HHsearch results for GI: 254781037 and protein with PDBid: 2iee_A

>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis}
Probab=94.32  E-value=0.29  Score=27.13  Aligned_cols=164  Identities=13%  Similarity=0.050  Sum_probs=80.8

Q ss_pred             HHHHHHCCCCEEEEECCCCCCCCCCCCCEEEEECCCCCCCEEEEECCC-----CCCCCCCCCCEEECCCC-CHHHHHHHH
Q ss_conf             999987098369974034321110122101222365683105665243-----24332456732204753-028889984
Q gi|254781037|r   68 IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-----QSLKDLALHSVIGTSSL-RRKALLLRW  141 (307)
Q Consensus        68 le~aLl~g~iDiAVHSlKDlP~~~~~~l~i~a~~~R~d~rD~lv~~~~-----~~l~~lp~~a~IGTsS~-RR~aql~~~  141 (307)
                      +..+|.+|++|+++.++..-|. ..+.+.... +--.. ..+++.+..     .++++|. |.+||+..- --..+++..
T Consensus        75 ~~~~l~~g~~D~~~~~~~~~~~-r~~~~~~s~-p~~~~-~~~~~~~~~~~~~~~~~~dl~-g~~v~v~~g~~~~~~l~~~  150 (271)
T 2iee_A           75 MLTAVNSGQVDAAANDIDVTKD-REEKFAFST-PYKYS-YGTAIVRKDDLSGIKTLKDLK-GKKAAGAATTVYMEVARKY  150 (271)
T ss_dssp             HHHHHHHTSSSEECSSCBCCHH-HHTTEEECC-CSEEE-EEEEEECTTTGGGCSSGGGGT-TCEEESCTTSHHHHHHHHT
T ss_pred             HHHHHHCCCCCEEECCCCCCHH-HHHHHHCCC-CCCCC-CCCEEEECCCCCCCCCHHHHC-CCEEEECCCCHHHHHHHHC
T ss_conf             9999976997744024546878-876542056-62215-762367504777779878807-9458971685899999970


Q ss_pred             HCCCCCHHHCCCHHHHHHHHHCCCCCEEEEEHHHHHHCCCCCC-CCCCCCHHHCCCCCCCCEEEEEEECCCCHHHHHHHH
Q ss_conf             2377310330767999998637876556301454542162112-223368667358543207899985276124556776
Q gi|254781037|r  142 RSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV-IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKV  220 (307)
Q Consensus       142 ~p~l~~~~iRGNv~TRl~Kl~~g~~DaiilA~Agl~RL~l~~~-i~~~l~~~~~~PA~gQGaIaIe~r~~d~~i~~il~~  220 (307)
                      +|...+... .+.+.-+..|.+|++|++|.-..-+..+-.... ....+.+.  . ..-...+++-.+++|.++.+   .
T Consensus       151 ~~~~~i~~~-~s~~~~l~~L~~grvD~~i~~~~~~~~~~~~~~~~~~~~~~~--~-~~~~~~~~~~~~k~~~~L~~---~  223 (271)
T 2iee_A          151 GAKEVIYDN-ATNEQYLKDVANGRTDVILNDYYLQTLALAAFPDLNITIHPD--I-KYMPNKQALVMKKSNAALQK---K  223 (271)
T ss_dssp             TCEEEECSS-CCHHHHHHHHHHTSSCEEEEEHHHHHHHHHHCTTSSCEECSS--C-CEEEEEECCEEETTCHHHHH---H
T ss_pred             CCCCEEEEE-CCHHHHHHHHHCCCEEEEEECHHHHHHHHHHCCCCCEEECCC--C-CCCCCEEEEEEECCCHHHHH---H
T ss_conf             898589982-360889999976953499924999999998689974686667--6-65661289999489999999---9


Q ss_pred             HCCHHHHHH--HHHHHHHHHHHCC
Q ss_conf             239788888--7889999987177
Q gi|254781037|r  221 INHEDTWDS--VNCERAFLAELDG  242 (307)
Q Consensus       221 Ind~~T~~~--v~aER~fL~~L~G  242 (307)
                      +|..-..+.  -+.++-+=+-+++
T Consensus       224 ln~~l~~i~~dG~~~~I~~kyf~~  247 (271)
T 2iee_A          224 MNEALKEMSKDGSLTKLSKQFFNK  247 (271)
T ss_dssp             HHHHHHHHHHHTHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHCCHHHHHHHHHCCC
T ss_conf             999999999787799999874899