RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781034|ref|YP_003065447.1| hypothetical protein CLIBASIA_04680 [Candidatus Liberibacter asiaticus str. psy62] (344 letters) >d1x3aa1 a.240.1.1 (A:8-94) Synapse associated protein 1, SYAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Score = 27.4 bits (61), Expect = 1.7 Identities = 16/66 (24%), Positives = 25/66 (37%) Query: 102 EKEIISQNLSIAQQKDEETADKELANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRL 161 E+ I Q L+++ K D NF+ + + Q LSK +V +L Sbjct: 4 EETIQQQILALSADKRNFLRDPPAGVQFNFDFDQMYPVALVMLQEDELLSKMRFALVPKL 63 Query: 162 TKMETL 167 K E Sbjct: 64 VKEEVF 69 >d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 477 Score = 27.2 bits (60), Expect = 2.0 Identities = 23/124 (18%), Positives = 48/124 (38%), Gaps = 7/124 (5%) Query: 39 WEKILSNKTFFKIL--ALVCVIVLTFIFIFTALFTEKFLRTDNNLLLLPSVSPLKEDPKD 96 SN ++ +L+ + +LTF +F +K+L +LL L ++ KE Sbjct: 229 IVATNSNHLGIQLQYHSLLLIWLLTFNPVFANELVQKYLSDFLDLLKLVKITI-KEKVSR 287 Query: 97 ISPVIEKEIISQNLSIAQQKDEETADKE--LANTQNFNIKPLLEE--IASLKQLISDLSK 152 + I + S + ++ ++ L Q+ + + +E + L L Sbjct: 288 LCISIILQCCSTRVKQHKKVIKQLLLLGNALPTVQSLSERKYSDEELRQDISNLKEILEN 347 Query: 153 NYQD 156 YQ+ Sbjct: 348 EYQE 351 >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Score = 27.0 bits (59), Expect = 2.2 Identities = 13/80 (16%), Positives = 30/80 (37%), Gaps = 8/80 (10%) Query: 82 LLLPSVSPLKEDPKDISPVIEKEIISQNLSIAQQK--------DEETADKELANTQNFNI 133 L +V+ +D K ISP I +++ + ++ E + N ++ Sbjct: 10 YLFHTVAGKHQDLKYISPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHM 69 Query: 134 KPLLEEIASLKQLISDLSKN 153 + +E+ K ++ K Sbjct: 70 EEEVEDFLLKKPIVPTDGKR 89 >d1epwa3 d.92.1.7 (A:1-533) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Length = 533 Score = 26.4 bits (58), Expect = 3.4 Identities = 14/56 (25%), Positives = 25/56 (44%), Gaps = 5/56 (8%) Query: 144 KQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLLILKNALDK---GEYS 196 K + + +N++ IV RL K+ ++P N N + K + G+YS Sbjct: 285 KSIYDKVLQNFRGIVDRLNKVLVCISDP--NININIYKNKFKDKYKFVEDSEGKYS 338 >d1t3ca_ d.92.1.7 (A:) Botulinum neurotoxin {Clostridium botulinum, serotype E [TaxId: 1491]} Length = 411 Score = 25.9 bits (57), Expect = 4.8 Identities = 12/76 (15%), Positives = 28/76 (36%), Gaps = 6/76 (7%) Query: 97 ISPVIEKEIISQNLSIAQQKDEETADKEL--ANTQNFNIKPLLEEIASLKQLISDLSKNY 154 + K I+Q + T +E + NI + + ++L +Y Sbjct: 223 AKGITTKYTITQKQNPLITNIRGTNIEEFLTFGGTDLNIITSAQS----NDIYTNLLADY 278 Query: 155 QDIVTRLTKMETLTAN 170 + I ++L+K++ Sbjct: 279 KKIASKLSKVQVSNPL 294 >d2giab1 d.18.1.4 (B:28-173) GBP21 {Trypanosoma brucei [TaxId: 5691]} Length = 146 Score = 25.8 bits (56), Expect = 5.6 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Query: 78 DNNLLLL---PSVSPLKEDPKDISPVIEKE 104 D LLL+ P + P K DP D+SP + + Sbjct: 25 DGKLLLISQYPQLGPRKVDPNDLSPQFDAD 54 >d2onkc1 f.58.1.1 (C:1-252) Molybdate/tungstate transport system permease protein WtpB (ModB) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 252 Score = 25.3 bits (54), Expect = 8.1 Identities = 10/33 (30%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 48 FFKILALVCVIVLTFIFI-FTALFTEKFLRTDN 79 F +LAL+ I+L F+ + A T + D Sbjct: 5 FSALLALLSSIILLFVLLPVAATVTLQLFNFDE 37 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.132 0.364 Gapped Lambda K H 0.267 0.0554 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,198,536 Number of extensions: 55699 Number of successful extensions: 162 Number of sequences better than 10.0: 1 Number of HSP's gapped: 162 Number of HSP's successfully gapped: 13 Length of query: 344 Length of database: 2,407,596 Length adjustment: 86 Effective length of query: 258 Effective length of database: 1,226,816 Effective search space: 316518528 Effective search space used: 316518528 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (24.6 bits)