RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781034|ref|YP_003065447.1| hypothetical protein CLIBASIA_04680 [Candidatus Liberibacter asiaticus str. psy62] (344 letters) >gnl|CDD|33948 COG4223, COG4223, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 422 Score = 91.8 bits (227), Expect = 2e-19 Identities = 58/219 (26%), Positives = 96/219 (43%), Gaps = 8/219 (3%) Query: 120 TADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQ-------DIVTRLTKMETLTANPL 172 A + + +K L + +L L S L ++ R+ +E P Sbjct: 195 AALEAASAEPAPRVKALEVAVTALLPLESALPAERSTALAAVAELNGRIAALEQSLNEPA 254 Query: 173 RNPNTQRMVSLLILKNALDKGEYSSLNTTMQENFSVLKPCTATLMQFANIKIPTTIEILA 232 + ++ LK A+D+G E+ + P A L +A +PT E+ Sbjct: 255 DDIEAALAIAATALKTAIDRGGPFLAELDTLESVAPGDPALAALRPYAATGVPTRAELAT 314 Query: 233 KFPKVSEEMVFASESLEKDSGFANYLLFQLTRLVKVRPIGGNIEGDAITDVIARIENNLK 292 +F V+ MV AS + + ++G + L + LV VRP+G ++EG +IAR+E L Sbjct: 315 QFGAVANAMVSASNNPDPNAGLFDRLRSSASSLVSVRPVG-SVEGSTPDAMIARMEAALD 373 Query: 293 TGDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAIL 331 GDL A EWD +PE A+ S L+A I + ++ Sbjct: 374 NGDLEGAVLEWDSLPEAAKAASADFAVKLKARIEVETLV 412 >gnl|CDD|38128 KOG2917, KOG2917, KOG2917, Predicted exosome subunit [Translation, ribosomal structure and biogenesis]. Length = 250 Score = 29.9 bits (67), Expect = 0.95 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 11/106 (10%) Query: 95 KDISPVIEKEIISQNLSIAQQKDEETADKELANTQNFNIKPLL----EEIASLKQLISDL 150 KD+ V++ + N+S Q +E K T I + E S K+ S L Sbjct: 45 KDLDEVLQTHTVFSNVSKGQVAKKEDLIKAFGTTDETEICKEILSKGELQVSEKERHSQL 104 Query: 151 SKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDKGEYS 196 K ++DIVT + NP T+R +++ AL + +S Sbjct: 105 EKTFRDIVTIVAAKCV-------NPETKRPYPPSMIEKALQEIHFS 143 >gnl|CDD|100093 cd05800, PGM_like2, This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four structural domains (subdomains) with a centrally located active site formed by four loops, one from each subdomain. All four subdomains are included in this alignment model.. Length = 461 Score = 28.7 bits (65), Expect = 2.4 Identities = 19/69 (27%), Positives = 31/69 (44%), Gaps = 4/69 (5%) Query: 266 VKVRPIGGNIEGDAITDVIARIENNLKTGDLVKAAAEWDKIPEKARQPSMFLRNALEAHI 325 VKV+P G G A+ ++ A IE L +G+ A + + E P AL + + Sbjct: 109 VKVKPAFG---GSALPEITAAIEARLASGEPPGLEARAEGLIETI-DPKPDYLEALRSLV 164 Query: 326 CSDAILKEE 334 +AI + Sbjct: 165 DLEAIREAG 173 >gnl|CDD|146138 pfam03348, Serinc, Serine incorporator (Serinc). This is a family of eukaryotic membrane proteins which incorporate serine into membranes and facilitate the synthesis of the serine-derived lipids phosphatidylserine and sphingolipid. Members of this family contain 11 transmembrane domains and form intracellular complexes with key enzymes involved in serine and sphingolipid biosynthesis. Length = 426 Score = 28.4 bits (64), Expect = 3.2 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 9/28 (32%) Query: 38 FWEKILSNKTFFKILALVCVIVLTFIFI 65 FW FFKIL L+ +IV F FI Sbjct: 110 FW--------FFKILLLIGLIVGAF-FI 128 >gnl|CDD|30141 cd01643, Bacterial_IMPase_like_2, Bacterial family of Mg++ dependent phosphatases, related to inositol monophosphatases. These enzymes may dephosphorylate inositol monophosphate or similar substrates.. Length = 242 Score = 28.0 bits (62), Expect = 4.1 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 9/45 (20%) Query: 294 GDLVKAAAEWDKIPEKARQPSMFLRNALEAHICSDAILKEEMAKI 338 G LV AA W Q +R L A D +L EE I Sbjct: 31 GSLVTAADRW------VEQ---LIRARLAAQFPDDGVLGEEGGGI 66 >gnl|CDD|145924 pfam03034, PSS, Phosphatidyl serine synthase. Phosphatidyl serine synthase is also known as serine exchange enzyme. This family represents eukaryotic PSS I and II which are membrane bound proteins which catalyses the replacement of the head group of a phospholipid (phosphotidylcholine or phosphotidylethanolamine) by L-serine. Length = 278 Score = 27.7 bits (62), Expect = 4.5 Identities = 15/55 (27%), Positives = 26/55 (47%), Gaps = 7/55 (12%) Query: 33 TWRKFFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKFL---RTDNNLLLL 84 +W K+ W+ S K F ++L LV +I+L + F K + + L+L Sbjct: 176 SWDKYEWKVFKSPKRFLQVLFLVFLILLAEL----NTFFLKHILWIPPSHPLVLY 226 >gnl|CDD|36159 KOG0941, KOG0941, KOG0941, E3 ubiquitin protein ligase [Posttranslational modification, protein turnover, chaperones]. Length = 850 Score = 27.6 bits (61), Expect = 4.6 Identities = 11/61 (18%), Positives = 23/61 (37%), Gaps = 6/61 (9%) Query: 27 CDVKKITWRKFFWEKILSNK------TFFKILALVCVIVLTFIFIFTALFTEKFLRTDNN 80 C I + +F+ E++ ++ + C + FI A+ + L+ D Sbjct: 416 CRKGLIPYEEFYNEELNDRIDMKEDYVHWRTKQMNCFSFCNYPFILNAVAKIELLQYDAR 475 Query: 81 L 81 L Sbjct: 476 L 476 >gnl|CDD|72858 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.. Length = 148 Score = 27.7 bits (61), Expect = 4.7 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 9/65 (13%) Query: 284 IARIENNLKTGDLVKAAAEWDKIPEK---ARQP-----SMFLRNALEAHICSDAILKEEM 335 +ARIE + AA W +PE+ RQP ++L N A I + IL+ Sbjct: 55 LARIEKLWEENGTYWYAARWYTLPEETHMGRQPHNLRRELYLTNDF-ADIEMECILRHCS 113 Query: 336 AKIPQ 340 K P+ Sbjct: 114 VKCPK 118 >gnl|CDD|177124 MTH00049, COX3, cytochrome c oxidase subunit III; Validated. Length = 215 Score = 27.6 bits (62), Expect = 4.8 Identities = 10/38 (26%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Query: 37 FFWEKILSNKTFFKILALVCVIVLTFIFIFTALFTEKF 74 F W K F ++ L+ ++L IF+ L K Sbjct: 20 FLW------KPFILLVFLILWVLLIVIFVSDGLVQVKH 51 >gnl|CDD|29987 cd01121, Sms, Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.. Length = 372 Score = 27.1 bits (60), Expect = 7.0 Identities = 24/72 (33%), Positives = 32/72 (44%), Gaps = 15/72 (20%) Query: 207 SVLKPCTATLMQFANIK-IPTTI--------EILAKFPKVSEEMVFASESLEKDSGFANY 257 S ++ CTA LM+FA + IP I I PKV E MV E D + Sbjct: 183 SQVRECTAELMRFAKERNIPIFIVGHVTKEGSIAG--PKVLEHMVDTVLYFEGD----RH 236 Query: 258 LLFQLTRLVKVR 269 +++ R VK R Sbjct: 237 SEYRILRSVKNR 248 >gnl|CDD|113356 pfam04582, Reo_sigmaC, Reovirus sigma C capsid protein. Length = 326 Score = 27.2 bits (60), Expect = 7.4 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 6/76 (7%) Query: 134 KPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDKG 193 L E ++++ +SDLS + QD+ T L T N L S+ L + L Sbjct: 45 ASLSESVSTISSRLSDLSADLQDMTTSLDDA-KATLNGLITTVQALQTSVDSLSSEL--- 100 Query: 194 EYSSLNTTMQENFSVL 209 + L+ T+ + + + Sbjct: 101 --ADLSLTVSAHDAAI 114 >gnl|CDD|112419 pfam03601, Cons_hypoth698, Conserved hypothetical protein 698. Length = 305 Score = 26.9 bits (60), Expect = 8.2 Identities = 14/44 (31%), Positives = 18/44 (40%), Gaps = 6/44 (13%) Query: 47 TFFKILA------LVCVIVLTFIFIFTALFTEKFLRTDNNLLLL 84 T I A L+ IVL F+ ++ L D NL LL Sbjct: 73 TLSDIAAVGLKGVLIDAIVLISTFLLVLFLGQRLLGLDKNLALL 116 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.316 0.132 0.364 Gapped Lambda K H 0.267 0.0662 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,902,075 Number of extensions: 199855 Number of successful extensions: 607 Number of sequences better than 10.0: 1 Number of HSP's gapped: 605 Number of HSP's successfully gapped: 32 Length of query: 344 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 249 Effective length of database: 4,210,882 Effective search space: 1048509618 Effective search space used: 1048509618 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 58 (26.3 bits)