 IEEQINTLKDFQKLIT------DSVKNN---------------AASYNKG---------- 1661
            I +QI  L +  +++       D V  +               AAS  +           
Sbjct: 1784 IVDQIEALAELNRIVARHGRGMDVVTPSRAATVTTREEEPVLAAASVGRAETVAARPAPR 1843

Query: 1662 --------LHSDEYNISQVDKR-------PSGKKTKNNHAIKEWFNKILSSSTHSKGKSS 1706
                    L   +  +    +R       PS      +  + E  N+  +S+     +  
Sbjct: 1844 SRESSAATLPPPDLGMPAGPRRTEAPPVAPSNADQGRDGWLSELLNRADTSAEREPPRGR 1903

Query: 1707 SHIDISDKDSLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLN 1766
            +        S + ++SL  +I + +D +  +++W+ Y  GE   F+KRLYT  GQK F  
Sbjct: 1904 AAQQAQAAMSGNPLESLSLDIGRLMDRNLALEMWERYQRGEAKSFTKRLYTPAGQKAFDE 1963

Query: 1767 LQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
            +  +Y+++ + +  +DRYI+ FE +L E+A+  +    ++ H+ S  G VYT+L HA+GR
Sbjct: 1964 VARKYRSERSFKQTVDRYIAEFERLLDEVARDENAPQALRGHLSSETGLVYTLLAHAAGR 2023


>gi|298292237|ref|YP_003694176.1| Apolipoprotein A1/A4/E [Starkeya novella DSM 506]
 gi|296928748|gb|ADH89557.1| Apolipoprotein A1/A4/E [Starkeya novella DSM 506]
          Length = 2085

 Score =  112 bits (281), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 43/111 (38%), Positives = 78/111 (70%)

Query: 1716 SLSSIDSLVENISKFIDYDAFVQLWKSYTLGEDDIFSKRLYTIKGQKVFLNLQEQYKADS 1775
            ++ S+DSL  +I++ ID++A V LW+ Y  GE ++F++RLYT++GQ+ F  ++ +Y+ D 
Sbjct: 1973 TIESLDSLSVDIARMIDHEAAVDLWERYKKGERNVFTRRLYTMQGQQTFEEIRRKYRRDL 2032

Query: 1776 ALRNAIDRYISNFEEMLSEIAQSNDDSPLVQEHIMSNYGKVYTMLVHASGR 1826
              R+ +DRYI  FE +L ++++ +    + + ++ S+ GKVYT+L HA+GR
Sbjct: 2033 EFRDTVDRYIGEFERLLEQVSRDDRGQAMTKTYLTSDTGKVYTLLAHAAGR 2083



 Score =  110 bits (274), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 342/1774 (19%), Positives = 680/1774 (38%), Gaps = 330/1774 (18%)

Query: 43   RRDDSIESKDRQQTTLSKNFKQASNKQTYSGFYPANDLDNGGITHILQNIGKNSLNIALR 102
            RRD      +R+ T  S+  + A+ +    G   AND D   I  +L  + +        
Sbjct: 197  RRDIERREIERRDTERSETERAAAPQ----GRRAAND-DRPSIGQLLSALQRRPSATPYV 251

Query: 103  NAFMSSLIWLACELGFLIKFYTNSPMDSFYDFAMRPEVITL---FLV---VSVVPILLFF 156
             A ++SL WL      L   YT      F  FA   + +T    FL      +VP + +F
Sbjct: 252  IAGIASLAWLGAGGALL---YTQ-----FDGFAGGLQALTASPAFLASMAALIVPPVFYF 303

Query: 157  SFFIMISRARDMHDASQSIAGIALRLIDPEEYSSEKMQ------------------SISS 198
                M+ R ++M   + S+A +A+RL +P    +                      S+++
Sbjct: 304  VLAAMVRRMQEMRIVAHSMAQVAIRLAEPPPAPAPVPAPVAPPAPAAIPMAAPASFSLAT 363

Query: 199  AVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNITQNLKQEREAII 258
            A   E +     ++ A++RASE E  VR E+  L   Y  + +R++ + + L+ ER+AI 
Sbjct: 364  AS-PETLAQFAGLEDAVTRASEAEAFVRGEVAALAQAYEDNNLRMNQLIERLQAERDAIF 422

Query: 259  NHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAID---------------SFQSIVDV 303
                 +  ++   H +  +E++  S+ IS  +  A D               +   + D 
Sbjct: 423  GQTEHIRETLTSSHYAFAQEVNGVSDRISETVMLAADRVAGTLSDKGEHITLALGRVGDT 482

Query: 304  RIAKVTEKTTRIVQE-----------------------SAQT--ISSKIDQLLEVLHSTS 338
             I  ++EK   ++                         SAQT  IS ++  +   L  T 
Sbjct: 483  IIEALSEKGGDLIDRLQATGSEVNTNLADSSEHLISTLSAQTDDISQRLSGVASNLTDTL 542

Query: 339  IVITKDFDNRI----ESLSNTLNNS----GRSLANQVGNYTLMLGNNTDKVSIALKEQSQ 390
             V T +   R+    E+LS+TL        R L+    N    L   TD++S  L   ++
Sbjct: 543  AVRTDEISERLSGVTENLSDTLATRTDEISRRLSGATENLADTLATRTDEISRQLSGVTE 602

Query: 391  QFMQAFTSHI----CEMSNF-------FSEKQKSITVTLNDVLQSLRISLQEKEDSFCSN 439
                   S      C +S          S +  +I+  L  V ++L  +L  + D    +
Sbjct: 603  NLTDTLVSRTDEISCRLSGVTDSLSDTLSTRTDAISRQLTGVTENLSETLASRTDEIGDH 662

Query: 440  LKSTTDNTLREVDNRTNTLENRITAFLKEIVETF---NNSITDF----SSFYKDNL---- 488
            L  T     R V++RT  +  ++ A    + ET    ++ ITD      +   D +    
Sbjct: 663  LLRTAAELSRVVNHRTEEISEKLAATTHNLTETLAARSDEITDALVTTGTRLADEIAIRA 722

Query: 489  SEFESNLQGNIDKLQGCFADSHGNM-------EDLFLSNIQTIGSNL-----DKKTLLFE 536
            SE    L+   D L    +   G +        +     I   G +L     D    ++ 
Sbjct: 723  SEVNQTLRSTGDSLVLDLSVRGGEVVRKLEETGNRVADTITVRGDDLADRIADTGNRIY- 781

Query: 537  DILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGKKSEELCSSF-- 594
            D ++ +   + ++     +R+ + L+ +   + D L E   R+  DI  +   L      
Sbjct: 782  DAVAVRGAELERLLGETGQRVVHQLSQAGTGIHDALAEAASRVSQDIDYRGHMLTEQLAL 841

Query: 595  ---NSSYQKVSN---VISD-REKL------FSNSLARVQSHFEETIAGHPQSIVDSISNS 641
                +S   V+N   V S  RE        F++    V+   E  + G    I D +S  
Sbjct: 842  VGAEASQTLVANGTQVTSQFREAAEFLTTEFASRSESVRGELEHQLRG----IEDMVSVR 897

Query: 642  TNNLYDKIMVLAAALS----ESQKSLDNSLKAHATDVVHKI-------TNAENQLVNRFD 690
               + D+I   +AAL     +  +  D+ L+ H  D+VH+I       T A +  ++ FD
Sbjct: 898  GGEIADRIATDSAALGRQIMDGLREFDSVLQTHGADMVHRIADRVEAVTRAIDTNMSGFD 957

Query: 691  ES----SKNIICSYNSSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSN 746
            E     ++ +  S +     +E +  + +   N+T   ++   +  L    +  ++  S+
Sbjct: 958  EQVTAKAEQVAASLDLRIANIEGVLDRGVEGLNETLGGRTVEFAQTLSEGARQANEAMSH 1017

Query: 747  NAKRMEELLHSGSANIESELSAISKAMNKSIDD-VETISTALKERCQELGSDLVNHSDKV 805
            + + +       +  I  +LS   +  ++++    + I+T L ER       +V   D V
Sbjct: 1018 SLEMLSGFFDDRAGAITEQLSQHIEQADRTLSARAQDIATTLDERVGRFEETVVGRIDNV 1077

Query: 806  LSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDI----QKLT 861
             +S++     +     QR  +    L +  ++ E+ L      L+D +S  +     ++T
Sbjct: 1078 ATSVEVRGAAMADLLGQRIGAVAGQLRNEATEIESTLTT----LVDTVSRTMVDRAGEVT 1133

Query: 862  DIAYSKAIDVANSLTEIQGNVGVTLENHSQAMLEKISASNTLVAKTFEECMSNILLSYDE 921
             +  S+  ++A  + E    +   LE+ S  +  +I+ ++T           ++L + D+
Sbjct: 1134 SLFDSRTDEIARIVEERGNGLLAALEDRSIGITSEIARAST-----------DLLSAIDD 1182

Query: 922  NRQTLDKKLSDHIDVLRQNLAGSENKIDGAIGSASQFIRDILDENSSRIESLLSCSNNSV 981
            +R+ L + L    D  R          +GA+    +   D+L    SR E++++      
Sbjct: 1183 HRENLVQAL----DTTR----------NGAVTDIMRASEDLLHTLESRSEAIVTA----- 1223

Query: 982  NSTLLRSHQKFDRLLQEKSDELIQLLDNKASCLSTAVSTQTINLENNLKEQEKSLSRVVD 1041
                      F+     ++D+L+Q+     S L T  +  T +L+N   E   S+  +  
Sbjct: 1224 ----------FETATSGRADQLMQMSGEVVSSLQTISNEVTSSLQNVGGEVTSSIQAIGG 1273

Query: 1042 TSASSFKYLSDSIQTLAQELVSVIGSMSQSTTDISGKLEISLDSVNQKIQKCR-----EF 1096
               SS + ++  + +  Q+   + G +S S   ISG+       V Q+I +       EF
Sbjct: 1274 DVTSSLQAVTGDVHSSLQQ---IGGEVSVSLQQISGQ-------VTQEIARAGNSLLTEF 1323

Query: 1097 FGDNIVAFMDEISKVMEISEKRISQRTQEISQQLLQNNDVITNQIIDSTSRVRGEIVDIS 1156
             G     F++   +  E++    S+        L+   D    Q +DS +R   E+   S
Sbjct: 1324 DGRG-AQFVESARQATELAAGEFSR--------LVDEFDGRGQQFVDS-ARQATELA--S 1371

Query: 1157 NKFIETSRVLEQREEKFHSALDSF-------SDNISRILLDVDHTISSHTNESRSLIEQR 1209
             +F   SR++E+ + +    +DS        ++  SR++ + D       + +R   E  
Sbjct: 1372 GEF---SRLVEEFDGRGQQFVDSARQATGLAANEFSRLVEEFDGRGQQFIDSARQATELA 1428

Query: 1210 IHEVKDVLSNLDRALESYGSTVFKQFKEYVQCFETNMENMESLFDKNNDSMLLSFKERSN 1269
              E    L+ L    +  G       ++           +   FD      + + ++ + 
Sbjct: 1429 SGE----LTRLAEEFDGRGQQFVDSARQATGLAANEFTRLMDEFDGRGGQFVETARQATG 1484

Query: 1270 ILDNILSQRSMEISDSISGAFHKEGNAVVNVIDQQIYNAANALKKLEALLISDVEKITNR 1329
            ++    S+    ++D  + +    G+ ++  I +    AA  +      L  DV  +  R
Sbjct: 1485 VVSTEFSR----LADEFAASLEGRGSGLIAAIAESGRTAAAEISATNEALQGDVAGLLER 1540

Query: 1330 ITDSSQDVTTIISDATDSL----NKVDERL---HQTTNRITETT----GHIDTVLAESSK 1378
            + + +  +  +++ +  +L    N + ERL     T N + E +    GH+D        
Sbjct: 1541 LGEVNVQLQDVLASSVGNLSAIENTISERLEVFRTTVNNVEEASRLASGHMD-------- 1592

Query: 1379 LFEKKIKDLGEISRVSLLQMSEIVSKFDKNSQILIKSHDSLMKAQSETKLSLDKDANNLV 1438
               ++I+DL  +S   L  ++++   F + + I+    ++L  A      +L      L+
Sbjct: 1593 ---EQIRDLRAVSTDVLQDVAKLSQGFGEQASIITNVANALGAAHENLDDTLGGRHEALI 1649

Query: 1439 DLTSRLVSKSSEAQKFVMSILVDVKKIVEQADFLSDTVVKNMTDSIQSSFIKIDGTLSNI 1498
             L  ++ +++                    AD   D+ +   T +++ +F + +      
Sbjct: 1650 ALAEQVSTRT--------------------ADL--DSRLAQYTSTLEGTFGRAE------ 1681

Query: 1499 ETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLKEKSYDLSNHMRQKICSTI-PNIENIF 1557
                          +A+I    + T ++        S +     ++KI ST     E   
Sbjct: 1682 ------------QRVAEISKAILNTANA--------STEAVVRQQEKIRSTTEAERERTL 1721

Query: 1558 STLEEKSDQSMQV---FLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNSRDILKRD 1614
            ++L E  +Q++      +   N       Q L  +  DI    +R+   L  +R+ LKR 
Sbjct: 1722 ASLHETYEQAVSEVDNLMRQANQGFSGAAQALRSSVADI----QRL---LETTREELKRG 1774

Query: 1615 SVSLAKEAKESADTIRSAIEEQINTLKDFQKLIT 1648
             + L +E + +A  +R  + EQI  L +  ++++
Sbjct: 1775 IMELPEETEANASAMRRTVAEQIKALAELNEIVS 1808


>gi|75675279|ref|YP_317700.1| hypothetical protein Nwi_1086 [Nitrobacter winogradskyi Nb-255]
 gi|74420149|gb|ABA04348.1| conserved hypothetical protein [Nitrobacter winogradskyi Nb-255]
          Length = 1799

 Score =  112 bits (280), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/380 (22%), Positives = 164/380 (43%), Gaps = 77/380 (20%)

Query: 1491 IDGTLSNIETRSRDTVRLIDHNLADIGNKTVKTIDSNFVTLK---EKSYDLSNHMRQKIC 1547
            +D +L+  E R+RD  R++    A+        I+S F  ++   E    L++    +IC
Sbjct: 1451 LDESLAAAEERARDIARVV----AETAGAGSAAINSQFEAVRAAAENERRLTSESMSEIC 1506

Query: 1548 STIPNIENIFSTLEEKSDQSMQVFLDSLNNKVDSFTQKLSKTSDDIALTSRRIAEDLNNS 1607
                          +K+ Q  +  L    ++  +  Q + + + ++         +L  +
Sbjct: 1507 --------------KKAGQEAESMLRQSADRFAALVQSMKQMTAEMH-------RELETT 1545

Query: 1608 RDILKRDSVSLAKEAKESADTIRSAIEEQINTLKDFQKLITDSVKNNAASYNKGLH--SD 1665
            R  L+R  + + +EA ES   +R  I +QI  L +  +++        A +  G    S 
Sbjct: 1546 RGELRRGVLEMPQEAAESTAQMRKVIVDQIEALAELNRIV--------ARHGHGFDVVSS 1597

Query: 1666 EYNISQVDKRP-------SGKKTKNNHAIKEWFNKILSSSTHS----KGKSSSHIDISDK 1714
              + SQ +  P       S  K ++   +++  N   + +  +    + + ++   ++D 
Sbjct: 1598 GRSSSQREAEPVMAAAGRSAAKVRSASRMRDNGNTAPTPAPGAQPARRTEQTAKPPVADG 1657

Query: 1715 DSLSS----------------------------IDSLVENISKFIDYDAFVQLWKSYTLG 1746
            D   S                            +DSL  +I + +D     ++W  Y  G
Sbjct: 1658 DGWLSDLLNDADTAERDVPRGRQASPAAAPANPLDSLSLDIGRLMDRKLVGEMWDRYQRG 1717

Query: 1747 EDDIFSKRLYTIKGQKVFLNLQEQYKADSALRNAIDRYISNFEEMLSEIAQSNDDSPLVQ 1806
            E + F+KRLYT  GQK F  +  +Y+ D A +   DRY++ FE +L E+A+   +  +++
Sbjct: 1718 ERNAFTKRLYTPAGQKAFDEVARKYRTDRAFKQTADRYVAEFERLLDEVARDEREPSVIR 1777

Query: 1807 EHIMSNYGKVYTMLVHASGR 1826
            +H++S  G VYT+L HA+GR
Sbjct: 1778 DHLISETGLVYTLLAHAAGR 1797



 Score =  111 bits (278), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 196/914 (21%), Positives = 385/914 (42%), Gaps = 113/914 (12%)

Query: 76  PANDLDNGGITHILQNIGKNSLNIALRNAF-MSSL---IWLACE----LGFLIKFYTNSP 127
           PAND D   I  ILQ + K+  +   RN + M++L   IW+       + FL        
Sbjct: 80  PAND-DRETIGQILQTLQKSGPS---RNVYTMATLFAGIWILGAGLLTISFLPSLQAALG 135

Query: 128 MDSFYDFAMRPEVITLFLVVSVVPILLFFSFFIMISRARDMHDASQSIAGIALRLIDPEE 187
             S    A+   +I LF      P+LLF+    M  R +++   +QS+A +A+R  +PE 
Sbjct: 136 QGSGGTLAL-AGLIALFFA----PVLLFYFLAHMAWRGQELRMIAQSMAQMAIRFSEPEG 190

Query: 188 YSSEKMQSISSAVRKEIVLMTEEIDRAISRASELEKTVRSEIEVLENNYTKSEMRIDNIT 247
            +S+ + ++  A+R+E+  M + ++RAI+RA ELE  V +E+  LE  Y+ +E+RI  + 
Sbjct: 191 LASDSVVTVGQAIRREVAAMGDGVERAIARAGELEALVANEVAALERAYSDNEVRIRALL 250

Query: 248 QNLKQEREAIINHGTQLCTSIAEVHESLKEELSLTSEEISVHLSRAIDSFQSIVDVRIAK 307
           Q++  +R+ ++    Q+  +I+ V   L++++ L S+ I+                R+ +
Sbjct: 251 QDIAHQRDNLVGQAEQVRNAISGVQIDLRQDIELISDAIA---------------SRVEE 295

Query: 308 VTEKTTRIVQESAQTISSKI----DQLLEVLHSTSIVITKDFDNRIESLSNTLNNSGRSL 363
           V +  T  ++E    I++ +    D ++  L         D  +R+E  S     + R++
Sbjct: 296 VAKGITGALEERGDHITTALSNAGDNMIFALGERG----GDLLDRLEEAS---AQTARAV 348

Query: 364 ANQVGNYTLMLGNNTDKVSIALKEQSQQFMQAFTSHICEMSNFFSEKQKSITVTLNDVLQ 423
            +     T  L   T  V     + + +        I  ++  F +K  SI  +++D  +
Sbjct: 349 LDASERLTSSLNFKTGHVHDEFVDLADRVHDMLNERIDRITGEFEQKSASIVDSISDRTE 408

Query: 424 SLRISLQEKEDSFCSNLKSTTDNTLREVDNRTNTLENRITAFLKEIVETFNNSITDFSSF 483
            +  +L+   +S    L+    +   +VD+  N L +RI +   +  E  + ++   +S 
Sbjct: 409 QVHDALKNSSESLLLELELRGSDLASKVDDAGNRLASRILSCGDKASEALDVTV---NSL 465

Query: 484 YKDNLSEFES-----NLQGN-IDKL---QGC-----FADSHGNMEDLFLSNIQTIGSNLD 529
             + +S+ E+     +LQ N  D+L   QG      FA   G +  L   +I    S  D
Sbjct: 466 VANVVSQTETAHDTLSLQMNAFDQLVKDQGAELAEKFARDSGTLGALITRHI----SEFD 521

Query: 530 KKTLLFE----DILSKKQNNISQITSMNTERLENTLTNSINSLKDMLEEKRQRIDSDIGK 585
           +    F     D L ++  +I+Q      +  +  LT++   +  +L++   R ++ +  
Sbjct: 522 RTVKTFGAEIVDRLGQRTEDIAQSMKNYVDTFDTRLTSNGGEISAVLDQHLARFETSVRS 581

Query: 586 KSEELCSSFNSSYQKVSNVISDR----EKLFSNSLARVQSHFEETIAGHPQSIVDSISNS 641
           +   L S+F++  +     ++ R    E++F      V    +  +     S+ D  +++
Sbjct: 582 RVTNLDSAFDAKIKSFDESVNGRLKTLEQIFDTRALSVTQTIDSRLVTLTSSLSDGAAHA 641

Query: 642 TNNLYDKIMVLAAALSESQKSLDNSLKAHATDVVHKITNAENQLVNRFDESSKNIICSYN 701
             ++  ++  L  +L+E       +L+   + V   I +    L +      + I    +
Sbjct: 642 IGSIESRLNHLTTSLTEGATQAVVALEGRISGVTDAIDDRSAYLADTITARFQEIHQGLD 701

Query: 702 SSNNKLETIFQKHLHSFNDTFNNKSDHVSGILKNSTQHIDDLFSNNAKRMEELLHSGSAN 761
              + + T     +  F D   ++ + V+G  ++S +   D+      R EEL    S  
Sbjct: 702 ERVSFVATAIDTRVAQFEDLLGSRVEAVAGRFESSGREASDIL---LARAEEL----SFG 754

Query: 762 IESELSAISKAM-NKSIDDVETISTALKERCQEL-------GSDL--------------- 798
           I+S +    +++ N  ++  ETI T  +   Q L       G+ L               
Sbjct: 755 IKSHVEDAERSLTNLVVNTSETIQTGTRSAQQALLSISTDVGAQLQLTSTEVERALTTAG 814

Query: 799 VNHSDKVLSSLKQAQELLCTTFAQRNDSFVNALADNQSKFENNLVNQSHLLLDKLSSDIQ 858