HHsearch alignment for GI: 254781033 and conserved domain: KOG1155

>KOG1155 consensus.
Probab=99.15  E-value=2.1e-06  Score=67.95  Aligned_cols=266  Identities=9%  Similarity=0.086  Sum_probs=159.9

Q ss_pred             CHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCHHHHHHHHH-----------------------------HHHHCCC
Q ss_conf             15899999875322221000168999999726885057999865-----------------------------4552158
Q gi|254781033|r  118 NEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLY-----------------------------FESCRIG  168 (492)
Q Consensus       118 ~~~L~~Ll~A~aA~~~gd~~~A~~~~~~~~~~~~~~~~~~~gL~-----------------------------~~al~~g  168 (492)
T Consensus       162 ~D~fllYL~Gvv~k~~~~~s~A~~sfv~~v~~~P~~W~AWleL~~lit~~e~~~~l~~~l~~~~h~M~~~F~~~a~~el~  241 (559)
T KOG1155         162 KDEFLLYLYGVVLKELGLLSLAIDSFVEVVNRYPWFWSAWLELSELITDIEILSILVVGLPSDMHWMKKFFLKKAYQELH  241 (559)
T ss_pred             CHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             21389998889998613077889999999963875268999999860529999999853753026999999999988988


Q ss_pred             CHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHH---------------HHHHHHHH
Q ss_conf             869999999988842-12698999999999995257456999999999502310357---------------89999999
Q gi|254781033|r  169 DLNSAQRYATKALDI-SPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRN---------------RAILLIAR  232 (492)
Q Consensus       169 d~~~A~~~~~~a~~~-~P~~~~a~~~L~~l~~~~gdw~~A~~~l~~~~~~~~~~~~~---------------~a~l~~~~  232 (492)
T Consensus       242 q~~e~~~k~e~l~~~gf~~~~~i~~~~A~~~y~~rDfD~a~s~Feei~knDP-YRl~dmdlySN~LYv~~~~skLs~LA~  320 (559)
T KOG1155         242 QHEEALQKKERLSSVGFPNSMYIKTQIAAASYNQRDFDQAESVFEEIRKNDP-YRLDDMDLYSNVLYVKNDKSKLSYLAQ  320 (559)
T ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8889999999887516874177999999988612207889999999985497-732158787677999721178999999


Q ss_pred             HH----------------HHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCH---
Q ss_conf             99----------------99966998999999987543133527999999999997399478999999999832898---
Q gi|254781033|r  233 SL----------------ENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHP---  293 (492)
Q Consensus       233 a~----------------~~~~~~~~~~A~~~~~~a~~~~p~~~~a~~~~a~~l~~~g~~~~A~~~le~a~~~~p~p---  293 (492)
T Consensus       321 ~v~~idKyR~ETCCiIaNYYSlr~eHEKAv~YFkRALkLNp~~~~aWTLmGHEyvEmKNt~AAi~sYRrAvdi~p~DyRA  400 (559)
T KOG1155         321 NVSNIDKYRPETCCIIANYYSLRSEHEKAVMYFKRALKLNPKYLSAWTLMGHEYVEMKNTHAAIESYRRAVDINPRDYRA  400 (559)
T ss_pred             HHHHHCCCCCCCEEEEHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCHHHHH
T ss_conf             99875147752324431378887768999999999983284313789986079898356188999999888149256788


Q ss_pred             --HHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCH-HHHHHHHHHHHH
Q ss_conf             --99999998507895899999999998268983689999999998799889999988786609998-999999999998
Q gi|254781033|r  294 --EIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRK-EIFLLLAQIEQA  370 (492)
Q Consensus       294 --~La~a~~~~~~~~~~~al~~~~~l~~~~P~~~e~~~~LA~~~~~~g~~~~Ar~~l~~al~~~P~~-~~~~llA~ie~~  370 (492)
T Consensus       401 WYGLGQaYeim--~Mh~YaLyYfqkA~~~kPnDsRlw~aLG~CY~kl~~~~eAiKCykrai~~~dte~~~l~~LakLye~  478 (559)
T KOG1155         401 WYGLGQAYEIM--KMHFYALYYFQKALELKPNDSRLWVALGECYEKLNRLEEAIKCYKRAILLGDTEGSALVRLAKLYEE  478 (559)
T ss_pred             HHHHHHHHHHH--CCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             85206899981--3569999999998724999668999999999985568999999988885246433899999999999


Q ss_pred             HCCCHHHHHHHHHHHHC
Q ss_conf             57998999999999962
Q gi|254781033|r  371 NSHNTDKILYWTQSALH  387 (492)
Q Consensus       371 e~~d~~~ar~wl~rA~~  387 (492)
T Consensus       479 l-~d~~eAa~~yek~v~  494 (559)
T KOG1155         479 L-KDLNEAAQYYEKYVE  494 (559)
T ss_pred             H-HHHHHHHHHHHH