HHsearch alignment for GI: 254781033 and conserved domain: pfam02259

>pfam02259 FAT FAT domain. The FAT domain is named after FRAP, ATM and TRRAP.
Probab=96.03  E-value=0.14  Score=30.35  Aligned_cols=65  Identities=14%  Similarity=0.034  Sum_probs=45.5

Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCC--CHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             8999999999999669989999999875431335--2799999999999739947899999999983
Q gi|254781033|r  225 RAILLIARSLENADKGDMIASYHDAIESLKLCDN--SIMASICAAKSLISQNKKRKAEVILEKIWKV  289 (492)
Q Consensus       225 ~a~l~~~~a~~~~~~~~~~~A~~~~~~a~~~~p~--~~~a~~~~a~~l~~~g~~~~A~~~le~a~~~  289 (492)
T Consensus       149 ~~~~wlk~a~laRK~g~~~~A~~~l~~l~~~~~~~~~p~v~~e~aKllW~~g~~~~Ai~~L~~~~~~  215 (351)
T pfam02259       149 LAEMWLKFANLARKSGRFSLAEKALLKLLTYDTREDLPNVVIAYAKYLWAKGEQQEAFQKLREFTSC  215 (351)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             8999999999998888998999999998625887899546999999999748899999999999998