Query gi|254781030|ref|YP_003065443.1| hypothetical protein CLIBASIA_04660 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 38 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 30 03:09:18 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254781030.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG0718 consensus 26.0 22 0.00055 18.5 0.3 18 12-29 67-91 (546) 2 pfam06335 DUF1054 Protein of u 6.0 1.9E+02 0.0049 14.2 0.4 19 8-26 50-68 (194) 3 KOG1684 consensus 5.6 1.6E+02 0.004 14.6 -0.2 26 2-32 59-84 (401) 4 pfam03859 CG-1 CG-1 domain. CG 5.6 1.6E+02 0.0042 14.5 -0.1 13 17-29 48-60 (119) 5 pfam03356 Pox_LP_H2 Viral late 5.3 1.9E+02 0.0048 14.2 0.0 16 20-35 127-142 (189) 6 KOG2556 consensus 5.1 1.8E+02 0.0045 14.3 -0.2 18 4-21 374-391 (666) 7 pfam07772 consensus 4.7 3.3E+02 0.0084 13.1 0.9 18 15-34 38-56 (92) 8 pfam08567 TFIIH_BTF_p62_N TFII 3.5 3E+02 0.0076 13.3 -0.1 14 11-24 1-14 (79) 9 pfam09542 FFD_TFG FFD and TFG 3.4 4.1E+02 0.01 12.7 0.5 15 17-38 1-15 (47) 10 TIGR01853 lipid_A_lpxD UDP-3-O 3.3 3.7E+02 0.0094 12.9 0.2 10 27-36 230-239 (336) No 1 >KOG0718 consensus Probab=25.96 E-value=22 Score=18.51 Aligned_cols=18 Identities=44% Similarity=0.901 Sum_probs=12.5 Q ss_pred HHHHHHHCCC-------CCCCCHHH Q ss_conf 0222221013-------35864011 Q gi|254781030|r 12 THAQRAIYDK-------KDGWNLKK 29 (38) Q Consensus 12 thaqraiydk-------kdgwnlkk 29 (38) ...||||||- ..||++-- T Consensus 67 Dp~kRaIYD~~G~qGL~t~gwEl~~ 91 (546) T KOG0718 67 DPQKRAIYDNYGEQGLKTEGWELGF 91 (546) T ss_pred CHHHHHHHHHHHHCCCCCCCCEEEC T ss_conf 8677789887512235545716305 No 2 >pfam06335 DUF1054 Protein of unknown function (DUF1054). This family consists of several hypothetical bacterial proteins of unknown function. Probab=5.96 E-value=1.9e+02 Score=14.18 Aligned_cols=19 Identities=37% Similarity=0.648 Sum_probs=15.9 Q ss_pred HHHHHHHHHHHCCCCCCCC Q ss_conf 0010022222101335864 Q gi|254781030|r 8 AMVATHAQRAIYDKKDGWN 26 (38) Q Consensus 8 amvathaqraiydkkdgwn 26 (38) .-||-||.|..+--+|-|- T Consensus 50 ~HVAKHaRRtvNPP~dTWv 68 (194) T pfam06335 50 PHVAKHARRTVNPPNDTWV 68 (194) T ss_pred HHHHHHHCCCCCCCCCCEE T ss_conf 5677764256799813211 No 3 >KOG1684 consensus Probab=5.63 E-value=1.6e+02 Score=14.59 Aligned_cols=26 Identities=38% Similarity=0.540 Sum_probs=21.0 Q ss_pred CCCCCCHHHHHHHHHHHCCCCCCCCHHHCEE Q ss_conf 4122220010022222101335864011100 Q gi|254781030|r 2 INAMNGAMVATHAQRAIYDKKDGWNLKKNIK 32 (38) Q Consensus 2 inamngamvathaqraiydkkdgwnlkknik 32 (38) .||||-.|| +.||-+-++|+..+.++ T Consensus 59 LNAlnleMv-----~~~~~~L~~we~s~~~k 84 (401) T KOG1684 59 LNALNLEMV-----LSIYPKLVEWEKSPLVK 84 (401) T ss_pred HCCCCHHHH-----HHHHHHHHHHCCCCCCE T ss_conf 010338889-----98899887540277721 No 4 >pfam03859 CG-1 CG-1 domain. CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs. Probab=5.62 E-value=1.6e+02 Score=14.50 Aligned_cols=13 Identities=46% Similarity=0.644 Sum_probs=9.0 Q ss_pred HHCCCCCCCCHHH Q ss_conf 2101335864011 Q gi|254781030|r 17 AIYDKKDGWNLKK 29 (38) Q Consensus 17 aiydkkdgwnlkk 29 (38) .-|=+|||||-+| T Consensus 48 ~r~fRkDGh~WkK 60 (119) T pfam03859 48 LRYFRKDGHNWRK 60 (119) T ss_pred HHHHHHCCCEEEE T ss_conf 5555515730024 No 5 >pfam03356 Pox_LP_H2 Viral late protein H2. All Members of this family show similarity to the vaccinia virus late protein H2. This protein is often referred# to by its gene name H2R. Members from this family all belong to the viral taxon Poxviridae. Probab=5.27 E-value=1.9e+02 Score=14.19 Aligned_cols=16 Identities=44% Similarity=0.804 Sum_probs=13.3 Q ss_pred CCCCCCCHHHCEEECC Q ss_conf 1335864011100022 Q gi|254781030|r 20 DKKDGWNLKKNIKIDN 35 (38) Q Consensus 20 dkkdgwnlkknikidn 35 (38) ..-|||-.||--|+|- T Consensus 127 G~GDgWmvkKA~k~D~ 142 (189) T pfam03356 127 GTGDGWMVKKASKVDP 142 (189) T ss_pred CCCCCEEEEECCCCCC T ss_conf 6897316745212694 No 6 >KOG2556 consensus Probab=5.10 E-value=1.8e+02 Score=14.34 Aligned_cols=18 Identities=28% Similarity=0.453 Sum_probs=14.7 Q ss_pred CCCCHHHHHHHHHHHCCC Q ss_conf 222200100222221013 Q gi|254781030|r 4 AMNGAMVATHAQRAIYDK 21 (38) Q Consensus 4 amngamvathaqraiydk 21 (38) -||.||..+|.|+.+|.+ T Consensus 374 leNEaMTGshtqn~V~Sr 391 (666) T KOG2556 374 LENEAMTGSHTQNSVVSR 391 (666) T ss_pred HHHHHHCCCCCCCHHHHH T ss_conf 763431076655428878 No 7 >pfam07772 consensus Probab=4.69 E-value=3.3e+02 Score=13.08 Aligned_cols=18 Identities=28% Similarity=0.575 Sum_probs=11.9 Q ss_pred HHHHCCCCCCC-CHHHCEEEC Q ss_conf 22210133586-401110002 Q gi|254781030|r 15 QRAIYDKKDGW-NLKKNIKID 34 (38) Q Consensus 15 qraiydkkdgw-nlkknikid 34 (38) ++|-+ .+|| +++.||++. T Consensus 38 ~~Apv--d~g~~~lr~~I~~~ 56 (92) T pfam07772 38 NRAPV--DTGKGHMRRSIKVE 56 (92) T ss_pred HHCCC--CCCCCCHHHHEEEE T ss_conf 72876--77530000004788 No 8 >pfam08567 TFIIH_BTF_p62_N TFIIH p62 subunit, N-terminal domain. The N-terminal domain of the TFIIH basal transcription factor complex p62 subunit (BTF2-p62) forms an interaction with the 3' endonuclease XPG, which is essential for activity. The 3' endonuclease XPG is a major component of the nucleotide excision repair machinery. The structure of the N-terminal domain reveals that it adopts a pleckstrin homology (PH) fold. Probab=3.53 E-value=3e+02 Score=13.29 Aligned_cols=14 Identities=50% Similarity=0.674 Sum_probs=0.0 Q ss_pred HHHHHHHHCCCCCC Q ss_conf 00222221013358 Q gi|254781030|r 11 ATHAQRAIYDKKDG 24 (38) Q Consensus 11 athaqraiydkkdg 24 (38) +.|.-.+.|.|+|| T Consensus 1 ~~~~g~~~yKK~~G 14 (79) T pfam08567 1 ALHSGAASYKKVDG 14 (79) T ss_pred CCCCCEEEEECCCC T ss_conf 97655079962562 No 9 >pfam09542 FFD_TFG FFD and TFG box motifs. This pair of motifs are found in the C-terminal region of Sm-like proteins. Probab=3.39 E-value=4.1e+02 Score=12.66 Aligned_cols=15 Identities=47% Similarity=0.826 Sum_probs=0.0 Q ss_pred HHCCCCCCCCHHHCEEECCCCC Q ss_conf 2101335864011100022459 Q gi|254781030|r 17 AIYDKKDGWNLKKNIKIDNMSS 38 (38) Q Consensus 17 aiydkkdgwnlkknikidnmss 38 (38) ..|||++.. .||+|+ T Consensus 1 ~~Y~K~~sF-------FD~ISc 15 (47) T pfam09542 1 PAYDKKSSF-------FDNISC 15 (47) T ss_pred CCCCCCCCC-------CCCCCC T ss_conf 976554542-------402441 No 10 >TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2.3.1 from EC) catalyses an early step in lipid A biosynthesis :UDP-3-O-(3-hydroxytetradecanoyl)glucosamine + (R)-3-hydroxytetradecanoyl- [acyl carrier protein] = UDP-2,3-bis(3-hydroxytetradecanoyl)glucosamine + [acyl carrier protein] Members of this family also contain a hexapeptide repeat (IPR001451 from INTERPRO). This entry represents the non-repeating region of LPXD proteins.; GO: 0016747 transferase activity transferring groups other than amino-acyl groups, 0009245 lipid A biosynthetic process. Probab=3.27 E-value=3.7e+02 Score=12.86 Aligned_cols=10 Identities=40% Similarity=0.707 Sum_probs=0.0 Q ss_pred HHHCEEECCC Q ss_conf 0111000224 Q gi|254781030|r 27 LKKNIKIDNM 36 (38) Q Consensus 27 lkknikidnm 36 (38) .+++.||||. T Consensus 230 i~~gtKIDNL 239 (336) T TIGR01853 230 IGEGTKIDNL 239 (336) T ss_pred EECCCEECCE T ss_conf 7238466231 Done!