RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781036|ref|YP_003065449.1| hypothetical protein CLIBASIA_04690 [Candidatus Liberibacter asiaticus str. psy62] (65 letters) >gnl|CDD|162505 TIGR01730, RND_mfp, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. Length = 322 Score = 28.4 bits (64), Expect = 0.46 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 8/44 (18%) Query: 3 IAPF-GSLGVAVLSR--YVKSG-----VFNLDSLLVDFSVSLKE 38 APF G++G ++ YV +G + +LD L DFSV ++ Sbjct: 138 RAPFDGTIGRRLVEVGAYVTAGQTLATIVDLDPLEADFSVPERD 181 >gnl|CDD|118864 pfam10343, DUF2419, Protein of unknown function (DUF2419). This is a family of conserved proteins found from plants to humans. The function is not known. A few members are annotated as being cobyrinic acid a,c-diamide synthetase but this could not be confirmed. Length = 282 Score = 25.3 bits (56), Expect = 3.9 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 5/34 (14%) Query: 25 LDSLLVDFSV--SLKEHFFDTYSIPWH---SIFY 53 ++++L+DF + KE D IP H SI+Y Sbjct: 249 VNAILIDFFLWDYGKELEADGEKIPHHRTRSIYY 282 >gnl|CDD|162958 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA. Length = 731 Score = 25.0 bits (55), Expect = 4.6 Identities = 10/46 (21%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Query: 3 IAPFGSLGVAVLSRYVKSGVFNLDSLLVDFSVSLKEHFFDTYSIPW 48 I F L VL + V+ V L L + ++ L+ + + Sbjct: 643 IIHFNPLSEEVLEKIVQKFVDELSKQLNEKNIKLE---LTDDAKKY 685 >gnl|CDD|163523 TIGR03811, tyr_de_CO2_Ent, tyrosine decarboxylase, Enterococcus type. This model represents tyrosine decarboxylases in the family of the Enterococcus faecalis enzyme Tdc. These enzymes often are encoded next to tyrosine/tyramine antiporter, together comprising a system in which tyrosine decarboxylation can protect against exposure to acid conditions. This clade differs from the archaeal tyrosine decarboxylases associated with methanofuran biosynthesis. Length = 608 Score = 24.4 bits (53), Expect = 7.6 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 5/36 (13%) Query: 15 SRYVKSGVFNLDSLLVDFSVSLKEHFFDTYSIPWHS 50 S+ V N+ +L + S L+ T S+PWHS Sbjct: 52 SKSFTKTVNNMKDVLDELSSRLR-----TESVPWHS 82 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.139 0.442 Gapped Lambda K H 0.267 0.0622 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,043,189 Number of extensions: 48662 Number of successful extensions: 145 Number of sequences better than 10.0: 1 Number of HSP's gapped: 145 Number of HSP's successfully gapped: 5 Length of query: 65 Length of database: 5,994,473 Length adjustment: 36 Effective length of query: 29 Effective length of database: 5,216,585 Effective search space: 151280965 Effective search space used: 151280965 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.3 bits)