HHsearch alignment for GI: 254781033 and conserved domain: TIGR00990

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents. These proteins include several chaperone proteins, four proteins of the outer membrane translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tom70 proteins. ; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0005741 mitochondrial outer membrane.
Probab=98.97  E-value=1e-07  Score=78.23  Aligned_cols=250  Identities=17%  Similarity=0.153  Sum_probs=195.7

Q ss_pred             HCCHHHHHHHHHHHHCC-CCHHH--------HHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             10001689999997268-85057--------9998654552158869999999988842126989999999999952574
Q gi|254781033|r  134 RQYNIAHEKLEMMLQIP-ATREF--------AVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEW  204 (492)
Q Consensus       134 gd~~~A~~~~~~~~~~~-~~~~~--------~~~gL~~~al~~gd~~~A~~~~~~a~~~~P~~~~a~~~L~~l~~~~gdw  204 (492)
T Consensus       336 ~~y~~aa~~F~~~Ld~~nede~L~e~~A~~~~~~G~F~--~L~~~~~~A~~Dl~K~IEL~P~~~qSYI~~A~~~~~~~~~  413 (649)
T TIGR00990       336 ESYEEAARAFEKALDLGNEDEKLGEKEAIALNLRGIFK--CLKGKHLEALADLSKSIELDPRVTQSYIKRASINLELGDP  413 (649)
T ss_pred             HHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHH--HHCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             22789999999984047751121145555441242223--3128815789987765422787317899999997415784


Q ss_pred             HHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             56999999999502310357899999999999966998999999987543133527999999999997399478999999
Q gi|254781033|r  205 SRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILE  284 (492)
Q Consensus       205 ~~A~~~l~~~~~~~~~~~~~~a~l~~~~a~~~~~~~~~~~A~~~~~~a~~~~p~~~~a~~~~a~~l~~~g~~~~A~~~le  284 (492)
T Consensus       414 ~~~~~~F~~Al~~~~~~~~----~YYHRaQl~FI~~~f~~A~KDy~K~~~LDp~~IF~~IQL~~~~Y~~~~~~~~~~~F~  489 (649)
T TIGR00990       414 DKAEEDFDKALKKNSEDPD----IYYHRAQLHFIKGEFAQAGKDYQKSIDLDPDFIFSYIQLGVLQYKLGSIASSMALFR  489 (649)
T ss_pred             HHHHHHHHHHHHCCCCCCC----CEEHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             2258899999861889875----110177899887307767545776643271102268999998863034434789999


Q ss_pred             HHHHHCC-CHHHHHHHHHHCCC--CHHHHHHHHHHHHHHCCC------CHHHHHHHHHHHHH---CCCHHHHHHHHHHHH
Q ss_conf             9998328-98999999985078--958999999999982689------83689999999998---799889999988786
Q gi|254781033|r  285 KIWKVNP-HPEIANIYTHLLSE--NTVGKLKRALRLEEINKE------SVESLVIVSKIALE---MGSIDQAHAKAMLAM  352 (492)
Q Consensus       285 ~a~~~~p-~p~La~a~~~~~~~--~~~~al~~~~~l~~~~P~------~~e~~~~LA~~~~~---~g~~~~Ar~~l~~al  352 (492)
T Consensus       490 ~~~~~Fp~~P~V~Nyy~ElL~D~~~F~~A~~~fD~AI~LE~~~~~~~~~v~PL~~Ka~~L~~nP~~~~f~EA~~L~EKA~  569 (649)
T TIGR00990       490 RCKKNFPEAPDVYNYYGELLLDKNKFDEAIEKFDLAIELEKELKPIYVNVLPLINKALALFQNPWKQDFIEAENLLEKAL  569 (649)
T ss_pred             HHHHCCCCCCCCCCHHHHHHHCHHHHHHHHHHHHHHHHHHHCCCCEEEECHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH
T ss_conf             99861778888530578886143679999998568999875059807631336778999762652100789999988863


Q ss_pred             HCCCCHHHH-HHHHHHHHHHCCCHHHHHHHHHHHHCCCC
Q ss_conf             609998999-99999999857998999999999962889
Q gi|254781033|r  353 KIAPRKEIF-LLLAQIEQANSHNTDKILYWTQSALHAMP  390 (492)
Q Consensus       353 ~~~P~~~~~-~llA~ie~~e~~d~~~ar~wl~rA~~a~~  390 (492)
T Consensus       570 ~~DP~~~~A~~~lAQl~LQQ-~~v~EAl~~FE~~A~LAR  607 (649)
T TIGR00990       570 IIDPECDIAVATLAQLLLQQ-GDVDEALKLFERAAELAR  607 (649)
T ss_pred             CCCCCHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHH
T ss_conf             04884147899999987623-468999999987787630