BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781037|ref|YP_003065450.1| porphobilinogen deaminase
[Candidatus Liberibacter asiaticus str. psy62]
         (307 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781037|ref|YP_003065450.1| porphobilinogen deaminase [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040714|gb|ACT57510.1| porphobilinogen deaminase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 307

 Score =  631 bits (1628), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 307/307 (100%), Positives = 307/307 (100%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG
Sbjct: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD
Sbjct: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK
Sbjct: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL
Sbjct: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS
Sbjct: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300

Query: 301 NKNVFNF 307
           NKNVFNF
Sbjct: 301 NKNVFNF 307


>gi|315122376|ref|YP_004062865.1| porphobilinogen deaminase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495778|gb|ADR52377.1| porphobilinogen deaminase [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 307

 Score =  518 bits (1334), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 243/307 (79%), Positives = 276/307 (89%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           ME+K F+IGTR SPLALAHAFETRS LM VHKIP   I ++PLSTKGDRITNRTLTEIGG
Sbjct: 1   MEEKDFKIGTRRSPLALAHAFETRSYLMSVHKIPLEKIFVVPLSTKGDRITNRTLTEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEEIE+KLISGEID AVHSAKDMPTKLLKGL+ISAYLPRED+RDVFISHTAQSL D
Sbjct: 61  KGLFTEEIERKLISGEIDFAVHSAKDMPTKLLKGLRISAYLPREDVRDVFISHTAQSLND 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA++S++GTSSLRRKALLLRWR+D+S+IDFRGKIETRL KL N +A A+LLAYAGIKRLK
Sbjct: 121 LAVNSIVGTSSLRRKALLLRWRADLSIIDFRGKIETRLTKLKNKQADAMLLAYAGIKRLK 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           KE V+KEILN+EDFPPSPGQGAICIETH+NN +A EL   INH +TWD+V+CERAFLAEL
Sbjct: 181 KESVVKEILNLEDFPPSPGQGAICIETHMNNTRAHELATAINHRETWDTVSCERAFLAEL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSCKSAIAGF+YCKG +LYFYG +L  DGKIFHEVS++GN CDAI IGRDA ++IR I+
Sbjct: 241 DGSCKSAIAGFSYCKGQSLYFYGTILTPDGKIFHEVSKSGNCCDAIQIGRDAGRHIRLIA 300

Query: 301 NKNVFNF 307
           +K +FN 
Sbjct: 301 DKTIFNL 307


>gi|325294021|ref|YP_004279885.1| Porphobilinogen deaminase [Agrobacterium sp. H13-3]
 gi|325061874|gb|ADY65565.1| Porphobilinogen deaminase [Agrobacterium sp. H13-3]
          Length = 309

 Score =  361 bits (926), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 225/306 (73%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A+ETR+ LM  H +P     I+ LSTKGDRIT+R L+EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAYETRNRLMSAHGLPEDMFEIVVLSTKGDRITDRALSEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E +L+SGE+D AVHS+KDMPT L KGL +SA+LPRED+RD FI  TA  L +
Sbjct: 61  KGLFTEELESQLLSGELDIAVHSSKDMPTVLPKGLYLSAFLPREDMRDAFIGRTAPKLLE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G++SLRR+AL+ R R D+SVI FRG++ETRL KL   +A A LLA+AG+KRL 
Sbjct: 121 LPQGAVVGSASLRRQALIRRLRPDLSVIIFRGQVETRLRKLEEGQADATLLAFAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V  +IL+ +DFPP+P QGAIC+E+ + + +  EL+  IN   T+D+V CERAFLA L
Sbjct: 181 MENVPTDILDPKDFPPAPAQGAICVESRIGDTRMDELLSPINDIPTYDAVTCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAGFA C G  L+F G++L  DG+  H V  +G R DA ++GR A + +R  +
Sbjct: 241 DGSCRTPIAGFATCHGEELHFSGLILTPDGQTSHSVEISGARKDAEDLGRKAGEDVRARA 300

Query: 301 NKNVFN 306
             N F+
Sbjct: 301 GSNFFD 306


>gi|15889908|ref|NP_355589.1| porphobilinogen deaminase [Agrobacterium tumefaciens str. C58]
 gi|23821691|sp|Q8UC46|HEM3_AGRT5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|15157859|gb|AAK88374.1| porphobilinogen deaminase [Agrobacterium tumefaciens str. C58]
          Length = 309

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 167/306 (54%), Positives = 225/306 (73%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A+ETRS LM  H +P     I+ LSTKGDRIT+R L+EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAYETRSRLMAAHGLPEEMFEIVVLSTKGDRITDRALSEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E +L+SGE+D AVHS+KDMPT L +GL +SA+LPRED+RD FI  TA  L +
Sbjct: 61  KGLFTEELENQLLSGELDIAVHSSKDMPTVLPEGLHLSAFLPREDMRDAFIGRTAPKLLE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G++SLRR+AL+ R R D++VI FRG ++TRL KL   +A A LLA+AG+KRL 
Sbjct: 121 LPQGAVVGSASLRRQALIRRLRPDLNVIVFRGLVDTRLRKLEEGQADATLLAFAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K+ V  EIL+ ++FPP+P QGAI +E+ + + +  +L+  IN   T+D+V CERAFLA L
Sbjct: 181 KDNVPTEILDPKEFPPAPAQGAIGVESRIGDARMDKLLAPINDRPTYDAVTCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A C+G  L+F G++L  DG+  H V  +GNR DA+ +G+ A + +R  +
Sbjct: 241 DGSCRTPIAGYATCEGDNLHFSGLILTPDGQTSHGVEISGNRRDALILGKKAGEEVRAKA 300

Query: 301 NKNVFN 306
             N F 
Sbjct: 301 GSNFFE 306


>gi|190893753|ref|YP_001980295.1| porphobilinogen deaminase [Rhizobium etli CIAT 652]
 gi|190699032|gb|ACE93117.1| porphobilinogen deaminase protein [Rhizobium etli CIAT 652]
          Length = 309

 Score =  344 bits (883), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 217/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ LSTKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEEMFEIVVLSTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL+SGE+D AVHSAKDMPT L  GL +SAYLPREDIRD  I  TA  L D
Sbjct: 61  KGLFTEELEQKLVSGELDFAVHSAKDMPTHLPDGLHLSAYLPREDIRDAVIGRTAPKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVIIFRGSVETRLRKLEEGQVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K +V+ +IL+ + FPP+P QGAICIE+ + + +  +L+  +N   T+D+V+CERAFLA L
Sbjct: 181 KVEVLTDILDPDTFPPAPAQGAICIESRIGDSRIDDLLAAVNDAATFDTVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|86359485|ref|YP_471377.1| porphobilinogen deaminase [Rhizobium etli CFN 42]
 gi|86283587|gb|ABC92650.1| porphobilinogen deaminase protein [Rhizobium etli CFN 42]
          Length = 309

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 166/306 (54%), Positives = 216/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +      I+ L+TKGDRIT+R L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHNLSEEMFEIVVLTTKGDRITDRPLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL+SGE+D AVHSAKDMPT L  GL +SAYLPREDIRD  +  TA  L D
Sbjct: 61  KGLFTEELEQKLVSGELDFAVHSAKDMPTHLPDGLHLSAYLPREDIRDAVVGRTAPKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI FRG +ETRL KL+  +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVITFRGSVETRLRKLDEGQVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K +VI ++L+ + FPP+P QGAICIE+ V + K  +L+  +N   T+DSV+CERAFLA L
Sbjct: 181 KVEVITDVLDPDTFPPAPAQGAICIESRVGDTKIDDLLAAVNDATTFDSVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|209551271|ref|YP_002283188.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209537027|gb|ACI56962.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 309

 Score =  341 bits (874), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 163/306 (53%), Positives = 217/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ LSTKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEEMFEIVVLSTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E++L +GE+D AVHSAKDMPTKL  GL +SAYLPREDIRD  I  TA  L D
Sbjct: 61  KGLFTEELEQQLTTGELDFAVHSAKDMPTKLPDGLHLSAYLPREDIRDAVIGRTAPKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+V+ FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVVTFRGLVETRLRKLEEGQVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K +V+ +IL+ + FPP+P QGAIC+E+ + + +  +L+  +N   T+D+V+CERAFLA L
Sbjct: 181 KVEVLTDILDPDTFPPAPAQGAICLESRIGDTQIDDLLAPVNDAATFDTVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|241206704|ref|YP_002977800.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860594|gb|ACS58261.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 309

 Score =  339 bits (869), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 164/306 (53%), Positives = 217/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ L+TKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEDMFEIVVLTTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL +GE+D AVHSAKDM TKL +GL +SAYLPREDIRD  I  TA+ L D
Sbjct: 61  KGLFTEELEQKLAAGELDFAVHSAKDMATKLPEGLYLSAYLPREDIRDAVIGRTARKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVITFRGLVETRLRKLEQGEVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K  V+ +IL+ + FPP+P QGAICIE+ + + +  +L+  +N   T+D+V+CERAFLA L
Sbjct: 181 KVDVLTDILDPDTFPPAPAQGAICIESRIGDARVDDLLAPVNDGPTFDTVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|222150055|ref|YP_002551012.1| porphobilinogen deaminase [Agrobacterium vitis S4]
 gi|221737037|gb|ACM38000.1| porphobilinogen deaminase [Agrobacterium vitis S4]
          Length = 309

 Score =  338 bits (868), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 164/306 (53%), Positives = 212/306 (69%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A ETR  L   H + P    I+ LST GDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHETRERLATAHGLSPDMFEIVVLSTTGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT E+E++L+SG +D AVHS+KDMPT L  GL+ISAYLPRED+RD FI  TA  L +
Sbjct: 61  KGLFTLELEQQLLSGGLDFAVHSSKDMPTALPDGLEISAYLPREDMRDAFIGRTAPKLLE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  +VIG++SLRR+AL+ R R D+ VI +RG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LAEGAVIGSASLRRQALIRRLRPDLQVITYRGAVETRLRKLAAGEVDATLLAVAGLKRLD 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           KE VI + L++E FPP+P QGAICIE  V++ + Q+L+  INH  T+D+V+CERAFLA L
Sbjct: 181 KETVITQYLDLESFPPAPAQGAICIEARVDDRRIQDLLAPINHRPTFDAVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A   G  +   G +L  DG++ H V   G   D + +G  A + +R  +
Sbjct: 241 DGSCRTPIAGYAISDGEMIRLTGTILTPDGQVSHSVEAEGRCADGLALGWSAGEKVRDKA 300

Query: 301 NKNVFN 306
               F 
Sbjct: 301 GPGFFE 306


>gi|116254224|ref|YP_770062.1| porphobilinogen deaminase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115258872|emb|CAK09980.1| putative porphobilinogen deaminase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 309

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 163/306 (53%), Positives = 217/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ L+TKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEDMFEIVVLTTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL +GE+D AVHSAKDM TKL +GL +SAYLPREDIRD  I  TA+ L D
Sbjct: 61  KGLFTEELEQKLTAGELDFAVHSAKDMATKLPEGLYLSAYLPREDIRDAVIGRTARKLID 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+V+ FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 121 LPHGATVGSSSLRRQALIRRMRPDINVVTFRGLVETRLRKLEEGEVDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K  V+ +IL+ + FPP+P QGAICIE+ + + +  +L+  +N   T+D+V+CERAFLA L
Sbjct: 181 KVDVLTDILDPDTFPPAPAQGAICIESRIGDARIDDLLAPVNDIMTFDTVSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G+A C+G  + F G+++  DG+  H V+ +G+R DA  +G  A Q +R  +
Sbjct: 241 DGSCRTPIGGYAVCEGDLIRFSGLIITPDGRSQHAVTTDGHRRDAAALGTRAGQDVRARA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GSAFFD 306


>gi|222087476|ref|YP_002546013.1| porphobilinogen deaminase [Agrobacterium radiobacter K84]
 gi|221724924|gb|ACM28080.1| porphobilinogen deaminase [Agrobacterium radiobacter K84]
          Length = 322

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 164/306 (53%), Positives = 214/306 (69%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ L+TKGDRI +RTL EIGG
Sbjct: 14  MQTKPFRIGTRGSPLALAQAHEARDRLMAAHGLPEEMFEIVALTTKGDRIADRTLAEIGG 73

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E+KL SGE+D AVHSAKDM TKL +GL ++AYLPREDIRD  I  TA  L +
Sbjct: 74  KGLFTQELEEKLTSGELDFAVHSAKDMATKLPEGLALTAYLPREDIRDSVIGRTAPKLIE 133

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G++SLRR+AL+ R R DI+VI FRG ++TRL KL   +A A LLA AG+KRL 
Sbjct: 134 LPHGATVGSASLRRQALIRRLRPDINVITFRGSVQTRLRKLEEGQADATLLAVAGLKRLG 193

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K  VI +IL+ ++FPP+P QGAI IE+ + + +  +L+  IN   T+D V+CER FLA L
Sbjct: 194 KVDVITDILDPDEFPPAPAQGAIGIESRIGDKRMNDLLAAINDSPTFDIVSCERGFLAAL 253

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A C+G  + F+G++L  DG+  H  +  GNR DA  +G +A Q IR  +
Sbjct: 254 DGSCRTPIAGYAVCEGDHIRFFGMILTPDGQQVHTTTIEGNRRDAEALGTNAGQAIRAEA 313

Query: 301 NKNVFN 306
               F 
Sbjct: 314 GSAFFE 319


>gi|15966832|ref|NP_387185.1| porphobilinogen deaminase [Sinorhizobium meliloti 1021]
 gi|307301660|ref|ZP_07581419.1| porphobilinogen deaminase [Sinorhizobium meliloti BL225C]
 gi|307316316|ref|ZP_07595760.1| porphobilinogen deaminase [Sinorhizobium meliloti AK83]
 gi|23821697|sp|Q92LH7|HEM3_RHIME RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|15076104|emb|CAC47658.1| Probable porphobilinogen deaminase [Sinorhizobium meliloti 1021]
 gi|306898156|gb|EFN28898.1| porphobilinogen deaminase [Sinorhizobium meliloti AK83]
 gi|306903358|gb|EFN33947.1| porphobilinogen deaminase [Sinorhizobium meliloti BL225C]
          Length = 309

 Score =  335 bits (858), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 156/306 (50%), Positives = 215/306 (70%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLA+A   ETR  L   H +PP    I+ LSTKGDRIT+R+L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLAMAQTHETRDRLAAAHGLPPEMFEIVILSTKGDRITDRSLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E++L+SG++D AVHS+KDMPTKL +GL +SA+LPREDIRD F+  +A+ L D
Sbjct: 61  KGLFTEELEQQLLSGDLDFAVHSSKDMPTKLPEGLFLSAFLPREDIRDAFVGRSAKRLVD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI VI +RG++ETRL KL   +    LLAYAG++RL 
Sbjct: 121 LPQGATVGSSSLRRQALIRRLRPDIDVITYRGQVETRLRKLAEGQVDGTLLAYAGLRRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V  E+L+ E+FPP+P QGAIC+E  + + +   L+  I+   T ++V+CER FLA L
Sbjct: 181 MEHVPTELLDPEEFPPAPAQGAICVEARIGDDRINTLLAAIDDPRTHEAVSCERGFLATL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A   G+ + F G++L  DG   H++  +G   DA  +G++A + IR  +
Sbjct: 241 DGSCRTPIAGYAQSDGTHIRFAGMILTPDGTTSHQIEIDGRAADAERLGQEAGERIRAKA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GPGFFS 306


>gi|163757401|ref|ZP_02164490.1| porphobilinogen deaminase [Hoeflea phototrophica DFL-43]
 gi|162284903|gb|EDQ35185.1| porphobilinogen deaminase [Hoeflea phototrophica DFL-43]
          Length = 312

 Score =  334 bits (857), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 209/305 (68%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           + KP+RIGTR SPLALA A ETR  LM  H +P     I+ LSTKGDRIT+R L EIGGK
Sbjct: 5   QMKPYRIGTRGSPLALAQAHETRERLMAAHDLPESAFEIVVLSTKGDRITDRPLAEIGGK 64

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEE+E++L  G +D AVHS+KDMPT L +GL I  YL RED RD +IS  A  L+DL
Sbjct: 65  GLFTEELEEQLSDGRLDLAVHSSKDMPTALPEGLGIVTYLEREDPRDAYISSAAPRLEDL 124

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+G+SSLRR+AL+ R R DISVI FRG ++TRL KL + + HA +LA+AG+KRL K
Sbjct: 125 PQKAVVGSSSLRRQALIRRLRPDISVITFRGLVDTRLRKLADGEVHATMLAFAGLKRLGK 184

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            +V+  +++ E FPP+PGQGAICIE  +++ +  EL+  I+H DT  ++NCER FL  LD
Sbjct: 185 SEVVTNLMDPESFPPAPGQGAICIEARLDDERIAELLAPIDHADTHAALNCERGFLGALD 244

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IAG A  +   + FYG++L  DG  FH++   G   DA  +G DA   +R  + 
Sbjct: 245 GSCRTPIAGHATLENGQVSFYGMILTPDGTTFHDIRVQGPAADAAQLGADAGAEVRARAG 304

Query: 302 KNVFN 306
              F 
Sbjct: 305 SKFFE 309


>gi|227823724|ref|YP_002827697.1| porphobilinogen deaminase [Sinorhizobium fredii NGR234]
 gi|227342726|gb|ACP26944.1| porphobilinogen deaminase [Sinorhizobium fredii NGR234]
          Length = 309

 Score =  327 bits (838), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 209/306 (68%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA   ETR  L   H +PP    ++ LSTKGDRIT+R L EIGG
Sbjct: 1   MQTKPFRIGTRGSPLALAQTHETRDRLAAAHGLPPEMFEVVVLSTKGDRITDRPLAEIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E++L+SG++D AVHS+KDMPTKL  GL +SA+LPREDIRD F+  TA  L +
Sbjct: 61  KGLFTEELEQQLLSGDLDFAVHSSKDMPTKLPDGLFLSAFLPREDIRDAFVGRTAPRLVE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI +RG++ETRL KL   +    LLA+AG+KRL 
Sbjct: 121 LPEGATVGSSSLRRQALIRRLRPDINVITYRGQVETRLRKLAEGQVDGTLLAFAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V  E+L+ ++FPP+P QGAICIE+   + +   L+  I+   T ++V CER FLA L
Sbjct: 181 MTDVPTELLDPKEFPPAPAQGAICIESRDGDDRVNALLAAIDDPRTHEAVACERGFLATL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A   G+ + F G++L  DG   H V  +G   DA  +GR A + IR  +
Sbjct: 241 DGSCRTPIAGYAQSDGTYIRFSGMILTPDGATSHRVEIDGKAQDATELGRKAGEQIRDKA 300

Query: 301 NKNVFN 306
               F+
Sbjct: 301 GPGFFS 306


>gi|150398163|ref|YP_001328630.1| porphobilinogen deaminase [Sinorhizobium medicae WSM419]
 gi|150029678|gb|ABR61795.1| porphobilinogen deaminase [Sinorhizobium medicae WSM419]
          Length = 330

 Score =  322 bits (826), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 152/305 (49%), Positives = 208/305 (68%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA   ETR  L   H +P     I+ LSTKGDRIT+R+L EIGG
Sbjct: 22  MQTKPFRIGTRGSPLALAQTHETRDRLAAAHGLPVEMFEIVTLSTKGDRITDRSLAEIGG 81

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E++L+SG++D AVHS+KDM TKL  GL +SA+LPRED+RD F+  +A  L +
Sbjct: 82  KGLFTEELEQQLLSGDLDFAVHSSKDMTTKLPDGLFLSAFLPREDVRDAFVGRSATRLAE 141

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R D++VI +RG++ETRL KL   +    LLAYAG++RL 
Sbjct: 142 LPQGATVGSSSLRRQALIRRLRPDVNVITYRGQVETRLRKLAEGQVDGTLLAYAGLRRLG 201

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V  E+L+ E FPP+P QGAICIE  + + +   L+  ++   T ++V+CER FLA L
Sbjct: 202 MAHVPTELLDPESFPPAPAQGAICIEARLGDDRINALLSAVDDPRTHEAVSCERGFLATL 261

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG+A   G+ + F G++L  DG   H +  +G   DA  +GR+A + IR  +
Sbjct: 262 DGSCRTPIAGYAQSDGARIRFSGMILTPDGTTCHRIETDGRTADAAALGREAGERIRAKA 321

Query: 301 NKNVF 305
               F
Sbjct: 322 GPEFF 326


>gi|153008310|ref|YP_001369525.1| porphobilinogen deaminase [Ochrobactrum anthropi ATCC 49188]
 gi|166217778|sp|A6WXJ2|HEM3_OCHA4 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|151560198|gb|ABS13696.1| porphobilinogen deaminase [Ochrobactrum anthropi ATCC 49188]
          Length = 314

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 150/301 (49%), Positives = 196/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ETR  LM+ H +P   I IIP+ST GDRI +R L+EIGGKGLFT
Sbjct: 11  LKIGTRGSKLALAQAYETRRRLMEAHGLPEEAIEIIPMSTAGDRIQDRALSEIGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L  GL +S +L RED RD FI  TA  L DL   +
Sbjct: 71  EEIEQALTDGRIDLAVHSTKDMPTVLPDGLHLSVFLEREDPRDAFIGRTASRLLDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ FRG ++TRL KL   +     LA AG++RL    VI
Sbjct: 131 TVGSSSLRRQALIRRLRPDIQVVIFRGNVDTRLRKLEAGEVDGTFLACAGLRRLGLGDVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++ + E FPP+PGQGAI IET + + +   L+  + H +T  ++ CERAFLA LDGSC+
Sbjct: 191 TDLADPESFPPAPGQGAIGIETRIGDTRIDTLLAPLAHRETGIALACERAFLAALDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A   G T+ F+G++L  DG   HE+   G   +A  IG +AA+++R  +    F
Sbjct: 251 TPIAGLATVNGDTVSFHGMILKPDGSEAHEIKTEGPASNAAAIGTEAAEHLRAKAGPQFF 310

Query: 306 N 306
            
Sbjct: 311 E 311


>gi|110635531|ref|YP_675739.1| porphobilinogen deaminase [Mesorhizobium sp. BNC1]
 gi|110286515|gb|ABG64574.1| hydroxymethylbilane synthase [Chelativorans sp. BNC1]
          Length = 309

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 153/306 (50%), Positives = 203/306 (66%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    +IGTR S LALA A ETR+ LM  H +P     I+ + T GDRI +R L+E GG
Sbjct: 1   MQTDVIKIGTRGSALALAQAAETRARLMVAHGLPEDAFEIVVIRTSGDRIQDRPLSEAGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+ G ID AVHS+KDMPT L  GL++SA+L RED+RDVFI   A+ L+D
Sbjct: 61  KGLFTKEIEEALLEGRIDLAVHSSKDMPTFLPDGLELSAFLEREDVRDVFIGRAAKRLED 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+AL LR R D+ V  FRG ++TRL KL +  A   LLA AG+KRLK
Sbjct: 121 LPHGANLGTSSLRRQALALRLRPDLKVGVFRGNVQTRLRKLEDGAADGTLLALAGLKRLK 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V  E+++   FPP+ GQGAICIE+   + +  +LV+ I+H  T  +++CERAFLA L
Sbjct: 181 LEHVATELMDPVIFPPALGQGAICIESRTGDTRIAKLVEAIHHPATGFALSCERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ +AG A   G  + F G++L  DG+  HE+  +G   DA  IGRDA + IR  +
Sbjct: 241 DGSCRTPMAGLATVDGDRIAFSGMILTPDGREVHEIGGDGAAQDAAEIGRDAGRRIRQKA 300

Query: 301 NKNVFN 306
               F 
Sbjct: 301 GAGFFE 306


>gi|319780787|ref|YP_004140263.1| porphobilinogen deaminase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166675|gb|ADV10213.1| porphobilinogen deaminase [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 308

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 141/301 (46%), Positives = 206/301 (68%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR SPLALA A ET++ LM  H +P     ++ +ST GDRI +R L+E GGKGLFT
Sbjct: 5   LRIGTRGSPLALAQAHETQARLMAAHGMPAEAFEVVVISTSGDRIQDRPLSEAGGKGLFT 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L++G ID AVHS+KDMPT+L  GL++SA+LPRED RD F+   A+++ +L   +
Sbjct: 65  KEIEEALLAGRIDIAVHSSKDMPTQLPDGLELSAFLPREDARDAFVGKVAKAIAELPRGA 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R D+ V+ FRG ++TRL KL    A   +LAYAG+KRL  E V+
Sbjct: 125 KVGSSSLRRQALIRRMRPDLDVVMFRGNVQTRLRKLEEGVAAGTILAYAGLKRLGLEHVV 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            +++ ++ FPP+PGQGAI IET + +   ++++  ++   T  ++ CERAFLA LDGSC+
Sbjct: 185 TDLIPLDVFPPAPGQGAIGIETRIGDRDVEKMLAAVHDVPTGQALACERAFLAALDGSCR 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG+A  +   L F G++++ DG   H V   G+  DA  IG +AA+ +R  + +  F
Sbjct: 245 TPIAGYAAIEAGKLSFAGLIISPDGTQSHTVELQGSAQDAARIGGEAARSVRARAGEKFF 304

Query: 306 N 306
           +
Sbjct: 305 D 305


>gi|239833011|ref|ZP_04681340.1| porphobilinogen deaminase [Ochrobactrum intermedium LMG 3301]
 gi|239825278|gb|EEQ96846.1| porphobilinogen deaminase [Ochrobactrum intermedium LMG 3301]
          Length = 314

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 149/301 (49%), Positives = 195/301 (64%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ETR  LM+ H +P   I I+P+ST GDRI +R L+EIGGKGLFT
Sbjct: 11  LKIGTRGSKLALAQAYETRRRLMEAHGLPEEAIEIVPMSTAGDRIQDRALSEIGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L  GL +S +L RED RD FI  TA  L DL   +
Sbjct: 71  EEIEQALTDGRIDLAVHSTKDMPTVLPDGLHLSVFLEREDPRDAFIGRTASRLLDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ FRG ++TRL KL   +     LA AG++RL    VI
Sbjct: 131 TVGSSSLRRQALIRRLRPDIQVVIFRGNVDTRLRKLEAGEVDGTFLACAGLRRLGLGDVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E+++ E F P+PGQGAI IET + + +   L+  + H +T  ++ CERAFLA LDGSC+
Sbjct: 191 TELVDPESFLPAPGQGAIGIETRIGDTRIDALLAPLAHRETGIALACERAFLAALDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A   G  + F+G++L  DG   HE+   G   +A  +GR+AA+ IR  +    F
Sbjct: 251 TPIAGLATVDGDRVSFHGMILKPDGSEAHEIRAEGPVSNAAALGREAAERIRAKAGPQFF 310

Query: 306 N 306
            
Sbjct: 311 E 311


>gi|13473577|ref|NP_105145.1| porphobilinogen deaminase [Mesorhizobium loti MAFF303099]
 gi|23821698|sp|Q98EI7|HEM3_RHILO RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|14024327|dbj|BAB50931.1| hydroxymethylbilane synthase [Mesorhizobium loti MAFF303099]
          Length = 308

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 204/301 (67%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR SPLALA A ET++ LM  H +P     ++ +ST GDRI +R L+E GGKGLFT
Sbjct: 5   LKIGTRGSPLALAQAHETQARLMAAHGLPAEAFEVVVISTSGDRIQDRPLSEAGGKGLFT 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L++G ID AVHS+KDMPT+L  GL++SA+LPRED RD F+   A+++ DL   +
Sbjct: 65  KEIEEALLAGAIDIAVHSSKDMPTQLPDGLELSAFLPREDARDAFVGKAAKTIADLLRGA 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R D+ V+ FRG ++TRL KL+   A   +LAYAG+KRL  E V 
Sbjct: 125 KVGSSSLRRQALIRRMRPDLDVVMFRGNVQTRLRKLDEGVAAGTILAYAGLKRLGLEHVA 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            +++ ++ FPP+PGQGAI IET + +   ++++  I+   T  ++ CERAFLA LDGSC+
Sbjct: 185 TDLMPLDIFPPAPGQGAIGIETRIGDRAVEKMLVAIHDVPTGQALACERAFLAALDGSCR 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +   L F G++++ DG   H V   G   DA  IG +AA+ +R  + +  F
Sbjct: 245 TPIAGHATIETGNLSFAGLIISPDGTQSHTVELQGPAQDAARIGDEAARTVRAKAGEKFF 304

Query: 306 N 306
           +
Sbjct: 305 D 305


>gi|254502424|ref|ZP_05114575.1| porphobilinogen deaminase [Labrenzia alexandrii DFL-11]
 gi|222438495|gb|EEE45174.1| porphobilinogen deaminase [Labrenzia alexandrii DFL-11]
          Length = 308

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 142/297 (47%), Positives = 199/297 (67%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+  P RIGTR S LALA A ETR+ LM  H +P     I+ + T GD+I +R L+E+GG
Sbjct: 1   MQSNPLRIGTRGSALALAQAHETRARLMAAHDLPEDAFEIVVIKTSGDQIQDRPLSEVGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ ++ G ID AVHS+KDMPT L  GL ++A+LPRED+RD F+S  A++L D
Sbjct: 61  KGLFTKEIEEAMLDGRIDLAVHSSKDMPTVLPDGLALTAFLPREDVRDAFLSPKAKTLMD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G+SSLRR+A++ R R DI V+ +RG ++TRL KL   +  A LLAYAG++RL 
Sbjct: 121 LPHGAVVGSSSLRRQAMIKRLRPDIEVVMYRGNLQTRLRKLAEGEVDATLLAYAGLRRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ +  +L  EDF P+ GQGAICIE+   + +  E+++ I+  +T   ++ ERAFLA L
Sbjct: 181 LEEEVTSLLETEDFLPAVGQGAICIESREGDERTLEMLQAIHDRETQIRLDAERAFLAVL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           DGSC++ I G A   G  L   G VL  DG   H+  R+G   DA+ IG+ A + ++
Sbjct: 241 DGSCRTPIGGLALLNGDELTLKGTVLKPDGSEVHDEVRSGGAVDAVQIGQAAGEALK 297


>gi|260464233|ref|ZP_05812426.1| porphobilinogen deaminase [Mesorhizobium opportunistum WSM2075]
 gi|259030036|gb|EEW31319.1| porphobilinogen deaminase [Mesorhizobium opportunistum WSM2075]
          Length = 308

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 138/301 (45%), Positives = 205/301 (68%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR SPLALA A ET++ LM  H +P     ++ +ST GDRI +R L+E GGKGLFT
Sbjct: 5   LKIGTRGSPLALAQAHETQARLMAAHGMPAEAFEVVVISTSGDRIQDRPLSEAGGKGLFT 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L++G ID AVHS+KDMPT+L  GL++SA+L RED RD ++    +++ DL   +
Sbjct: 65  KEIEEALLAGAIDIAVHSSKDMPTQLPDGLELSAFLSREDARDAYVGKATKTIADLPRGA 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R D+ V+ FRG ++TRL KL+   A   +LAYAG+KRL  + V+
Sbjct: 125 KVGSSSLRRQALIRRMRPDLDVVMFRGNVQTRLRKLDEGVAAGTILAYAGLKRLGLDHVV 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            +++ ++ FPP+PGQGAI IET + +   ++++  I+   T  ++ CERAFLA LDGSC+
Sbjct: 185 TDLIPLDVFPPAPGQGAIGIETRIGDRAVEKMLVAIHDVPTGQALACERAFLAALDGSCR 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG+A  +G  L F G++++ DG   H +   G   DA  IG +AA+ +R  + +  F
Sbjct: 245 TPIAGYAAIEGGKLSFAGLIISPDGTQSHTIDLQGPAQDAALIGTEAARTVRAKAGEKFF 304

Query: 306 N 306
           +
Sbjct: 305 D 305


>gi|306844857|ref|ZP_07477440.1| porphobilinogen deaminase [Brucella sp. BO1]
 gi|306274789|gb|EFM56570.1| porphobilinogen deaminase [Brucella sp. BO1]
          Length = 314

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 11  LKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 71  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 131 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 191 TDLLDPSVFPPAPGQGAIGIESRIGDERIDALLAPLAHRETQIALACERAFLGSLDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 251 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGAVSDAAALGTDAANRVRAMAGPHFF 310

Query: 306 N 306
           +
Sbjct: 311 D 311


>gi|62290744|ref|YP_222537.1| porphobilinogen deaminase [Brucella abortus bv. 1 str. 9-941]
 gi|82700655|ref|YP_415229.1| porphobilinogen deaminase [Brucella melitensis biovar Abortus 2308]
 gi|189024957|ref|YP_001935725.1| porphobilinogen deaminase [Brucella abortus S19]
 gi|225853324|ref|YP_002733557.1| porphobilinogen deaminase [Brucella melitensis ATCC 23457]
 gi|254690032|ref|ZP_05153286.1| porphobilinogen deaminase [Brucella abortus bv. 6 str. 870]
 gi|254694521|ref|ZP_05156349.1| porphobilinogen deaminase [Brucella abortus bv. 3 str. Tulya]
 gi|254696146|ref|ZP_05157974.1| porphobilinogen deaminase [Brucella abortus bv. 2 str. 86/8/59]
 gi|254731064|ref|ZP_05189642.1| porphobilinogen deaminase [Brucella abortus bv. 4 str. 292]
 gi|256045496|ref|ZP_05448379.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112222|ref|ZP_05453143.1| porphobilinogen deaminase [Brucella melitensis bv. 3 str. Ether]
 gi|256258286|ref|ZP_05463822.1| porphobilinogen deaminase [Brucella abortus bv. 9 str. C68]
 gi|256263189|ref|ZP_05465721.1| porphobilinogen deaminase [Brucella melitensis bv. 2 str. 63/9]
 gi|260546007|ref|ZP_05821747.1| porphobilinogen deaminase [Brucella abortus NCTC 8038]
 gi|260562805|ref|ZP_05833291.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. 16M]
 gi|260755568|ref|ZP_05867916.1| porphobilinogen deaminase [Brucella abortus bv. 6 str. 870]
 gi|260758791|ref|ZP_05871139.1| porphobilinogen deaminase [Brucella abortus bv. 4 str. 292]
 gi|260760515|ref|ZP_05872858.1| porphobilinogen deaminase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884592|ref|ZP_05896206.1| porphobilinogen deaminase [Brucella abortus bv. 9 str. C68]
 gi|261214839|ref|ZP_05929120.1| porphobilinogen deaminase [Brucella abortus bv. 3 str. Tulya]
 gi|265991918|ref|ZP_06104475.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993649|ref|ZP_06106206.1| porphobilinogen deaminase [Brucella melitensis bv. 3 str. Ether]
 gi|297247130|ref|ZP_06930848.1| porphobilinogen deaminase [Brucella abortus bv. 5 str. B3196]
 gi|23821695|sp|Q8YJB0|HEM3_BRUME RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|75496218|sp|Q57B08|HEM3_BRUAB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123768401|sp|Q2YLM5|HEM3_BRUA2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238058730|sp|B2S842|HEM3_BRUA1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800235|sp|C0RFD1|HEM3_BRUMB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|62196876|gb|AAX75176.1| HemC, porphobilinogen deaminase [Brucella abortus bv. 1 str. 9-941]
 gi|82616756|emb|CAJ11843.1| Porphobilinogen deaminase [Brucella melitensis biovar Abortus 2308]
 gi|189020529|gb|ACD73251.1| Porphobilinogen deaminase [Brucella abortus S19]
 gi|225641689|gb|ACO01603.1| porphobilinogen deaminase [Brucella melitensis ATCC 23457]
 gi|260096114|gb|EEW79990.1| porphobilinogen deaminase [Brucella abortus NCTC 8038]
 gi|260152821|gb|EEW87913.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. 16M]
 gi|260669109|gb|EEX56049.1| porphobilinogen deaminase [Brucella abortus bv. 4 str. 292]
 gi|260670947|gb|EEX57768.1| porphobilinogen deaminase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675676|gb|EEX62497.1| porphobilinogen deaminase [Brucella abortus bv. 6 str. 870]
 gi|260874120|gb|EEX81189.1| porphobilinogen deaminase [Brucella abortus bv. 9 str. C68]
 gi|260916446|gb|EEX83307.1| porphobilinogen deaminase [Brucella abortus bv. 3 str. Tulya]
 gi|262764630|gb|EEZ10551.1| porphobilinogen deaminase [Brucella melitensis bv. 3 str. Ether]
 gi|263002984|gb|EEZ15277.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093111|gb|EEZ17246.1| porphobilinogen deaminase [Brucella melitensis bv. 2 str. 63/9]
 gi|297174299|gb|EFH33646.1| porphobilinogen deaminase [Brucella abortus bv. 5 str. B3196]
 gi|326539601|gb|ADZ87816.1| porphobilinogen deaminase [Brucella melitensis M5-90]
          Length = 314

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 11  LKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 71  EEIEQALKDGRIDIAVHSTKDMPTALPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 131 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 191 TDVLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 251 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGPHFF 310

Query: 306 N 306
           +
Sbjct: 311 D 311


>gi|306842959|ref|ZP_07475593.1| porphobilinogen deaminase [Brucella sp. BO2]
 gi|306286887|gb|EFM58412.1| porphobilinogen deaminase [Brucella sp. BO2]
          Length = 314

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 11  LKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 71  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 131 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 191 TDLLDPSVFPPAPGQGAIGIESRIGDERIDALLAPLAHRETQIALACERAFLGALDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 251 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGPHFF 310

Query: 306 N 306
           +
Sbjct: 311 D 311


>gi|254713697|ref|ZP_05175508.1| porphobilinogen deaminase [Brucella ceti M644/93/1]
 gi|254715953|ref|ZP_05177764.1| porphobilinogen deaminase [Brucella ceti M13/05/1]
 gi|261217716|ref|ZP_05931997.1| porphobilinogen deaminase [Brucella ceti M13/05/1]
 gi|261321437|ref|ZP_05960634.1| porphobilinogen deaminase [Brucella ceti M644/93/1]
 gi|260922805|gb|EEX89373.1| porphobilinogen deaminase [Brucella ceti M13/05/1]
 gi|261294127|gb|EEX97623.1| porphobilinogen deaminase [Brucella ceti M644/93/1]
          Length = 314

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 11  LKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 71  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 131 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 191 TDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 251 TPIAGLATVEGDRLSFQGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGPHFF 310

Query: 306 N 306
           +
Sbjct: 311 D 311


>gi|294851125|ref|ZP_06791798.1| porphobilinogen deaminase [Brucella sp. NVSL 07-0026]
 gi|294819714|gb|EFG36713.1| porphobilinogen deaminase [Brucella sp. NVSL 07-0026]
          Length = 314

 Score =  292 bits (747), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 11  LKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 71  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 131 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 191 TDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 251 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGSHFF 310

Query: 306 N 306
           +
Sbjct: 311 D 311


>gi|148559606|ref|YP_001259712.1| porphobilinogen deaminase [Brucella ovis ATCC 25840]
 gi|166201494|sp|A5VSL5|HEM3_BRUO2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|148370863|gb|ABQ60842.1| porphobilinogen deaminase [Brucella ovis ATCC 25840]
          Length = 304

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 1   MKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 61  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 121 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 181 TDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCR 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 241 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGPHFF 300

Query: 306 N 306
           +
Sbjct: 301 D 301


>gi|23502739|ref|NP_698866.1| porphobilinogen deaminase [Brucella suis 1330]
 gi|161619804|ref|YP_001593691.1| porphobilinogen deaminase [Brucella canis ATCC 23365]
 gi|163843911|ref|YP_001628315.1| porphobilinogen deaminase [Brucella suis ATCC 23445]
 gi|254704902|ref|ZP_05166730.1| porphobilinogen deaminase [Brucella suis bv. 3 str. 686]
 gi|254707583|ref|ZP_05169411.1| porphobilinogen deaminase [Brucella pinnipedialis M163/99/10]
 gi|254708880|ref|ZP_05170691.1| porphobilinogen deaminase [Brucella pinnipedialis B2/94]
 gi|256030406|ref|ZP_05444020.1| porphobilinogen deaminase [Brucella pinnipedialis M292/94/1]
 gi|256059864|ref|ZP_05450051.1| porphobilinogen deaminase [Brucella neotomae 5K33]
 gi|256158389|ref|ZP_05456287.1| porphobilinogen deaminase [Brucella ceti M490/95/1]
 gi|256253808|ref|ZP_05459344.1| porphobilinogen deaminase [Brucella ceti B1/94]
 gi|256370288|ref|YP_003107799.1| porphobilinogen deaminase [Brucella microti CCM 4915]
 gi|260169315|ref|ZP_05756126.1| porphobilinogen deaminase [Brucella sp. F5/99]
 gi|260567624|ref|ZP_05838094.1| porphobilinogen deaminase [Brucella suis bv. 4 str. 40]
 gi|261220941|ref|ZP_05935222.1| porphobilinogen deaminase [Brucella ceti B1/94]
 gi|261315070|ref|ZP_05954267.1| porphobilinogen deaminase [Brucella pinnipedialis M163/99/10]
 gi|261316373|ref|ZP_05955570.1| porphobilinogen deaminase [Brucella pinnipedialis B2/94]
 gi|261323834|ref|ZP_05963031.1| porphobilinogen deaminase [Brucella neotomae 5K33]
 gi|261755596|ref|ZP_05999305.1| porphobilinogen deaminase [Brucella suis bv. 3 str. 686]
 gi|261758828|ref|ZP_06002537.1| porphobilinogen deaminase [Brucella sp. F5/99]
 gi|265987445|ref|ZP_06100002.1| porphobilinogen deaminase [Brucella pinnipedialis M292/94/1]
 gi|265996901|ref|ZP_06109458.1| porphobilinogen deaminase [Brucella ceti M490/95/1]
 gi|38258150|sp|Q8FYI6|HEM3_BRUSU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189042875|sp|A9M8M2|HEM3_BRUC2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189042876|sp|B0CID9|HEM3_BRUSI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|23348756|gb|AAN30781.1| porphobilinogen deaminase [Brucella suis 1330]
 gi|161336615|gb|ABX62920.1| porphobilinogen deaminase [Brucella canis ATCC 23365]
 gi|163674634|gb|ABY38745.1| porphobilinogen deaminase [Brucella suis ATCC 23445]
 gi|256000451|gb|ACU48850.1| porphobilinogen deaminase [Brucella microti CCM 4915]
 gi|260157142|gb|EEW92222.1| porphobilinogen deaminase [Brucella suis bv. 4 str. 40]
 gi|260919525|gb|EEX86178.1| porphobilinogen deaminase [Brucella ceti B1/94]
 gi|261295596|gb|EEX99092.1| porphobilinogen deaminase [Brucella pinnipedialis B2/94]
 gi|261299814|gb|EEY03311.1| porphobilinogen deaminase [Brucella neotomae 5K33]
 gi|261304096|gb|EEY07593.1| porphobilinogen deaminase [Brucella pinnipedialis M163/99/10]
 gi|261738812|gb|EEY26808.1| porphobilinogen deaminase [Brucella sp. F5/99]
 gi|261745349|gb|EEY33275.1| porphobilinogen deaminase [Brucella suis bv. 3 str. 686]
 gi|262551369|gb|EEZ07359.1| porphobilinogen deaminase [Brucella ceti M490/95/1]
 gi|264659642|gb|EEZ29903.1| porphobilinogen deaminase [Brucella pinnipedialis M292/94/1]
          Length = 314

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 11  LKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 71  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 131 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 191 TDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 251 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGPHFF 310

Query: 306 N 306
           +
Sbjct: 311 D 311


>gi|17986460|ref|NP_539094.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. 16M]
 gi|237816250|ref|ZP_04595243.1| porphobilinogen deaminase [Brucella abortus str. 2308 A]
 gi|17982057|gb|AAL51358.1| porphobilinogen deaminase [Brucella melitensis bv. 1 str. 16M]
 gi|237788317|gb|EEP62532.1| porphobilinogen deaminase [Brucella abortus str. 2308 A]
          Length = 342

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 39  LKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 98

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 99  EEIEQALKDGRIDIAVHSTKDMPTALPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 158

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 159 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 218

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 219 TDVLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCR 278

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 279 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGPHFF 338

Query: 306 N 306
           +
Sbjct: 339 D 339


>gi|254717954|ref|ZP_05179765.1| porphobilinogen deaminase [Brucella sp. 83/13]
 gi|265982897|ref|ZP_06095632.1| porphobilinogen deaminase [Brucella sp. 83/13]
 gi|306838958|ref|ZP_07471782.1| porphobilinogen deaminase [Brucella sp. NF 2653]
 gi|264661489|gb|EEZ31750.1| porphobilinogen deaminase [Brucella sp. 83/13]
 gi|306405961|gb|EFM62216.1| porphobilinogen deaminase [Brucella sp. NF 2653]
          Length = 314

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 11  LKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 71  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 131 IVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVGGTFLACAGLRRLGLADVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 191 TDLLDPSVFPPAPGQGAIGIESRIGDERIDALLAPLAHRETQIALACERAFLGALDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+      DA  +G DAA  +R ++  + F
Sbjct: 251 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEEAVSDAAALGTDAANRVRAMAGPHFF 310

Query: 306 N 306
           +
Sbjct: 311 D 311


>gi|118592006|ref|ZP_01549400.1| porphobilinogen deaminase [Stappia aggregata IAM 12614]
 gi|118435302|gb|EAV41949.1| porphobilinogen deaminase [Stappia aggregata IAM 12614]
          Length = 303

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 143/292 (48%), Positives = 194/292 (66%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LALA A ETR  LM  H +   +  I+ + T GDRI +R L+E+GGKGLFT
Sbjct: 1   MRIGTRGSALALAQAHETRDRLMAAHGLAEDSFEIVVIKTSGDRIQDRPLSEVGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G ID AVHS+KDMPT L  GL ++A+LPRED+RD F+S  A++L DL   +
Sbjct: 61  KEIEEALLDGRIDLAVHSSKDMPTVLPDGLALTAFLPREDVRDAFLSPKAKTLTDLPHGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+G+SSLRR+A++ R R DI V+ +RG ++TRL KL      A LLA AG++RL  E  I
Sbjct: 121 VVGSSSLRRQAMIKRLRPDIEVVMYRGNLQTRLRKLAEGAVDATLLAAAGLRRLGLEAEI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L  + F P+ GQGAICIE+  ++    E++  I+ E T   ++ ERAFLA LDGSC+
Sbjct: 181 TSLLETDQFLPAVGQGAICIESRADDTATLEMLAAIHDEATQIRLDAERAFLAVLDGSCR 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           + I G A   G TL+F GIVL  DG   HE + +G + DA+ IGR   + ++
Sbjct: 241 TPIGGLATLDGDTLHFRGIVLKPDGSEVHEATASGLKSDAVQIGRSVGEDLK 292


>gi|254700531|ref|ZP_05162359.1| porphobilinogen deaminase [Brucella suis bv. 5 str. 513]
 gi|261751035|ref|ZP_05994744.1| porphobilinogen deaminase [Brucella suis bv. 5 str. 513]
 gi|261740788|gb|EEY28714.1| porphobilinogen deaminase [Brucella suis bv. 5 str. 513]
          Length = 314

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 196/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IG R S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 11  LKIGARGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 71  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 131 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 191 TDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCR 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 251 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGPHFF 310

Query: 306 N 306
           +
Sbjct: 311 D 311


>gi|225628089|ref|ZP_03786124.1| porphobilinogen deaminase [Brucella ceti str. Cudo]
 gi|225616914|gb|EEH13961.1| porphobilinogen deaminase [Brucella ceti str. Cudo]
          Length = 342

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 143/301 (47%), Positives = 197/301 (65%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LALA A+ TR  L + H +P   I I+P+ST GDRI +R L+E+GGKGLFT
Sbjct: 39  LKIGTRGSKLALAQAYLTRRLLQEAHGLPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFT 98

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           EEIE+ L  G ID AVHS KDMPT L +GL +S +L RED RD FI  +A+   DL   +
Sbjct: 99  EEIEQALKDGRIDIAVHSTKDMPTVLPEGLHLSVFLEREDPRDAFIGRSARRFMDLPQGA 158

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+AL+ R R DI V+ +RG ++TRL KL+  +     LA AG++RL    VI
Sbjct: 159 TVGSSSLRRQALIRRLRPDIEVVMYRGNVDTRLRKLDAGEVDGTFLACAGLRRLGLADVI 218

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L+   FPP+PGQGAI IE+ + + +   L+  + H +T  ++ CERAFL  LDGSC+
Sbjct: 219 TDLLDPSVFPPAPGQGAIGIESRIGDERIDVLLAPLAHRETQIALACERAFLGALDGSCR 278

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G  L F G++L  DG+  HEV+  G   DA  +G DAA  +R ++  + F
Sbjct: 279 TPIAGLATVEGDRLSFRGMILTPDGRQAHEVTAEGVVSDAAALGTDAANRVRAMAGPHFF 338

Query: 306 N 306
           +
Sbjct: 339 D 339


>gi|307942602|ref|ZP_07657950.1| porphobilinogen deaminase [Roseibium sp. TrichSKD4]
 gi|307774241|gb|EFO33454.1| porphobilinogen deaminase [Roseibium sp. TrichSKD4]
          Length = 307

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 197/306 (64%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    RIGTR S LALA A ETR  LM  H +P     I+ + T GD+I +R L+E+GG
Sbjct: 1   MQSTLLRIGTRGSQLALAQAHETRDRLMAAHGLPEDAFEIVVVKTSGDQIQDRPLSEVGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE  L+ G +D AVHS+KDMPT L  GL I+A+LPRED+RD FIS  A++L+D
Sbjct: 61  KGLFTKEIEDMLLDGSLDLAVHSSKDMPTVLPAGLDITAFLPREDVRDAFISPKAKTLRD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G+SSLRR+A++ R R DI V+ +RG ++TRL KL+     A LLA+AG+KRL 
Sbjct: 121 LPHGAVVGSSSLRRQAMVKRLRPDIDVVMYRGNVQTRLRKLDEGVVDATLLAHAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V+  ++  +DF P+ GQGAIC+E+ +++ K   L+  IN  +T   +  ERAFL  L
Sbjct: 181 LGDVVTSVIEADDFVPAVGQGAICLESRLDDEKTNGLLSAINDPETRVRLEAERAFLGVL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DG+C++ I G A   G TL   G++L  DG   HEV  +G+  DA  IG  A + ++  +
Sbjct: 241 DGTCRTPIGGLATVDGDTLTLKGVILKPDGSQMHEVEHSGSVQDAEAIGLAAGEELKSKA 300

Query: 301 NKNVFN 306
             N   
Sbjct: 301 GPNFLT 306


>gi|328541997|ref|YP_004302106.1| Porphobilinogen deaminase [polymorphum gilvum SL003B-26A1]
 gi|326411747|gb|ADZ68810.1| Porphobilinogen deaminase [Polymorphum gilvum SL003B-26A1]
          Length = 302

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 143/300 (47%), Positives = 193/300 (64%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LALA A ETR+ LM  H +      I+ + T GDRI +R L+E+GGKGLFT
Sbjct: 1   MRIGTRGSALALAQAHETRARLMAAHGLAEDAFEIVVIKTSGDRILDRPLSEVGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+   ID AVHS+KDMPT L  GL ++A+LPRED+RD F+S  A+ L DL   +
Sbjct: 61  KEIEEALLDDRIDLAVHSSKDMPTLLPDGLALTAFLPREDVRDAFVSPKAKMLMDLPQGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+G+SSLRR+A++ R R DI V+ +RG ++TRL KL +    A LLAYAG++RL    V+
Sbjct: 121 VVGSSSLRRQAMIKRLRPDIEVVMYRGNVQTRLQKLEDGAVDATLLAYAGLRRLGLADVV 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L+ + F P+ GQGAICIE+ V +     L+  I+  +T   +  ERAFLAELDGSC+
Sbjct: 181 TSLLDTDAFLPAVGQGAICIESRVEDAATLGLLAAIHDRETEIRLTAERAFLAELDGSCR 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + I G A   G  L   GI+L  DG   HE++R G   DA  IGR+A + ++       F
Sbjct: 241 TPIGGLARIDGDRLSLAGIILRPDGSEAHEIAREGAVADAEAIGREAGRTLKAAGGPGFF 300


>gi|90421073|ref|ZP_01228976.1| porphobilinogen deaminase [Aurantimonas manganoxydans SI85-9A1]
 gi|90334708|gb|EAS48485.1| porphobilinogen deaminase [Aurantimonas manganoxydans SI85-9A1]
          Length = 311

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 190/307 (61%), Gaps = 1/307 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RIGTR S LA A A E R+ LM  H +P     I  +ST GDRI +R L+E+GG
Sbjct: 1   MASDIIRIGTRGSQLAKAQASEVRARLMAAHDLPEEAFEIEVISTTGDRILDRPLSEVGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE  LI G +D A HS+KDM T   +GL++SAYLPRED+RD FI  TA ++ +
Sbjct: 61  KGLFTKEIEAALIDGRVDIAAHSSKDMATASPEGLEVSAYLPREDVRDAFIGRTAATIDE 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IG++SLRR++LL R R D+ VI FRG +++RL KL   +  A LLA AG+ R+ 
Sbjct: 121 LPHGATIGSASLRRQSLLKRMRPDLKVITFRGNVQSRLRKLEEGQVDATLLALAGLNRMA 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            + V  EIL +E F P+PGQGAICI+  + + +   LV  I    T  ++  ERAFLAEL
Sbjct: 181 MQDVATEILEVERFLPAPGQGAICIQNRIGDERVHGLVAAIADPRTTVALTAERAFLAEL 240

Query: 241 DGSCKSAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           DGSC++ IA  A   +  T+  +G++L  DG   HE  R G   DA  +GR A + +   
Sbjct: 241 DGSCRTPIAAHAVLAEDGTVTLHGMILTPDGSRMHETRRTGIAADAEALGRLAGRDVLDA 300

Query: 300 SNKNVFN 306
           +    F+
Sbjct: 301 AGPGFFD 307


>gi|254473214|ref|ZP_05086612.1| porphobilinogen deaminase [Pseudovibrio sp. JE062]
 gi|211957935|gb|EEA93137.1| porphobilinogen deaminase [Pseudovibrio sp. JE062]
          Length = 307

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 136/307 (44%), Positives = 195/307 (63%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KP RIGTR S LALA A ETR+ L   H +   +  I+ + T GD+I +R L+E GG
Sbjct: 1   MQTKPIRIGTRGSALALAQAHETRARLAKAHGLTDDDFEIVVIKTTGDQIQDRPLSEAGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+   ID AVHS+KDMPT L  GL ++AYLPRED+RD FIS   + L D
Sbjct: 61  KGLFTKEIEEALLDKSIDLAVHSSKDMPTVLPDGLGMTAYLPREDVRDAFISPKVEKLTD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+G+SSLRR+A + R R D+ V+ +RG ++TRL KL+     A  LAYAG++RL 
Sbjct: 121 LPQGAVVGSSSLRRQAQIKRLRPDLDVVMYRGNLQTRLRKLDEGVVDATFLAYAGLRRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           +  ++  ++++E F P+ GQGAI IE  + + +   ++  I+H +T   +  ERA+LAE+
Sbjct: 181 QGDLVTSLMDLEHFLPAVGQGAIGIEARLGDEETARILAPIHHAETESRLLLERAYLAEM 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG ++ +G  + F G V+  DG   H V   G   DA  IGR+  + ++  S
Sbjct: 241 DGSCRTPIAGLSHVEGDRIKFRGEVIKPDGSQTHTVEGEGPVSDAEEIGRELGKELKAKS 300

Query: 301 NKNVFNF 307
             N    
Sbjct: 301 GPNFLEL 307


>gi|114705601|ref|ZP_01438504.1| porphobilinogen deaminase [Fulvimarina pelagi HTCC2506]
 gi|114538447|gb|EAU41568.1| porphobilinogen deaminase [Fulvimarina pelagi HTCC2506]
          Length = 316

 Score =  269 bits (687), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 195/302 (64%), Gaps = 1/302 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR SPLALA A E R+ L+  H +   +  I  +ST GDRI +R L+E+GGKGLFT
Sbjct: 8   IRIGTRGSPLALAQASEVRARLIAAHGLTEDDFAIEVISTSGDRILDRPLSEVGGKGLFT 67

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L+   ID AVHS+KDM T +  GL I+A+L RED+RD FI   A++L DL   +
Sbjct: 68  KEIEAALLDRRIDLAVHSSKDMATAIPDGLAITAFLEREDVRDAFIGRDAKTLADLPEGA 127

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G++SLRR+AL+ R R D++ I FRG ++TRL KL   +A A LLA AG+ R++ +   
Sbjct: 128 TVGSASLRRQALIKRLRPDLNTIIFRGNVQTRLRKLGEGQADATLLALAGLNRMEMQHHA 187

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            +IL  EDFPP+PGQGAICIE+   + + + LV  I H++T  +++ ERAFL  LDGSC+
Sbjct: 188 TDILEPEDFPPAPGQGAICIESRQGDTRIENLVSAIVHDETSIALHAERAFLKVLDGSCR 247

Query: 246 SAIAGFAYCKGST-LYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           + IA  A    S  + F+G++L  DG   HEV   G+   A+ +G  A + +   +  + 
Sbjct: 248 TPIAARAVLWDSGRIAFHGMILRPDGTEVHEVHDEGDADGAVALGERAGRSVLEAAGPHF 307

Query: 305 FN 306
           F+
Sbjct: 308 FD 309


>gi|326409887|gb|ADZ66952.1| Porphobilinogen deaminase [Brucella melitensis M28]
          Length = 277

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/274 (47%), Positives = 180/274 (65%)

Query: 33  IPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLL 92
           +P   I I+P+ST GDRI +R L+E+GGKGLFTEEIE+ L  G ID AVHS KDMPT L 
Sbjct: 1   MPEDAIEILPMSTAGDRIQDRPLSEVGGKGLFTEEIEQALKDGRIDIAVHSTKDMPTALP 60

Query: 93  KGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRG 152
           +GL +S +L RED RD FI  +A+   DL   + +G+SSLRR+AL+ R R DI V+ +RG
Sbjct: 61  EGLHLSVFLEREDPRDAFIGRSARRFMDLPQGATVGSSSLRRQALIRRLRPDIEVVMYRG 120

Query: 153 KIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNP 212
            ++TRL KL+  +     LA AG++RL    VI ++L+   FPP+PGQGAI IE+ + + 
Sbjct: 121 NVDTRLRKLDAGEVDGTFLACAGLRRLGLADVITDVLDPSVFPPAPGQGAIGIESRIGDE 180

Query: 213 KAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKI 272
           +   L+  + H +T  ++ CERAFL  LDGSC++ IAG A  +G  L F G++L  DG+ 
Sbjct: 181 RIDVLLAPLAHRETQIALACERAFLGALDGSCRTPIAGLATVEGDRLSFRGMILTPDGRQ 240

Query: 273 FHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
            HEV+  G   DA  +G DAA  +R ++  + F+
Sbjct: 241 AHEVTAEGVVSDAAALGTDAANRVRAMAGPHFFD 274


>gi|218509456|ref|ZP_03507334.1| porphobilinogen deaminase [Rhizobium etli Brasil 5]
          Length = 279

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 164/226 (72%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+ KPFRIGTR SPLALA A E R  LM  H +P     I+ LSTKGDRIT+R+L EIGG
Sbjct: 54  MQTKPFRIGTRGSPLALAQAHEARDRLMAAHHLPEEMFEIVVLSTKGDRITDRSLAEIGG 113

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFTEE+E+KL+SGE+D AVHSAKDMPT L  GL +SAYLPREDIRD  I  TA  L D
Sbjct: 114 KGLFTEELEQKLVSGELDFAVHSAKDMPTHLPDGLHLSAYLPREDIRDAVIGRTAPKLID 173

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +G+SSLRR+AL+ R R DI+VI FRG +ETRL KL   +  A LLA AG+KRL 
Sbjct: 174 LPHGATVGSSSLRRQALIRRMRPDINVIIFRGSVETRLRKLEEGQVDATLLALAGLKRLG 233

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDT 226
           K +V+ +IL+ + FPP+P QGAICIE+ + + +  +L+  +N   T
Sbjct: 234 KVEVLTDILDPDTFPPAPAQGAICIESRIGDTRIDDLLAAVNDAAT 279


>gi|21328661|gb|AAM48667.1| porphobilinogen deaminase [uncultured marine proteobacterium]
          Length = 316

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 130/268 (48%), Positives = 176/268 (65%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K P  IGTR SPLALA A+ETR+ L     +P     I+ + T GDR+T+R L EIGGKG
Sbjct: 9   KTPLNIGTRGSPLALAQAYETRARLAKAFDLPFEAFEIVVIMTTGDRVTDRPLKEIGGKG 68

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE+ ++ G ID AVHS KDMP     GL +  YLPRED+RD FIS +  +L DL+
Sbjct: 69  LFTREIEQAMLDGSIDIAVHSMKDMPVLQPDGLVLDTYLPREDVRDAFISLSGGALSDLS 128

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+A L   R D+ V++FRG ++TRL KL N  A A  LA AG+KRL  +
Sbjct: 129 PGAVVGTSSLRRQAQLKLRRPDLQVVEFRGNLQTRLKKLENQVAEATFLAMAGLKRLNMD 188

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           +V ++ + ++D  P+  QGAI IE  +N+ +  +++  I+  +T   +  ERAFLA LDG
Sbjct: 189 EVPRQAIEVDDMLPAVAQGAIGIERRINDGRMADMLAAIHDRETGQRLAAERAFLAALDG 248

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           SC++ IAG +  +GST+   G VL  DG
Sbjct: 249 SCETPIAGLSELQGSTMRLRGEVLRPDG 276


>gi|84516581|ref|ZP_01003940.1| porphobilinogen deaminase [Loktanella vestfoldensis SKA53]
 gi|84509617|gb|EAQ06075.1| porphobilinogen deaminase [Loktanella vestfoldensis SKA53]
          Length = 314

 Score =  258 bits (659), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 133/289 (46%), Positives = 175/289 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           PF IGTR SPLALA A ETR+ LM    +P     I+ +   GD I +R L +IGGKGLF
Sbjct: 11  PFNIGTRGSPLALAQAHETRARLMAAFDLPQDAFAIVVIKVMGDAIQDRALKDIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE  L+ G ID AVHS KDMP +   GL +  YLPRED+RD F+S TA+ L DL   
Sbjct: 71  TREIEDALLDGSIDIAVHSMKDMPVEQPSGLLLDTYLPREDVRDAFVSLTARGLDDLEHG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRR++ LL  R D++V++FRG ++TRL KL N  A A  LA AG+ RL    V
Sbjct: 131 ATVGTSSLRRRSQLLVRRPDLNVVEFRGNVQTRLMKLGNGVAEATFLAMAGLNRLNMTDV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  ED  P+  QGAI IE   ++ +A  +++ I+H  T   +  ER+FLA LDGSC
Sbjct: 191 PRTAIAPEDMLPAIAQGAIGIERRADDSRAAAMLEAIHHGPTGQRLAAERSFLAHLDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
           ++ I G A   G TL   G +L +DG         G   D  ++GR+ A
Sbjct: 251 QTPIGGLADLDGGTLRLRGEILRTDGSQVLADDMIGAIADGADMGREMA 299


>gi|163733941|ref|ZP_02141383.1| porphobilinogen deaminase [Roseobacter litoralis Och 149]
 gi|161393052|gb|EDQ17379.1| porphobilinogen deaminase [Roseobacter litoralis Och 149]
          Length = 314

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 181/303 (59%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLA+A AFETR+ LM    +P     I+ +   GD I +R L +IGGKGLF
Sbjct: 11  PLKIGTRGSPLAMAQAFETRARLMQAFDLPEDAFSIVVIKVTGDMIQDRALKDIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+S +ID AVHS KDMPT    GL +  YLPRED+RD F+S T   + DLA  
Sbjct: 71  TREIEEDLLSEKIDIAVHSMKDMPTLQPDGLVLDTYLPREDVRDAFVSPTLSGIADLAQG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GTSSLRRKA LL  R D++V++FRG ++TRL KL +  A    LA AG+ RLK ++V
Sbjct: 131 AVVGTSSLRRKAQLLNRRPDLNVVEFRGNVQTRLKKLADGVAECTFLASAGLNRLKMDEV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
               +  ++  P+  QGAI IE  + +    +L+  I+H +T   +  ER+FL  LDGSC
Sbjct: 191 PATPIEADEMLPAVAQGAIGIERRMADQNTADLLSAIHHIETGQRLTAERSFLLTLDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   G  L   G VL  DG       R+G   D   +GR  AQ +   +    
Sbjct: 251 ETPIAGLAELDGDQLRLRGEVLRPDGSESLAGERSGPIADGAEMGRILAQELLDRAGPKF 310

Query: 305 FNF 307
           F +
Sbjct: 311 FEW 313


>gi|159045244|ref|YP_001534038.1| porphobilinogen deaminase [Dinoroseobacter shibae DFL 12]
 gi|157913004|gb|ABV94437.1| porphobilinogen deaminase [Dinoroseobacter shibae DFL 12]
          Length = 347

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/303 (41%), Positives = 183/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR S LALA A ETR+ L     +P     I+ + T GDRI +R+L+EIGGKGLF
Sbjct: 40  PLKIGTRGSLLALAQAHETRARLSAAFDLPEEAFEIVVIKTTGDRIQDRSLSEIGGKGLF 99

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE  ++ G ID AVHS KDMP     GL +  YLPRED+RD F++    +L DL   
Sbjct: 100 TREIEDAMLDGSIDIAVHSMKDMPVDTPAGLALDTYLPREDVRDAFVTLDGGTLADLPEG 159

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+G+SSLRR+A L   R D+ +++FRG ++TR+ KL +  AHA  LA AG+ RL  ++V
Sbjct: 160 AVVGSSSLRRRAQLAHRRPDLQLVEFRGNVQTRMKKLGDGVAHATFLAMAGLNRLGMDEV 219

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  ED  P+  QG I IE   ++P+A E++  I+   +   + CERA+L+ LDGSC
Sbjct: 220 PRSAIAPEDMLPAVAQGCIGIERRADDPRAAEMLAAIHDGPSGHRLACERAYLSALDGSC 279

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   G +++    +L  DG      S      DA  +GR+ A+ +R  +    
Sbjct: 280 QTPIAGLAELDGGSIHLRAEILRPDGSEVLSDSETAPVEDAAKMGREVAERLRARAPDGF 339

Query: 305 FNF 307
           F++
Sbjct: 340 FSW 342


>gi|255262067|ref|ZP_05341409.1| porphobilinogen deaminase [Thalassiobium sp. R2A62]
 gi|255104402|gb|EET47076.1| porphobilinogen deaminase [Thalassiobium sp. R2A62]
          Length = 326

 Score =  256 bits (653), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 180/305 (59%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           + P  IGTR SPLALA A+ETR+ L     +P     I+ + T GDRI +R L EIGGKG
Sbjct: 21  QSPLNIGTRGSPLALAQAYETRARLSAAFDLPSEAFTIVVIKTTGDRIIDRPLKEIGGKG 80

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE  ++ G+ID AVHS KDMP     GL I  YLPRED RD FI+     LKDLA
Sbjct: 81  LFTREIEDAMLQGDIDIAVHSMKDMPVLQPDGLLIDTYLPREDNRDAFIALDGSGLKDLA 140

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR A L+  R D+++++FRG ++TRL KL +  A A  LA AG+ RLK +
Sbjct: 141 EGATVGTSSLRRHAQLMNRRPDLNIVEFRGNLQTRLKKLGDGVAEATFLAMAGLNRLKMD 200

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V +  +  +D  P+  QGAI IE   ++ +  E+++ I+   T   +  ERAFL  LDG
Sbjct: 201 DVPRTAIETDDMLPAVAQGAIGIERRADDSRMAEMLEAIHDGPTGQRLAAERAFLKALDG 260

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IAG A   G  LY  G VL  DG      + +G   D   +GR  A  +   + +
Sbjct: 261 SCETPIAGLAELNGGILYLRGEVLRVDGSDTVYDAASGPIEDGAEMGRVMAAKLLAEAGE 320

Query: 303 NVFNF 307
             F++
Sbjct: 321 GFFDW 325


>gi|110678608|ref|YP_681615.1| porphobilinogen deaminase [Roseobacter denitrificans OCh 114]
 gi|109454724|gb|ABG30929.1| porphobilinogen deaminase [Roseobacter denitrificans OCh 114]
          Length = 314

 Score =  254 bits (650), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 182/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLA+A AFETR+ LM    +P +   I+ +   GD I +R L +IGGKGLF
Sbjct: 11  PLKIGTRGSPLAMAQAFETRARLMQAFDLPENAFTIVVIKVTGDMIQDRALKDIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+S +ID AVHS KDMPT    GL +  YLPRED+RD FIS T + + DLA  
Sbjct: 71  TREIEEDLLSEKIDIAVHSMKDMPTLQPDGLILDTYLPREDVRDAFISPTLKGIADLAQG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GTSSLRRKA LL  R D++V++FRG ++TRL KL +  A    LA AG+ RLK ++V
Sbjct: 131 AVVGTSSLRRKAQLLNRRPDLNVVEFRGNVQTRLKKLADGVAECTFLACAGLSRLKMDEV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
               +  +   P+  QGAI IE  + +    EL+  I+   T   +  ER FL  LDGSC
Sbjct: 191 PATPIETDHMLPAVAQGAIGIERRIADTNTAELLSAIHDGPTGQRLAAERNFLLTLDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   G  L   G VL  DG       R+G   D   +GRD A+ +   +  + 
Sbjct: 251 ETPIAGLAELSGDHLRLRGEVLRPDGSEALNGERSGPISDGAAMGRDLAEKLLKRAGPSF 310

Query: 305 FNF 307
           F++
Sbjct: 311 FDW 313


>gi|332559141|ref|ZP_08413463.1| porphobilinogen deaminase [Rhodobacter sphaeroides WS8N]
 gi|332276853|gb|EGJ22168.1| porphobilinogen deaminase [Rhodobacter sphaeroides WS8N]
          Length = 310

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 185/304 (60%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGL
Sbjct: 6   EPLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGL 65

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE+ L+SG ID AVHS KDMPT   +GL +  YLPRED RD FI+     L DL  
Sbjct: 66  FTREIEEALLSGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITFADGGLADLPQ 125

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK ++
Sbjct: 126 GATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMDE 185

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V +  +  E+   +  QGAI IE   ++P+AQE++  I+   T   +  ER+FL +LDGS
Sbjct: 186 VPRVPIEPEEMLSAVAQGAIGIERRTDDPRAQEMLAAIHDVRTGHRLAAERSFLLKLDGS 245

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IAG A  +G  L+  G +L  DG         G   DA  +G + A  +   +  +
Sbjct: 246 CETPIAGLAILEGDQLWLRGEILRPDGSESISGEIRGAIADAAALGSELASELLGRAPAD 305

Query: 304 VFNF 307
            F++
Sbjct: 306 FFSW 309


>gi|221640136|ref|YP_002526398.1| porphobilinogen deaminase [Rhodobacter sphaeroides KD131]
 gi|221160917|gb|ACM01897.1| Porphobilinogen deaminase [Rhodobacter sphaeroides KD131]
          Length = 310

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 184/304 (60%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGL
Sbjct: 6   EPLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGL 65

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE+ L+SG ID AVHS KDMPT   +GL +  YLPRED RD FI+     L DL  
Sbjct: 66  FTREIEEALLSGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITFAEGGLADLPQ 125

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK  +
Sbjct: 126 GATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMNE 185

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V +  +  E+   +  QGAI IE   ++P+AQE++  I+   T   +  ER+FL +LDGS
Sbjct: 186 VPRVPIEPEEMLSAVAQGAIGIERRTDDPRAQEMLAAIHDVPTGHRLAAERSFLLKLDGS 245

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IAG A  +G  L+  G +L  DG         G   DA  +G + A  +   +  +
Sbjct: 246 CETPIAGLAILEGDQLWLRGEILRPDGSESISGEIRGAIADAAALGSELASELLGRAPAD 305

Query: 304 VFNF 307
            F++
Sbjct: 306 FFSW 309


>gi|149204076|ref|ZP_01881044.1| porphobilinogen deaminase [Roseovarius sp. TM1035]
 gi|149142518|gb|EDM30563.1| porphobilinogen deaminase [Roseovarius sp. TM1035]
          Length = 315

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/303 (43%), Positives = 184/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLALA AFETR+ L     +P     I+ + T GD+I +R L EIGGKGLF
Sbjct: 11  PLKIGTRGSPLALAQAFETRARLGAAFDLPEEAFEIVVIKTTGDQIIDRPLKEIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ +++G+ID AVHS KDMP    +GL +  YLPRED+RD F+S T  SL DL   
Sbjct: 71  TREIEQAMLTGDIDIAVHSMKDMPVLQPEGLLLDTYLPREDVRDAFVSPTVASLADLPAG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           S++GTSSLRRKA +L     + V++FRG ++TRL KL +  A    LA AG+ RL + +V
Sbjct: 131 SLVGTSSLRRKAQVLVAYPHLEVVEFRGNVQTRLKKLEDGVAACTFLAMAGLNRLGRSEV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
               ++ +   P+  QGAI IE   ++ +A E++  I+H++T   +  ERAFLA LDGSC
Sbjct: 191 ATCAIDADVMLPAVAQGAIGIERRADDTRAAEMLAAIHHKETGQRLVSERAFLAALDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   GSTL   G +L  DG       ++    D   +GR  A  +   +    
Sbjct: 251 ETPIAGLAELNGSTLRLRGEILRPDGSESLTDDQSAPIEDGAELGRAMAAKLLAQAGPGF 310

Query: 305 FNF 307
           F++
Sbjct: 311 FDW 313


>gi|77464252|ref|YP_353756.1| porphobilinogen deaminase [Rhodobacter sphaeroides 2.4.1]
 gi|77388670|gb|ABA79855.1| Porphobilinogen deaminase [Rhodobacter sphaeroides 2.4.1]
          Length = 314

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 184/304 (60%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGL
Sbjct: 10  EPLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGL 69

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE+ L+SG ID AVHS KDMPT   +GL +  YLPRED RD FI+     L DL  
Sbjct: 70  FTREIEEALLSGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITFAEGGLADLPQ 129

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK  +
Sbjct: 130 GATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMNE 189

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V +  +  E+   +  QGAI IE   ++P+AQE++  I+   T   +  ER+FL +LDGS
Sbjct: 190 VPRVPIESEEMLSAVAQGAIGIERRTDDPRAQEMLAAIHDVPTGHRLAAERSFLLKLDGS 249

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IAG A  +G  L+  G +L  DG         G   DA  +G + A  +   +  +
Sbjct: 250 CETPIAGLAILEGDQLWLRGEILRPDGSESISGEIRGAIADAAALGSELASELLGRAPAD 309

Query: 304 VFNF 307
            F++
Sbjct: 310 FFSW 313


>gi|126463094|ref|YP_001044208.1| porphobilinogen deaminase [Rhodobacter sphaeroides ATCC 17029]
 gi|126104758|gb|ABN77436.1| porphobilinogen deaminase [Rhodobacter sphaeroides ATCC 17029]
          Length = 322

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/304 (43%), Positives = 184/304 (60%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGL
Sbjct: 18  EPLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGL 77

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE+ L+SG ID AVHS KDMPT   +GL +  YLPRED RD FI+     L DL  
Sbjct: 78  FTREIEEALLSGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITFAEGGLADLPQ 137

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK  +
Sbjct: 138 GATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMNE 197

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V +  +  E+   +  QGAI IE   ++P+AQE++  I+   T   +  ER+FL +LDGS
Sbjct: 198 VPRVPIEPEEMLSAVAQGAIGIERRTDDPRAQEMLAAIHDVPTGHRLAAERSFLLKLDGS 257

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IAG A  +G  L+  G +L  DG         G   DA  +G + A  +   +  +
Sbjct: 258 CETPIAGLAILEGDQLWLRGEILRPDGSESISGEIRGAIADAAALGVELASELLGRAPAD 317

Query: 304 VFNF 307
            F++
Sbjct: 318 FFSW 321


>gi|85713686|ref|ZP_01044676.1| porphobilinogen deaminase [Nitrobacter sp. Nb-311A]
 gi|85699590|gb|EAQ37457.1| porphobilinogen deaminase [Nitrobacter sp. Nb-311A]
          Length = 316

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 177/272 (65%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           IGTR SPLALA A E R  L   H++ P  I I  + T GD I +R L ++GGKGLFT+E
Sbjct: 13  IGTRGSPLALAQAHEVRDRLARAHQVAPERIAIKTIRTSGDAIQDRPLFDVGGKGLFTKE 72

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L++G ID AVHS+KD+PT L     + A+LPRED+RDVFIS  A SL DL   S++
Sbjct: 73  IEEALLAGAIDFAVHSSKDVPTFLPDATWLPAFLPREDVRDVFISPRAASLHDLPAGSIV 132

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GT+SLRR+A++LR R D+ V   RG +ETRL K++  +A A LLA AG+ RL  +     
Sbjct: 133 GTASLRRQAMVLRLRPDLKVNALRGNVETRLRKIDAGEADATLLALAGLNRLGLQDKATR 192

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
           IL  E+F P+ GQGAI IE+  ++ +    VK I   +T  +++ ER+FLA LDGSC++ 
Sbjct: 193 ILETEEFLPAVGQGAIAIESRRDDDRINAFVKAIGDSETEVALSAERSFLALLDGSCRTP 252

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRN 279
           I G     G  ++F G++++ DG   +E +R 
Sbjct: 253 IGGHCRVNGDRIHFRGLIISPDGTESYETTRE 284


>gi|300024951|ref|YP_003757562.1| porphobilinogen deaminase [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526772|gb|ADJ25241.1| porphobilinogen deaminase [Hyphomicrobium denitrificans ATCC 51888]
          Length = 310

 Score =  253 bits (646), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/296 (46%), Positives = 181/296 (61%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+    RIGTR SPLALA A E R  L   H +    I I  + T GDR+T+R L++IGG
Sbjct: 1   MQAARIRIGTRGSPLALAQAHEVRDRLAKAHGLSEDAISITIIKTTGDRVTDRPLSDIGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE  L + EID AVHS KDM T+L  GL + A LPRED RD FIS    ++  
Sbjct: 61  KGLFTKEIEDALFAREIDIAVHSMKDMQTELPDGLALGAVLPREDPRDAFISLKHANISA 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRRK+ +L  R D+SVIDFRG +ETRL KL +  A A  LA AG+ RL 
Sbjct: 121 LPTGAIVGTSSLRRKSQVLSIRPDLSVIDFRGNVETRLRKLKDGIAEATFLAVAGLNRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I  I+   D  P+  QGAI +E    + +A+  V  +N  ++  +V  ERAFLA L
Sbjct: 181 LSDRITAIVPSADMLPAAAQGAIGLEIRTGDKEAEAFVAPLNDVNSQRAVTAERAFLARL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +GSC++ IA  A   G  L F G VL+ DG+  ++VSR+G    + +IG  AA  +
Sbjct: 241 EGSCRTPIAAHATIDGEQLSFRGQVLSLDGQQKYDVSRSGAANASRDIGLAAADEV 296


>gi|260425851|ref|ZP_05779830.1| porphobilinogen deaminase [Citreicella sp. SE45]
 gi|260420343|gb|EEX13594.1| porphobilinogen deaminase [Citreicella sp. SE45]
          Length = 319

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 136/308 (44%), Positives = 184/308 (59%), Gaps = 4/308 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIG 59
           +P RIGTR SPLALA A ETR  L D   + P    I+ + T GD       +R L EIG
Sbjct: 10  QPLRIGTRGSPLALAQAHETRDRLCDTFALSPEAFEIVVIRTTGDDRSMIAADRPLKEIG 69

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
            KGLFT+EIE++L++G ID AVHS KDMPT   +GL +  YLPRED+RD FIS     L 
Sbjct: 70  NKGLFTKEIEEQLMTGGIDIAVHSMKDMPTLQPEGLMLDCYLPREDVRDAFISPGHGGLG 129

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           DL   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A A  LA AG+ R+
Sbjct: 130 DLPAGTVVGTSSLRRRAQLLNRRPDLRVVEFRGNLQTRLKKLEDGVAAATFLAMAGLNRM 189

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
              ++    ++ ++  P+  QGAI IE   ++ +A E++  I+  DT   +  ERAFLAE
Sbjct: 190 GMTQLPMTAMSPDEMLPAVAQGAIGIERRSDDSRAAEMLAAIHDRDTALRLGAERAFLAE 249

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           LDGSC++ IAG A   G+ L   G +LA DG   H     G   +   +GR  AQ +   
Sbjct: 250 LDGSCETPIAGLAELDGTALRLRGELLAPDGSASHAGEIAGPADNGPELGRLLAQQLLAR 309

Query: 300 SNKNVFNF 307
           +  + F +
Sbjct: 310 AGADFFAW 317


>gi|146276603|ref|YP_001166762.1| porphobilinogen deaminase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554844|gb|ABP69457.1| porphobilinogen deaminase [Rhodobacter sphaeroides ATCC 17025]
          Length = 322

 Score =  252 bits (644), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 130/304 (42%), Positives = 184/304 (60%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P +IGTR SPLALA A+ETRS L     +P     I+ + T GD++ +R L EIGGKGL
Sbjct: 18  EPLKIGTRGSPLALAQAYETRSRLSAAFSLPEEAFEIVVIKTTGDKVLDRPLKEIGGKGL 77

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE+ L+ G ID AVHS KDMPT   +GL +  YLPRED RD FI++    L DL  
Sbjct: 78  FTREIEEALLDGGIDIAVHSMKDMPTLQPEGLILDTYLPREDTRDAFITYAEGGLADLPQ 137

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +G+SSLRR+A LL  R D+ V++FRG ++TRL KLN+  A    LA AG+ RLK + 
Sbjct: 138 GATVGSSSLRRRAQLLNKRPDLQVVEFRGNLQTRLKKLNDGVARGTFLAMAGLNRLKMDD 197

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V +  +  E+   +  QGAI IE  +++P+ QE++  I+   T   +  ER+FL +LDGS
Sbjct: 198 VPRVAIEPEEMLSAVAQGAIGIERRIDDPRTQEMLAAIHDVPTGHRLAAERSFLLKLDGS 257

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IAG A  +G  ++  G +L  DG         G   DA  +G + A  +   +  +
Sbjct: 258 CETPIAGLAVLEGDQIWLRGEILRPDGSESISGEIRGGIPDAAALGAELASELLGRAPSD 317

Query: 304 VFNF 307
            F++
Sbjct: 318 FFSW 321


>gi|85705298|ref|ZP_01036397.1| porphobilinogen deaminase [Roseovarius sp. 217]
 gi|85670171|gb|EAQ25033.1| porphobilinogen deaminase [Roseovarius sp. 217]
          Length = 315

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 133/303 (43%), Positives = 184/303 (60%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLALA AFETR+ L     +P     I+ + T GD+I +R L EIGGKGLF
Sbjct: 11  PLKIGTRGSPLALAQAFETRARLGAAFDLPEEVFEIVVIKTTGDQIIDRPLKEIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L++GEID AVHS KDMP    +GL +  YLPRED+RD F+S    SL DL   
Sbjct: 71  TREIEQALLTGEIDIAVHSMKDMPVLQPEGLLLDTYLPREDVRDAFVSPLVGSLADLPAG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +++GTSSLRRKA +L     + V++FRG ++TRL KL +  A    LA AG+ RL + +V
Sbjct: 131 ALVGTSSLRRKAQVLVAYPHLQVVEFRGNVQTRLKKLADGVATCTFLAMAGLNRLGRSEV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
               ++ E   P+  QGAI IE   ++ +A E++  I+H++T   +  ERAFLA LDGSC
Sbjct: 191 ATGAIDPEVMLPAVAQGAIGIERRADDTRAAEMLAAIHHKETGQRLVSERAFLAALDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           ++ IAG A   G+TL   G +L  DG       ++    D  ++GR  A  +   +    
Sbjct: 251 ETPIAGLAELNGNTLRLRGEILRPDGSESLTDDQSAPIEDGADLGRAMAAKLLAQAGPGF 310

Query: 305 FNF 307
           F++
Sbjct: 311 FDW 313


>gi|254466587|ref|ZP_05079998.1| porphobilinogen deaminase [Rhodobacterales bacterium Y4I]
 gi|206687495|gb|EDZ47977.1| porphobilinogen deaminase [Rhodobacterales bacterium Y4I]
          Length = 323

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/310 (44%), Positives = 183/310 (59%), Gaps = 10/310 (3%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A+ETRS L     +P     I+ + T GD       ++ L E+GG
Sbjct: 15  PLKIGTRGSPLALAQAYETRSRLAAAFDLPQEAFEIVVIRTTGDNQALIAADKPLKELGG 74

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP    +GL +  YLPRED+RD FIS   +SL D
Sbjct: 75  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPEGLALDTYLPREDVRDAFISPALKSLHD 134

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL+   A    LA AG+ RL 
Sbjct: 135 LAEGAVVGTSSLRRRAQLLNRRPDLKVVEFRGNVQTRLRKLSEGVADCTFLAMAGLNRLA 194

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V    +   D  P+  QGAI IE   ++ +A E++  I+  +T   +  ERAFLA L
Sbjct: 195 MADVPANPIETSDMLPAVAQGAIGIERRADDGRAAEMLAAIHDGETGLRLAAERAFLAAL 254

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC---DAINIGRDAAQYIR 297
           DGSC++ IAG A   GSTL   G VL  DG    E   +   C   D   +GR+ A  + 
Sbjct: 255 DGSCETPIAGLAELHGSTLRLRGEVLRPDG---SESISDDQTCPVEDGAELGREMAAKLL 311

Query: 298 FISNKNVFNF 307
             + K  F++
Sbjct: 312 EKAGKGFFDW 321


>gi|126732359|ref|ZP_01748159.1| porphobilinogen deaminase [Sagittula stellata E-37]
 gi|126707228|gb|EBA06294.1| porphobilinogen deaminase [Sagittula stellata E-37]
          Length = 316

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 137/307 (44%), Positives = 185/307 (60%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA AFETR  LM    +P     I  + T GD       +R L EIG 
Sbjct: 9   PLKIGTRGSPLALAQAFETRERLMAAFSLPEDAFEICIIKTTGDDRAMIAADRPLKEIGN 68

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L++G ID AVHS KDMPT+  +GL +  YLPRED RD FI H   S+ D
Sbjct: 69  KGLFTKEIEEALVAGRIDIAVHSMKDMPTEQPEGLILDCYLPREDPRDAFICHDHGSIHD 128

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L + +V+G+SSLRR+A LL  R D+ V++FRG ++TRL KL++  A A  LA AG+ R+K
Sbjct: 129 LPVGAVVGSSSLRRRAQLLHRRPDLDVVEFRGNLQTRLKKLSDGVATATFLACAGLNRMK 188

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V    +   D  P+  QGAI IE  +++   QE++  I+  DT   +  ERAFLA L
Sbjct: 189 IPGVPMFPIAEVDMLPAIAQGAIGIERRIDDATTQEMLAAIHDHDTGLRLAAERAFLARL 248

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A   G+TL+  G +L  DG I H    +G   +   +GR  A  +   +
Sbjct: 249 DGSCETPIAGLAELDGATLHLRGEILRPDGSISHAGEISGAATEGAALGRTLADDLLSRA 308

Query: 301 NKNVFNF 307
            +  F++
Sbjct: 309 GEGFFDW 315


>gi|302838564|ref|XP_002950840.1| hypothetical protein VOLCADRAFT_85406 [Volvox carteri f.
           nagariensis]
 gi|300263957|gb|EFJ48155.1| hypothetical protein VOLCADRAFT_85406 [Volvox carteri f.
           nagariensis]
          Length = 355

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 142/312 (45%), Positives = 196/312 (62%), Gaps = 11/312 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHN----IVIIPLSTKGDRITNRTLTEIG 59
           K  +IGTR SPLALA A+ TR  L      P  N    + I+ + T GD+I N+ L +IG
Sbjct: 47  KTVKIGTRGSPLALAQAYLTRDLLK--KNFPELNEEGALEIVIIKTTGDKILNQPLADIG 104

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLFT+EI+  L+ G+ID AVHS KD+PT L +G  +   LPRED+RDVFIS TA+ L 
Sbjct: 105 GKGLFTKEIDDALLGGKIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDVFISPTAKDLS 164

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+G++SLRR+A +L     + V +FRG ++TRL KLN     A LLA AG+KRL
Sbjct: 165 ELPAGAVVGSASLRRQAQILAKYPHLKVENFRGNVQTRLRKLNEGACSATLLALAGLKRL 224

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I +IL+IE+  P+  QGAI I     +  +++L+  +NHE+T  +V CERAFLA 
Sbjct: 225 DMTAHITKILSIEEMLPAVSQGAIGIACRTQDDASRKLLAALNHEETRIAVVCERAFLAA 284

Query: 240 LDGSCKSAIAGFAYCKGS--TLYFYGIVLASDGKIFHEVSRNGN--RCDAINIGRDAAQY 295
           LDGSC++ IAG+A+ KGS   L+F G+V   DGK     SR  +    DA+  G DA + 
Sbjct: 285 LDGSCRTPIAGYAH-KGSDGQLHFSGLVATPDGKQMMRTSRVASFTDADAVKAGEDAGRE 343

Query: 296 IRFISNKNVFNF 307
           ++    K +F +
Sbjct: 344 LKATGPKELFMY 355


>gi|323136449|ref|ZP_08071531.1| porphobilinogen deaminase [Methylocystis sp. ATCC 49242]
 gi|322398523|gb|EFY01043.1| porphobilinogen deaminase [Methylocystis sp. ATCC 49242]
          Length = 308

 Score =  249 bits (637), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 133/296 (44%), Positives = 178/296 (60%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RIGTR SPLALA     R++L   H +   +  I  + T GD+I +R L+E GG
Sbjct: 1   MTVRSLRIGTRGSPLALAQTHMIRAALAQAHGVAEDHFAIEIIKTTGDQIQDRPLSESGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E++  LI+G+ID AVHS+KD+PT L   + I+ YLPRED RD +I     +L  
Sbjct: 61  KGLFTKELDSALIAGDIDLAVHSSKDLPTHLPAEIVIAGYLPREDARDAWIGRNGVTLDQ 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT+SLRR A + R R D+     RG + TRLNK+   +  A LLA AG+KRL 
Sbjct: 121 LPAGAVVGTASLRRAAQVKRLRPDVQTTLLRGNVHTRLNKVERGEIDATLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
                  +L ++DFPP+ GQGAI I +  N+P+ +  +  +  E T  ++  ERAFLA L
Sbjct: 181 LADRATALLPLDDFPPAVGQGAIGITSRANDPETRAALAPLLDEATALALLAERAFLAAL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           DGSC++ IAG A  K   L FYG VL +DG     V R+G   DA  IG DA   I
Sbjct: 241 DGSCRTPIAGHATVKDGDLTFYGEVLKADGSEVWIVRRHGRAIDAAMIGADAGNEI 296


>gi|75674669|ref|YP_317090.1| porphobilinogen deaminase [Nitrobacter winogradskyi Nb-255]
 gi|123745784|sp|Q3SVF3|HEM3_NITWN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|74419539|gb|ABA03738.1| porphobilinogen deaminase [Nitrobacter winogradskyi Nb-255]
          Length = 316

 Score =  249 bits (636), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 176/272 (64%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           IGTR SPLALA A E R  L   H++ P  I I  + T GD I +R L ++GGKGLFT+E
Sbjct: 13  IGTRGSPLALAQAHEVRDRLARAHQVAPERIAIKTIRTSGDAIQDRPLFDVGGKGLFTKE 72

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L++G ID AVHS+KD+PT L     + A+LPRED+RDVFIS  A SL DL   + +
Sbjct: 73  IEEALLAGTIDFAVHSSKDVPTFLPDATWLPAFLPREDVRDVFISPHAGSLNDLPAGATV 132

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GT+SLRR+A++L+ R D+ V   RG +ETRL K++  +A A LLA AG+ RL  +     
Sbjct: 133 GTASLRRQAMVLKLRPDLKVNSLRGNVETRLRKISVGEADATLLALAGLNRLGLQDKATR 192

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
           IL  ++F P+ GQGAI IE+  ++ +    VK I   +T  +++ ER+FLA LDGSC++ 
Sbjct: 193 ILETDEFLPAVGQGAIAIESRRDDDRINAFVKAIGDPETEVALSAERSFLALLDGSCRTP 252

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRN 279
           I G     G  + F G++++ DG  F+E +R 
Sbjct: 253 IGGHCRVNGDRIDFRGLIISPDGTEFYETTRE 284


>gi|92116183|ref|YP_575912.1| porphobilinogen deaminase [Nitrobacter hamburgensis X14]
 gi|123387219|sp|Q1QQP5|HEM3_NITHX RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|91799077|gb|ABE61452.1| porphobilinogen deaminase [Nitrobacter hamburgensis X14]
          Length = 316

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 127/272 (46%), Positives = 175/272 (64%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           IGTR S LALA A E R  L   H++ P  IVI  + T GD I +R L ++GGKGLFT+E
Sbjct: 13  IGTRGSALALAQANEVRDRLARAHQVAPERIVIKTIRTSGDAIQDRPLFDVGGKGLFTKE 72

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L++G ID AVHS+KD+PT L     + A+LPRED+RD FIS  A SL DL   S++
Sbjct: 73  IEEALLAGSIDFAVHSSKDVPTFLPDATWLPAFLPREDVRDAFISPRAASLNDLPAGSIV 132

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GT+SLRR+A++LR R D+ V   RG +ETRL KL   +A A LLA AG+ RL  +     
Sbjct: 133 GTASLRRQAMVLRLRPDLKVSVIRGNVETRLRKLVAGEADATLLALAGLNRLGLQDRATR 192

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
           IL  ++F P+ GQGAI IE+  ++ +    VK I   +T  +++ ER+FLA LDGSC++ 
Sbjct: 193 ILETDEFLPAVGQGAIAIESRRDDDRINAFVKAIGDSETEVALSAERSFLALLDGSCRTP 252

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRN 279
           I G     G  ++F G++++ DG   +E +R 
Sbjct: 253 IGGHCRVNGDRIHFRGLIISPDGTQSYETTRE 284


>gi|254474607|ref|ZP_05087993.1| porphobilinogen deaminase [Ruegeria sp. R11]
 gi|214028850|gb|EEB69685.1| porphobilinogen deaminase [Ruegeria sp. R11]
          Length = 320

 Score =  248 bits (633), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 135/310 (43%), Positives = 183/310 (59%), Gaps = 10/310 (3%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR+ L     +P     I+ + T GD       ++ L E+GG
Sbjct: 12  PLKIGTRGSPLALAQAYETRARLAAAFDLPDDAFEIVVIKTTGDNQALIAADKPLKELGG 71

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP +   GL +  YLPRED+RD FIS +  S+ D
Sbjct: 72  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVQQPDGLVLDTYLPREDVRDAFISPSLTSIHD 131

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  +V+GTSSLRR+A LL  R D++V+ FRG ++TRL KL+   A    LA AG+ RL 
Sbjct: 132 LAKGAVVGTSSLRRRAQLLHRRPDLNVVQFRGNVQTRLRKLSEGVAECTFLAMAGLNRLA 191

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V    +   D  P+  QGAI IE   ++ +A +++  I+ + T   +  ERAFLA L
Sbjct: 192 MADVPANAIETNDMLPAVAQGAIGIERRTSDNRAADMLAAIHDQQTGQRLAAERAFLAAL 251

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC---DAINIGRDAAQYIR 297
           DGSC++ IAG A   G+TL   G VL  DG    E   +  RC   D   +GR  A  + 
Sbjct: 252 DGSCETPIAGLAELDGTTLRLRGEVLRPDGS---EAISDDQRCPIEDGAELGRAMAAKLL 308

Query: 298 FISNKNVFNF 307
             + +  F++
Sbjct: 309 DQAGEGFFDW 318


>gi|126725997|ref|ZP_01741839.1| porphobilinogen deaminase [Rhodobacterales bacterium HTCC2150]
 gi|126705201|gb|EBA04292.1| porphobilinogen deaminase [Rhodobacterales bacterium HTCC2150]
          Length = 313

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/291 (43%), Positives = 177/291 (60%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           + P +IGTR SPLALA A ETR  L   H + P    I+ + T GD + +R L EIGGKG
Sbjct: 7   QSPLKIGTRGSPLALAQAHETRDRLSKAHNLAPEAFEIVVIKTTGDIVQDRPLKEIGGKG 66

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+EIE+ ++SG+ID AVHS KDMP +   GL I+ YLPRED+RD F+S +A S  DL 
Sbjct: 67  LFTKEIEEAMLSGDIDIAVHSMKDMPVEQPDGLAITCYLPREDVRDAFVSLSADSFDDLR 126

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +G+SSLRR+A L   R D+++++FRG ++TR+ KL +  A A  LA AG+ RL   
Sbjct: 127 QGATVGSSSLRRRAQLAHRRPDLNLVEFRGNVQTRMRKLGDGVADATFLAMAGLIRLGMS 186

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V +  L  + F P+  QGAI IE  + +    E++  I+ + T D +  ERAFLA ++G
Sbjct: 187 DVARLPLETDVFLPAVAQGAIGIEQRIGDSVISEMLTAIHDQHTGDLLAAERAFLARVEG 246

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
           SC++ IAG A      L+F   +L  DG      + +G   D   IGR  A
Sbjct: 247 SCQTPIAGLAEIIDGKLHFRAEILRPDGSEAITGAASGEIADGAAIGRQVA 297


>gi|323451650|gb|EGB07526.1| hypothetical protein AURANDRAFT_27306 [Aureococcus anophagefferens]
          Length = 333

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 190/312 (60%), Gaps = 7/312 (2%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPH-----NIVIIPLSTKGDRITNRTL 55
           +E  P RIGTR SPLALA A+ TR  LM     P        I +  + T+GD I ++ L
Sbjct: 15  LEATPLRIGTRGSPLALAQAYMTRELLM--KNFPEELGGEGAIQLCIMKTQGDMILDKAL 72

Query: 56  TEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA 115
           +EIGGKGLFT+E++  L+  E+D  VHS KD+PT L     +   L RED RDVFIS TA
Sbjct: 73  SEIGGKGLFTKELDVALLGDEVDICVHSMKDVPTWLPAKTVLPCMLEREDTRDVFISPTA 132

Query: 116 QSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAG 175
           +SLKDL   SVIG++SLRR++ +L     +  ++FRG ++TRL KL+     A LLAYAG
Sbjct: 133 KSLKDLKDGSVIGSASLRRQSQILAINPTLKCVNFRGNVQTRLRKLDEGVVDATLLAYAG 192

Query: 176 IKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERA 235
           +KR+     +  +L  ++  P+  QGAI I+   ++ +A + +  +NHE+T+  V+CERA
Sbjct: 193 LKRMDMADEVTAVLEWDEMLPAVAQGAIGIQCRDDDARALKYIAALNHEETFTCVSCERA 252

Query: 236 FLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQY 295
           FLA LDG+CK+ IAG A      L F G+V + DG+  +  ++ G   DA  IGR+A + 
Sbjct: 253 FLAALDGNCKTPIAGQARIVDGELLFDGLVSSLDGQQMYRATKTGAPADAEKIGREAGEG 312

Query: 296 IRFISNKNVFNF 307
           I+  +    F +
Sbjct: 313 IKAEAGIEFFEW 324


>gi|2495180|sp|Q43082|HEM3_PEA RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG;
           AltName: Full=Hydroxymethylbilane synthase; Short=HMBS;
           AltName: Full=Pre-uroporphyrinogen synthase; Flags:
           Precursor
 gi|313724|emb|CAA51820.1| hydroxymethylbilane synthase [Pisum sativum]
          Length = 369

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 190/307 (61%), Gaps = 6/307 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  LM  H        I I+ + T GD+I ++ L +IGGKGL
Sbjct: 62  IRIGTRGSPLALAQAHETRDKLMASHTELAEEGAIQIVIIKTTGDKILSQPLADIGGKGL 121

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI++ LI+G+ID AVHS KD+PT L +   +   LPRED+RD FIS +A SL DL  
Sbjct: 122 FTKEIDEALINGDIDIAVHSMKDVPTYLPEETILPCNLPREDVRDAFISLSAASLADLPA 181

Query: 124 HSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            SVIGT+SLRRK+ +L     ++V D FRG ++TRL KL+     A LLA AG+KRL   
Sbjct: 182 GSVIGTASLRRKSQILHRYPSLTVQDNFRGNVQTRLRKLSEGVVKATLLALAGLKRLNMT 241

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +   L+I+D  P+  QGAI I    N+ K  E +  +NHE+T  +++CERAFL  LDG
Sbjct: 242 ENVTSTLSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHEETRLAISCERAFLTTLDG 301

Query: 243 SCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFI 299
           SC++ IAG+A   K     F G+V + DG    E SR G+    D + IG+DA + +   
Sbjct: 302 SCRTPIAGYASRDKDGNCLFRGLVASPDGTRVLETSRIGSYTYEDMMKIGKDAGEELLSR 361

Query: 300 SNKNVFN 306
           +    FN
Sbjct: 362 AGPGFFN 368


>gi|83952840|ref|ZP_00961570.1| porphobilinogen deaminase [Roseovarius nubinhibens ISM]
 gi|83835975|gb|EAP75274.1| porphobilinogen deaminase [Roseovarius nubinhibens ISM]
          Length = 304

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 131/302 (43%), Positives = 183/302 (60%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR SPLALA A+ETR  L+    +P     I+ ++T GDR+ +R L EIGGKGLFT
Sbjct: 1   MKIGTRGSPLALAQAYETRDRLVAAFDLPETAFEIVIITTTGDRVIDRPLKEIGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            EIE  L++G+ID AVHS KDMP    +GL I  YLPRED+RD FI  T ++L ++A  +
Sbjct: 61  REIEDALLTGDIDLAVHSMKDMPVLQPEGLIIDCYLPREDVRDAFICPTGRNLSEMAPGT 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+A +L     + V++FRG ++TRL KL+   A    LA AG+ RLK+ +VI
Sbjct: 121 KVGSSSLRRRAQVLVAHPQLEVVEFRGNVQTRLRKLDEGVAACTFLAMAGLNRLKRTEVI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L  E+  P+  QGAI IE   ++  A  +++ I+H  T   +  ERAFLA LDGSC+
Sbjct: 181 TRALEPEEMLPAVAQGAIGIERRRDDSGAAMMLEAIHHGPTGQRLAAERAFLAALDGSCE 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G TL   G +L  DG       R+    D   +GR  A  +   +  + F
Sbjct: 241 TPIAGLAELQGGTLRLRGEILRPDGSERLCDDRSAPVEDGAELGRAMAVDLLAQAGPDFF 300

Query: 306 NF 307
           ++
Sbjct: 301 DW 302


>gi|255558669|ref|XP_002520359.1| porphobilinogen deaminase, putative [Ricinus communis]
 gi|223540457|gb|EEF42025.1| porphobilinogen deaminase, putative [Ricinus communis]
          Length = 372

 Score =  246 bits (628), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 141/307 (45%), Positives = 188/307 (61%), Gaps = 6/307 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  LM  H        I I+ + T GD+I  + L +IGGKGL
Sbjct: 65  IRIGTRGSPLALAQAHETRDKLMAKHSELAEEGAIQIVIIKTTGDKILTQPLADIGGKGL 124

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI++ LI+GEID AVHS KD+PT L +   +   LPRED+RD FIS +A SL +L  
Sbjct: 125 FTKEIDEALINGEIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDAFISLSASSLAELPS 184

Query: 124 HSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            SVIGT+SLRRK+ +L     +SV++ FRG ++TRL KLN     A LLA AG+KRL   
Sbjct: 185 GSVIGTASLRRKSQILHRYPSLSVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLNMT 244

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  +L+I+D  P+  QGAI I    N+ K    +  +NHE+T  +V CERAFL  LDG
Sbjct: 245 ENVTSVLSIDDMLPAVAQGAIGIACRSNDDKMANYLASLNHEETRLAVACERAFLETLDG 304

Query: 243 SCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFI 299
           SC++ IAG+A   +     F G+V + DG    E SR G     D I +G+DA + +   
Sbjct: 305 SCRTPIAGYASKDENGDCIFKGLVASPDGTRVLETSRKGPYALDDMIMMGKDAGKELLLQ 364

Query: 300 SNKNVFN 306
           +    F+
Sbjct: 365 AGPGFFD 371


>gi|126733455|ref|ZP_01749202.1| porphobilinogen deaminase [Roseobacter sp. CCS2]
 gi|126716321|gb|EBA13185.1| porphobilinogen deaminase [Roseobacter sp. CCS2]
          Length = 311

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 129/285 (45%), Positives = 170/285 (59%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           PF IGTR SPLALA A ETRS LM    +P     I  +   GD I +R L EIGGKGLF
Sbjct: 11  PFNIGTRGSPLALAQAHETRSRLMAAFNLPEEAFAICVIKVTGDAIQDRPLKEIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE+ L+ G ID AVHS KDMP     GL +  YLPRED+RD F+S  A SL DLA  
Sbjct: 71  TREIEEALLDGSIDIAVHSMKDMPVDQPGGLLLDTYLPREDVRDAFVSLNASSLNDLAEG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRR++ LL  R D+++++FRG ++TRL KL +  A A  LA AG+ RL    V
Sbjct: 131 ATVGTSSLRRRSQLLAKRPDLNIVEFRGNVQTRLKKLGDGVAEATFLAMAGLNRLHMTDV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  +  ED  P+  QGAI IE   ++ +A  ++  I+   T   +  ER+FLA LDGSC
Sbjct: 191 PRTAVAPEDMLPAVAQGAIGIERRGDDSRAAAMLDAIHDHATGRRLAAERSFLAALDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           ++ I G A   G ++   G +L +DG        +G+  D   +G
Sbjct: 251 ETPIGGLAELDGGSIRLRGEILRTDGTEVFADDMSGSIEDGPAMG 295


>gi|148909210|gb|ABR17705.1| unknown [Picea sitchensis]
          Length = 373

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 191/306 (62%), Gaps = 5/306 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           RIGTR SPLALA A+ETR  L   H        + II + T GD+I N+ L +IGGKGLF
Sbjct: 68  RIGTRGSPLALAQAYETRDKLKSAHPELAEEGAVEIIIIKTTGDKILNQPLADIGGKGLF 127

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EI+  L+ G+ID AVHS KD+PT L  G  +   LPRED+RDVFI  TA SL +L   
Sbjct: 128 TKEIDDALLGGKIDIAVHSMKDVPTYLPSGTILPCNLPREDVRDVFICPTAGSLAELQAG 187

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           S++G++SLRR++ +L     + VI+FRG ++TRL KL   + HA LLA+AG+KRL   + 
Sbjct: 188 SIVGSASLRRQSQILYRYPSLKVINFRGNVQTRLRKLKEGEVHATLLAFAGLKRLGMIQH 247

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           +  +L+ E+  P+  QGAI I    N+ K  + +  +NHE+T  +V CERAFL  LDGSC
Sbjct: 248 VTCLLSTEEMLPAIAQGAIGIACRSNDDKMADYLAALNHEETRLAVACERAFLETLDGSC 307

Query: 245 KSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFISN 301
           ++ IAG+A+  K     F G++ + DG    E SR G     D +++G DA + ++  + 
Sbjct: 308 RTPIAGYAFRDKDGFCSFRGLIASPDGTRVLETSRKGAYTHEDMVSMGVDAGKELKERAG 367

Query: 302 KNVFNF 307
              F++
Sbjct: 368 PAFFDW 373


>gi|116793769|gb|ABK26871.1| unknown [Picea sitchensis]
          Length = 373

 Score =  246 bits (627), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 191/306 (62%), Gaps = 5/306 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           RIGTR SPLALA A+ETR  L   H        + II + T GD+I N+ L +IGGKGLF
Sbjct: 68  RIGTRGSPLALAQAYETRDKLKSAHPELAEEGAVEIIIIKTTGDKILNQPLADIGGKGLF 127

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EI+  L+ G+ID AVHS KD+PT L  G  +   LPRED+RDVFI  TA SL +L   
Sbjct: 128 TKEIDDALLGGKIDIAVHSMKDVPTYLPSGTILPCNLPREDVRDVFICPTAGSLAELQAG 187

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           S++G++SLRR++ +L     + VI+FRG ++TRL KL   + HA LLA+AG+KRL   + 
Sbjct: 188 SIVGSASLRRQSQILYRYPSLKVINFRGNVQTRLRKLKEGEVHATLLAFAGLKRLGMIQH 247

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           +  +L+ E+  P+  QGAI I    N+ K  + +  +NHE+T  +V CERAFL  LDGSC
Sbjct: 248 VTCLLSTEEMLPAIAQGAIGIACRSNDDKMADYLAALNHEETRLAVACERAFLETLDGSC 307

Query: 245 KSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFISN 301
           ++ IAG+A+  K     F G++ + DG    E SR G     D +++G DA + ++  + 
Sbjct: 308 RTPIAGYAFRDKDGFCSFRGLIASPDGTRVLETSRKGAYTYEDMVSMGVDAGKELKERAG 367

Query: 302 KNVFNF 307
              F++
Sbjct: 368 PAFFDW 373


>gi|99082369|ref|YP_614523.1| porphobilinogen deaminase [Ruegeria sp. TM1040]
 gi|99038649|gb|ABF65261.1| porphobilinogen deaminase [Ruegeria sp. TM1040]
          Length = 318

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 133/306 (43%), Positives = 181/306 (59%), Gaps = 5/306 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR  L    ++ P    I+ + T GD       +R L EIG 
Sbjct: 11  PLKIGTRGSPLALAQAYETRDRLARAFELEPTAFDIVVIKTTGDNRAMIDADRPLKEIGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMPT   +GL +  YLPRED+RD F+S    S+ D
Sbjct: 71  KGLFTKEIEEALLSGGIDIAVHSMKDMPTLQPEGLTLDCYLPREDVRDAFVSPGIHSIAD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL N  A A  LA AG++RL 
Sbjct: 131 LPEGAVVGTSSLRRRAQLLHRRPDLQVVEFRGNVQTRLQKLENGVASATFLAMAGLRRLD 190

Query: 181 -KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             E V    ++++D  P+  QGAI IE   ++     +++ I+H +T   +  ERAFLA 
Sbjct: 191 MAEAVPATPISVDDMLPAVAQGAIGIERRSSDITTAAMLEAIHHAETSLRLAAERAFLAA 250

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           LDGSC++ IA  A   G T+   G +L  DG       ++G   D   +GR   + +R  
Sbjct: 251 LDGSCETPIAALADLSGGTIQLRGQILRPDGSEALSDEQDGAIEDGAELGRQMGETLRAR 310

Query: 300 SNKNVF 305
           +    F
Sbjct: 311 AGAGFF 316


>gi|46201306|ref|ZP_00208053.1| COG0181: Porphobilinogen deaminase [Magnetospirillum
           magnetotacticum MS-1]
          Length = 315

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 181/304 (59%), Gaps = 2/304 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHN--IVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA   ETR  L            I I  + T GD I +R L EIGGKGL
Sbjct: 8   LRIGTRGSPLALAQTHETRDRLAAAWAPLGQEGAIDIEVIKTTGDLIQDRPLAEIGGKGL 67

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+E+++ ++SG I  AVHS KD+PT L  G+ +   LPRED+RD FIS  A SL DL  
Sbjct: 68  FTKELDEAMLSGRIHLAVHSMKDVPTLLPDGIVLPCILPREDVRDAFISLKAASLADLPQ 127

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +V+GTSSLRR A +L  R D+ V++FRG ++TRL KL+     A +LA AG++RL    
Sbjct: 128 GAVVGTSSLRRGAQILHRRPDLKVVNFRGNVQTRLRKLDEGVVDATMLAMAGLRRLGLAG 187

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            +   L+ +D  P+  QGAI I    ++  A   +  +N  D++  V  ERAFL  LDGS
Sbjct: 188 HVTSALSEDDMLPAVAQGAIGITCRADDEAAHAFLAALNCPDSFVRVAAERAFLTRLDGS 247

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IA  A   G  L F G++++ DG   H  SR+G+R DA  +G+DAA+ +  ++   
Sbjct: 248 CRTPIAALAVLDGDHLSFRGLIVSPDGTAIHATSRSGSRSDAEAMGKDAAEELIKVAGPG 307

Query: 304 VFNF 307
            F+ 
Sbjct: 308 FFDL 311


>gi|255640018|gb|ACU20300.1| unknown [Glycine max]
          Length = 356

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 143/308 (46%), Positives = 189/308 (61%), Gaps = 8/308 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A+ETR  LM  H        I I+ + T GD+I  + L +IGGKGL
Sbjct: 49  IRIGTRGSPLALAQAYETRDKLMASHPDLAEEGAIEIVIIKTTGDKILTQPLADIGGKGL 108

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI++ L++ EID AVHS KD+PT L     +   LPRED+RD FIS TA SL DL  
Sbjct: 109 FTKEIDEALLNSEIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFISLTAASLADLPP 168

Query: 124 HSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            SVIGT+SLRRK+ +L     ++V + FRG ++TRL KLN     A LLA AG+KRL   
Sbjct: 169 ASVIGTASLRRKSQILHRYPSLNVQENFRGNVQTRLRKLNEGVVQATLLALAGLKRLSMT 228

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  IL+I+D  P+  QGAI I    ++ K  E +  +NHE+T  +V CERAFL  LDG
Sbjct: 229 ENVTSILSIDDMLPAVAQGAIGIACRSDDDKMAEYIDSLNHEETRLAVVCERAFLQTLDG 288

Query: 243 SCKSAIAGFAYCKG--STLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRF 298
           SC++ IAG+A C+       F G+V + DG    E SR G     D I +G+DA + +  
Sbjct: 289 SCRTPIAGYA-CRNEDGNCLFRGLVASPDGTRVLETSRVGPYAVEDMIEMGKDAGKELLS 347

Query: 299 ISNKNVFN 306
            +  N F+
Sbjct: 348 RAGPNFFS 355


>gi|310815397|ref|YP_003963361.1| porphobilinogen deaminase [Ketogulonicigenium vulgare Y25]
 gi|308754132|gb|ADO42061.1| porphobilinogen deaminase [Ketogulonicigenium vulgare Y25]
          Length = 314

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 176/304 (57%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P RIGTR SPLALA A+ETR  L     +P     I  +   GD + ++ L EIGGKGL
Sbjct: 10  QPLRIGTRGSPLALAQAYETRDRLAQAFALPHEAFQIEVIKVTGDMVQDKALREIGGKGL 69

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE  L+ G ID AVHS KDMP +   GL +  YLPRED+RD F+S    +L D+  
Sbjct: 70  FTREIEDALLDGSIDIAVHSMKDMPVEQPAGLLLDCYLPREDVRDAFVSLHGWTLADVPA 129

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
             VIGTSSLRR+A +L  R D++V++FRG ++TRL KL+   A A  LA AG+ RL++  
Sbjct: 130 GKVIGTSSLRRRAQILARRPDLTVVEFRGNVQTRLKKLDEGVADATFLAMAGLNRLQRGD 189

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V  + L +E   P+  QGAI IE   ++   + ++ VI+   T   +  ERAFLA LDGS
Sbjct: 190 VPLKALEVEQMLPAVAQGAIGIERRADDRIIEGMLAVIHDGPTGVRLAAERAFLAGLDGS 249

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C + IAG A   G  +   G VL  DG         G   DA  IG + A+ +R ++ + 
Sbjct: 250 CHTPIAGLAEIIGDQIRLRGEVLRPDGSEAICDDMRGAAVDAAQIGAEMARKLRGLAGEG 309

Query: 304 VFNF 307
            F  
Sbjct: 310 FFTL 313


>gi|168059289|ref|XP_001781636.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162666950|gb|EDQ53592.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 393

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 134/305 (43%), Positives = 187/305 (61%), Gaps = 4/305 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           RIGTR SPLALA A++TR  L   H        + I+ + T GD+I ++ L +IGGKGLF
Sbjct: 89  RIGTRGSPLALAQAYQTRDKLKAAHPELAEEGALEIVIIKTTGDKILSQPLADIGGKGLF 148

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EI+  L++G+ID AVHS KD+PT L +G  +   LPRED+RD FI     SL +L   
Sbjct: 149 TKEIDDALLNGDIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICPNYSSLAELPEG 208

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SV+G++SLRR++ LL     + V++FRG ++TRL KL+     A LLA AG+KRL   + 
Sbjct: 209 SVVGSASLRRQSQLLHKYPHLKVVNFRGNVQTRLRKLSEGTVQATLLALAGLKRLDMTEH 268

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           +  IL+ +D  P+  QGAI I     + K +E +  +NHEDT  +V CERAFLA+LDGSC
Sbjct: 269 VTTILDTDDMLPAIAQGAIGIACRTGDTKMEEYLSSLNHEDTRLAVACERAFLAKLDGSC 328

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGN--RCDAINIGRDAAQYIRFISNK 302
           ++ IAG A        F G+V  +DGK   E SR G+    D I + +DA Q +   +  
Sbjct: 329 RTPIAGLAQRTDDGCSFRGLVATTDGKQVLETSRKGSFFYDDMIALAQDAGQELISRAGP 388

Query: 303 NVFNF 307
           + F +
Sbjct: 389 DFFEW 393


>gi|126740632|ref|ZP_01756319.1| porphobilinogen deaminase [Roseobacter sp. SK209-2-6]
 gi|126718433|gb|EBA15148.1| porphobilinogen deaminase [Roseobacter sp. SK209-2-6]
          Length = 319

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 133/310 (42%), Positives = 180/310 (58%), Gaps = 10/310 (3%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR+ L     +P     I+ + T GD       ++ L E+GG
Sbjct: 11  PLKIGTRGSPLALAQAYETRARLAKAFDLPQEAFEIVVIKTTGDNQALIAADKPLKELGG 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP    +GL +  YLPRED+RD F+S     L+D
Sbjct: 71  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVLQPEGLLLDCYLPREDVRDAFVSPKFSRLQD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  +V+GTSSLRR+A L+  R D+ V++FRG ++TRL KL +  A    LA AG+ RL 
Sbjct: 131 LAAGAVVGTSSLRRRAQLMNRRPDLKVVEFRGNVQTRLKKLEDGVAECTFLAMAGLNRLA 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E V    +   D  P+  QGAI IE   ++ +   +++ I+ + T   +  ERAFLA L
Sbjct: 191 MESVPATAIETTDMLPAVAQGAIGIERRSDDSRVAAMLEAIHDKATGQRLAAERAFLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC---DAINIGRDAAQYIR 297
           DGSC++ IAG A   G TL   G VL  DG    E       C   D   +GRD A  + 
Sbjct: 251 DGSCETPIAGLAELDGGTLRMRGEVLRPDG---SEAIAEDQSCAIEDGAALGRDMAAKLL 307

Query: 298 FISNKNVFNF 307
             +  + F++
Sbjct: 308 DQAGPSFFDW 317


>gi|259417591|ref|ZP_05741510.1| porphobilinogen deaminase [Silicibacter sp. TrichCH4B]
 gi|259346497|gb|EEW58311.1| porphobilinogen deaminase [Silicibacter sp. TrichCH4B]
          Length = 318

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 135/310 (43%), Positives = 184/310 (59%), Gaps = 11/310 (3%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR  L    ++ P    I+ + T GD       +R L EIG 
Sbjct: 11  PLKIGTRGSPLALAQAYETRDRLARAFELEPTAFDIVVIKTTGDNRAMIDADRPLKEIGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L SG ID AVHS KDMPT+  +GL +  YLPRED+RD F+S   +++ D
Sbjct: 71  KGLFTKEIEEALTSGGIDLAVHSMKDMPTEQPEGLMLDCYLPREDVRDAFVSPQIRAIAD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A A  LA AG++RL 
Sbjct: 131 LPEGAVVGTSSLRRRAQLLHRRPDLQVVEFRGNVQTRLQKLQDGVASATFLAMAGLRRLN 190

Query: 181 -KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             E+V    +  ED  P+  QGAI IE   ++  A  +++ I+H +T   +  ERAFLA 
Sbjct: 191 MAEEVPATPIAPEDMLPAVAQGAIGIERRSDDTTAAAMLEAIHHAETSLRLAAERAFLAA 250

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC---DAINIGRDAAQYI 296
           LDGSC++ IA  A   G TL   G +L  DG    E   +   C   D   +GR   + +
Sbjct: 251 LDGSCETPIAALADLSGGTLQLRGQILRPDGS---EALADQQSCAIEDGAELGRRMGEAL 307

Query: 297 RFISNKNVFN 306
           R  + +  F+
Sbjct: 308 RARAGEGFFS 317


>gi|298707417|emb|CBJ30046.1| hydroxymethylbilane synthase, putative chloroplast precursor
           [Ectocarpus siliculosus]
          Length = 373

 Score =  245 bits (625), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 128/292 (43%), Positives = 189/292 (64%), Gaps = 2/292 (0%)

Query: 8   IGTRCSPLALAHAFETRSSLMD-VHKIPPHNIVIIP-LSTKGDRITNRTLTEIGGKGLFT 65
           IGTR SPLALA A+ETR  L +   ++     V I  + T GD I ++ LTEIGGKGLFT
Sbjct: 61  IGTRGSPLALAQAYETRKRLGEQFDELKEEGAVAIQVIKTSGDMILDKPLTEIGGKGLFT 120

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E++ +L++ ++D  VHS KD+PT ++ G  +   LPRED  D FIS+ A ++  L   S
Sbjct: 121 KELDVQLLNKDVDICVHSMKDVPTWIVPGTILPCNLPREDTSDAFISNKADNIASLPDGS 180

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           VIG++SLRR+A LLR      V++FRG ++TRL KL+     A LLA+AG+KRL+  +V 
Sbjct: 181 VIGSASLRRQAQLLRANPTFKVVNFRGNVQTRLRKLDEEIVDATLLAFAGLKRLEMAQVA 240

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L+ +   P+  QGAI I+   N+P  ++ +  + H++T  +V+CERAFLA LDG+CK
Sbjct: 241 TSVLDQDAMLPAVAQGAIGIQCRENDPTFEKYLAGLCHQETKTAVDCERAFLAALDGNCK 300

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           + IAG A  +G  L F G++ + DGK F++ +R G   DA+ +G DA   ++
Sbjct: 301 TPIAGQARMEGEKLVFRGLIASPDGKQFYDTTREGKPEDAVAMGHDAGMELK 352


>gi|19849543|gb|AAL12220.1| porphobilinogen deaminase [Triticum aestivum]
          Length = 308

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 188/305 (61%), Gaps = 5/305 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHN--IVIIPLSTKGDRITNRTLTEIGGKGLF 64
           RIGTR SPLALA A +TR  L   H     +  I I+ + T GD I ++ L +IGGKGLF
Sbjct: 1   RIGTRGSPLALAQARQTRDELKAAHTELAEDGAIEIVIIKTTGDMILDKPLADIGGKGLF 60

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EI+  L+ G ID AVHS KD+PT L +G+ +   LPRED+RD FI  TA++L +L   
Sbjct: 61  TKEIDDALLQGSIDIAVHSMKDVPTYLPEGMILPCNLPREDVRDAFICLTAKTLGELPAG 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SVI ++SLRR++ +L     + V++FRG ++TRL KL     HA LLA AG+KRL   + 
Sbjct: 121 SVIASASLRRQSQILYKYPSLKVVNFRGNVQTRLRKLKEGDVHATLLALAGLKRLGMPET 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
              +L++++  P+  QGAI I    N+ K  E +  +NHEDT  +V CER FL+ LDG+C
Sbjct: 181 ATSVLSVDEMLPAVAQGAIGITCRSNDDKMMEYLSSLNHEDTRLAVACEREFLSVLDGNC 240

Query: 245 KSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFISN 301
           ++ IA +AY  K     F G++ + DG I +E SR+G     D + +G+DA   ++  + 
Sbjct: 241 RTPIAAYAYRDKDGNCSFRGLLASPDGSIVYETSRSGTYSFDDMVALGQDAGHELKSKAG 300

Query: 302 KNVFN 306
              F+
Sbjct: 301 PGFFD 305


>gi|89056336|ref|YP_511787.1| porphobilinogen deaminase [Jannaschia sp. CCS1]
 gi|88865885|gb|ABD56762.1| porphobilinogen deaminase [Jannaschia sp. CCS1]
          Length = 318

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/307 (41%), Positives = 182/307 (59%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRIT----NRTLTEIGG 60
           P RIGTR SPLALA A ETR+ LM    +P     I+ + T GD  +    +  L E+GG
Sbjct: 11  PLRIGTRGSPLALAQARETRARLMAAWDLPEDAFEIVVIKTTGDDRSLIDADVALKELGG 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ +++  ID AVHS KDMPT    GL +  YLPRED+RD F+S     L  
Sbjct: 71  KGLFTKEIEEDMLTSSIDIAVHSMKDMPTVQPDGLMLDCYLPREDVRDAFVSVNHDGLHA 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++G+SSLRR+A L   R D++V++FRG ++TR+ KL    A A  LA AG++RL 
Sbjct: 131 LPEGAIVGSSSLRRRAQLFARRPDLNVVEFRGNVQTRMKKLGGGVADATFLAMAGLRRLG 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+V+K  + +ED  P+  QGAI IE  V++ +A +++  I++ +T   +  ER+FL  L
Sbjct: 191 MEEVVKSAIEVEDMLPAVAQGAIGIERRVSDTRAGDMLAAIHNTETGQRLAAERSFLKGL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IA  A   G TL   G +L  DG       R     D   +G D A+ +R  +
Sbjct: 251 DGSCQTPIAALAELDGGTLRLRGEILRPDGSEVLTDDRTAPIEDGAALGADMARDLRARA 310

Query: 301 NKNVFNF 307
               F++
Sbjct: 311 GDGFFDW 317


>gi|84500376|ref|ZP_00998625.1| porphobilinogen deaminase [Oceanicola batsensis HTCC2597]
 gi|84391329|gb|EAQ03661.1| porphobilinogen deaminase [Oceanicola batsensis HTCC2597]
          Length = 315

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 127/304 (41%), Positives = 177/304 (58%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P +IGTR SPLALA A E R  L     +PP    +  + T GDR+ +R L EIGGKGL
Sbjct: 10  RPLKIGTRGSPLALAQAHEARDRLAHAFDLPPEAFEVCVIQTTGDRVQDRPLKEIGGKGL 69

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE  L++G ID AVHS KDMP    +GL +  YLPRED RD F+S+  + L  +  
Sbjct: 70  FTREIEHALLTGGIDIAVHSMKDMPVLQPEGLLLDCYLPREDPRDAFVSNLYERLDQIPA 129

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRR+A +L  R D+ V++FRG ++TRL KL +  A A  LA AG+ RL +  
Sbjct: 130 GARVGTSSLRRRAQVLVRRPDLEVVEFRGNVQTRLRKLADGVASATFLAMAGLNRLDRAS 189

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           + +  L  ++  P+  QGAI IE   ++     L++ I+  +T   +  ERAFLA LDGS
Sbjct: 190 IARSALATDEMLPAVAQGAIGIERREDDHATAALLEAIHDPETARQLAAERAFLAALDGS 249

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IAG A  +G TL   G +L  DG    +  R+    D   +GR+    +   +   
Sbjct: 250 CETPIAGLADLEGGTLRLRGEILRPDGSEALKDDRSAPVEDGAKLGREMGAALLAQAGDG 309

Query: 304 VFNF 307
            F+F
Sbjct: 310 FFDF 313


>gi|296080867|emb|CBI18797.3| unnamed protein product [Vitis vinifera]
          Length = 328

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/306 (45%), Positives = 189/306 (61%), Gaps = 6/306 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           RIGTR SPLALA A+ETR  LM  H        I I+ + T GD+I  + L +IGGKGLF
Sbjct: 22  RIGTRGSPLALAQAYETRDKLMAAHSELAEEGAIQIVVIKTTGDKILTQPLADIGGKGLF 81

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EI++ L++G+ID AVHS KD+PT L     +   LPRED+RD FIS TA SL +L   
Sbjct: 82  TKEIDEALLNGDIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFISLTAASLSELPAG 141

Query: 125 SVIGTSSLRRKALLL-RWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
           S++GT+SLRRK+ LL R++S   + +FRG ++TRL KLN     A LLA AG+KRL   +
Sbjct: 142 SIVGTASLRRKSQLLHRYKSLNVLENFRGNVQTRLRKLNEGVVQATLLALAGLKRLNMTE 201

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            +  IL+I++  P+  QGAI I    N+ K    +  +NHE T  +V CERAFL  LDGS
Sbjct: 202 NVTSILSIDEMLPAVAQGAIGIACRSNDDKMANYLASLNHEVTRLAVACERAFLETLDGS 261

Query: 244 CKSAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFIS 300
           C++ IAG+A + +     F G+V + DG    E SR G     D I +G+DA + +   +
Sbjct: 262 CRTPIAGYASHDEDGNCIFKGLVASPDGTKVLETSRKGPYALEDMIKMGKDAGEELLSRA 321

Query: 301 NKNVFN 306
               F+
Sbjct: 322 GPGFFD 327


>gi|254463278|ref|ZP_05076694.1| porphobilinogen deaminase [Rhodobacterales bacterium HTCC2083]
 gi|206679867|gb|EDZ44354.1| porphobilinogen deaminase [Rhodobacteraceae bacterium HTCC2083]
          Length = 295

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/295 (44%), Positives = 176/295 (59%), Gaps = 4/295 (1%)

Query: 15  LALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLIS 74
           +ALA A+ETR  L     +P    VI  + T GD+I +R L EIGGKGLFT EIE  ++S
Sbjct: 1   MALAQAYETRRRLSGAFDLPEEAFVIKVIKTTGDKILDRPLKEIGGKGLFTREIEDDMLS 60

Query: 75  GEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLRR 134
           G ID AVHS KDMP    +GL +  YLPRED+RD F+S   + L DL   +V+GTSSLRR
Sbjct: 61  GAIDIAVHSMKDMPVLQPEGLVLDTYLPREDVRDAFVSSGHERLADLPSGAVVGTSSLRR 120

Query: 135 KALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDF 194
           +A LL +R D++V++FRG ++TRL KL +  A    LA AG++RL    V K  +  E+ 
Sbjct: 121 RAQLLNYRPDLNVVEFRGNVQTRLKKLEDKVADCTFLAMAGLRRLDMAHVAKSAIETEEM 180

Query: 195 PPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAYC 254
            P+  QGAI IE  +N+  A E++  I+   T   +  ERAFLA LDGSC++ IAG A  
Sbjct: 181 LPAVAQGAIGIERRINDTNAAEMLAAIHDTQTGQRLAAERAFLAALDGSCETPIAGLAEL 240

Query: 255 KGSTLYFYGIVLASDG--KIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFNF 307
            GS + F G VL  DG   I  +VS  G   D + +G   A  +   + +  F +
Sbjct: 241 DGSNMRFRGQVLRPDGSESIGDDVS--GTIEDGVAMGEAMAAKLLAEAGEGFFEW 293


>gi|83855078|ref|ZP_00948608.1| porphobilinogen deaminase [Sulfitobacter sp. NAS-14.1]
 gi|83842921|gb|EAP82088.1| porphobilinogen deaminase [Sulfitobacter sp. NAS-14.1]
          Length = 317

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 177/305 (58%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           + P RIGTR SPLA+A A+ETR+ L    +IP     I+ +   GD I +R L +IGGKG
Sbjct: 9   ENPMRIGTRGSPLAMAQAYETRARLAAAFEIPQAAFEIVVIKVTGDVIQDRPLKDIGGKG 68

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE+ L++G+ID AVHS KDMPT    GL +  YLPRED RD F++ T  +L  LA
Sbjct: 69  LFTREIEEDLLAGKIDIAVHSMKDMPTIQPGGLLLDTYLPREDPRDAFVAPTLSALDQLA 128

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG+ RL  +
Sbjct: 129 ESAVVGTSSLRRRAQLLHQRPDLQVVEFRGNVQTRLKKLADGVAECTFLAVAGLNRLGMQ 188

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V    ++     P+  QGAI IE    +   + ++  I+   T   +  ERAFL  LDG
Sbjct: 189 HVPATPIDDTLMLPAVAQGAIGIERRAGDLDTEAMLAAIHDTPTGQRLAAERAFLLTLDG 248

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IAG A   G TL+  G VL  DG       R+G       +G D AQ +   +  
Sbjct: 249 SCETPIAGLATLDGDTLHLRGQVLRPDGSEAIAGDRSGPIAQGGQMGVDLAQDLLAQAGP 308

Query: 303 NVFNF 307
             F++
Sbjct: 309 GFFDW 313


>gi|163745168|ref|ZP_02152528.1| porphobilinogen deaminase [Oceanibulbus indolifex HEL-45]
 gi|161381986|gb|EDQ06395.1| porphobilinogen deaminase [Oceanibulbus indolifex HEL-45]
          Length = 315

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 179/304 (58%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P  IGTR S LALA A E R  L     +P     I+ + T GD+I +R L EIGGKGL
Sbjct: 10  RPLNIGTRGSLLALAQANEVRDRLAAAFDLPFEAFTIVVIKTTGDKIIDRPLKEIGGKGL 69

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE  L+ G ID AVHS KDMPT    GL I  YLPRED+RD FIS   +S+ DL  
Sbjct: 70  FTREIEAALLDGSIDIAVHSMKDMPTLQPGGLVIDTYLPREDMRDAFISPHLKSIADLPE 129

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +V+GTSSLRR+A +   R D+ V++FRG ++TRL KL +  A A  LA AG+ RLK ++
Sbjct: 130 GAVVGTSSLRRRAQVKLRRPDLEVVEFRGNLQTRLKKLEDGVAEATFLAMAGLNRLKMDE 189

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V K  ++ +D  P+  QGAI IE  +++ +A +++  I+   T + +  ERAFLA LDGS
Sbjct: 190 VPKAAVHTDDMLPAIAQGAIGIERRMDDTRAADMLAAIHDRATGEQLAAERAFLATLDGS 249

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C++ IAG A   G+ +   G VL  DG             D    GR+ A+ +   +   
Sbjct: 250 CETPIAGLAELNGTNMRLRGQVLRPDGSDAIGDDVTCTISDGAEAGREMARKLLAEAGPG 309

Query: 304 VFNF 307
            F++
Sbjct: 310 FFDW 313


>gi|163737211|ref|ZP_02144629.1| porphobilinogen deaminase [Phaeobacter gallaeciensis BS107]
 gi|161389815|gb|EDQ14166.1| porphobilinogen deaminase [Phaeobacter gallaeciensis BS107]
          Length = 320

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 182/310 (58%), Gaps = 10/310 (3%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A ETR+ L+    +P     I+ + T GD       ++ L E+GG
Sbjct: 12  PLKIGTRGSPLALAQAHETRARLVAAFDLPQDAFEIVVIKTSGDNQALIAADKPLKELGG 71

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP     GL +  YLPRED+RD F+S    ++ D
Sbjct: 72  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPAGLLLDTYLPREDVRDAFVSPDVTAITD 131

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG+ RL 
Sbjct: 132 LRAGAVVGTSSLRRRAQLLHRRPDLQVVEFRGNVQTRLTKLRDGVAECTFLAMAGLNRLG 191

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++V    +  ED  P+  QGAI IE   ++ +  +++  ++  +T + +  ERAFLA L
Sbjct: 192 ADQVPATPIPPEDMLPAVAQGAIGIERRADDSRTGDMLAALHDRETGERLAAERAFLAAL 251

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC---DAINIGRDAAQYIR 297
           DGSC++ IAG A  +G TL   G VL  DG    E   +   C   D   +GR+ A  + 
Sbjct: 252 DGSCETPIAGLATLEGRTLRLRGEVLRPDGS---EAISDEQTCPVEDGAELGREMAAKLL 308

Query: 298 FISNKNVFNF 307
             +    F++
Sbjct: 309 AQAGAGFFDW 318


>gi|83941602|ref|ZP_00954064.1| porphobilinogen deaminase [Sulfitobacter sp. EE-36]
 gi|83847422|gb|EAP85297.1| porphobilinogen deaminase [Sulfitobacter sp. EE-36]
          Length = 317

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 177/305 (58%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           + P RIGTR SPLA+A A+ETR+ L    +IP     I+ +   GD I +R L +IGGKG
Sbjct: 9   ENPMRIGTRGSPLAMAQAYETRARLAAAFEIPQAAFEIVVIKVTGDVIQDRPLKDIGGKG 68

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE+ L++G+ID AVHS KDMPT    GL +  YLPRED RD F++ T  +L  LA
Sbjct: 69  LFTREIEEDLLAGKIDIAVHSMKDMPTIQPGGLLLDTYLPREDPRDAFVAPTLSALDQLA 128

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG+ RL  +
Sbjct: 129 EGAVVGTSSLRRRAQLLHQRPDLQVVEFRGNVQTRLKKLADGVAECTFLAVAGLNRLGMQ 188

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V    ++     P+  QGAI IE    +   + ++  I+   T   +  ERAFL  LDG
Sbjct: 189 HVPATPIDDTLMLPAVAQGAIGIERRAGDLDTEAMLAAIHDTPTGQRLAAERAFLLTLDG 248

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IAG A   G TL+  G VL  DG       R+G       +G D AQ +   +  
Sbjct: 249 SCETPIAGLATLDGDTLHLRGQVLRPDGSEAIAGDRSGPIAQGGQMGVDLAQDLLAQAGP 308

Query: 303 NVFNF 307
             F++
Sbjct: 309 GFFDW 313


>gi|163740378|ref|ZP_02147772.1| porphobilinogen deaminase [Phaeobacter gallaeciensis 2.10]
 gi|161386236|gb|EDQ10611.1| porphobilinogen deaminase [Phaeobacter gallaeciensis 2.10]
          Length = 320

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 182/310 (58%), Gaps = 10/310 (3%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A ETR+ L+    +P     I+ + T GD       ++ L E+GG
Sbjct: 12  PLKIGTRGSPLALAQAHETRARLVAAFDLPQDAFEIVVIKTSGDNQALIAADKPLKELGG 71

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP     GL +  YLPRED+RD F+S    ++ D
Sbjct: 72  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPAGLLLDTYLPREDVRDAFVSPDVTAITD 131

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG+ RL 
Sbjct: 132 LRAGAVVGTSSLRRRAQLLHRRPDLQVVEFRGNVQTRLTKLRDGVAECTFLAMAGLNRLG 191

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++V    +  ED  P+  QGAI IE   ++ +  +++  ++  +T + +  ERAFLA L
Sbjct: 192 ADQVPATPIPPEDMLPAVAQGAIGIERRADDSRTGDMLAALHDRETGERLAAERAFLAAL 251

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC---DAINIGRDAAQYIR 297
           DGSC++ IAG A  +G TL   G VL  DG    E   +   C   D   +GR+ A  + 
Sbjct: 252 DGSCETPIAGLATLEGRTLRLRGEVLRPDGS---EAISDEQTCPVEDGAELGREMATKLL 308

Query: 298 FISNKNVFNF 307
             +    F++
Sbjct: 309 AQAGAGFFDW 318


>gi|149915548|ref|ZP_01904074.1| porphobilinogen deaminase [Roseobacter sp. AzwK-3b]
 gi|149810440|gb|EDM70283.1| porphobilinogen deaminase [Roseobacter sp. AzwK-3b]
          Length = 304

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 177/302 (58%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            ++GTR SPLALA A+ETRS L     +PP    I+ + T GDRI +R L EIGGKGLFT
Sbjct: 1   MKLGTRGSPLALAQAYETRSRLSAAFDLPPEAFEIVVIKTTGDRIIDRPLKEIGGKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            EIE+ ++SGEID A+HS KDMP    +GL +  YLPRED+RD F+S     L DL   +
Sbjct: 61  REIEEAMLSGEIDIAIHSMKDMPVLQPEGLVLDTYLPREDVRDAFVSPHVGGLADLEPGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRRKA +L     + V++FRG ++TRL KL +  A    LA AG+ RL + +V 
Sbjct: 121 KVGTSSLRRKAQVLVAYPHLDVVEFRGNVQTRLKKLQDGVAACTFLAMAGLNRLGRSEVA 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              +  ++  P+  QGAI IE   ++ +  E++  I+   T   +  ERAFLA LDGSC+
Sbjct: 181 TAAIETDEMLPAVAQGAIGIERRRDDTRTAEMLAAIHDTPTGQRLAAERAFLAALDGSCE 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A   G TL   G VL  DG    +  ++    D   +G +  + +   +    F
Sbjct: 241 TPIAGLAELDGGTLRLRGQVLRPDGSEALDDDQSAPIEDGAKLGHEMGRKLLERAGPGFF 300

Query: 306 NF 307
           ++
Sbjct: 301 DW 302


>gi|114765839|ref|ZP_01444932.1| porphobilinogen deaminase [Pelagibaca bermudensis HTCC2601]
 gi|114541838|gb|EAU44875.1| porphobilinogen deaminase [Roseovarius sp. HTCC2601]
          Length = 319

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 131/307 (42%), Positives = 178/307 (57%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A ETR  L     +P     I+ + T GD       +R L EIG 
Sbjct: 11  PLKIGTRGSPLALAQAHETRDRLAAAFDLPQDAFEIVVIKTTGDDRAMIAADRPLKEIGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE++L+SG ID AVHS KDMPT+  +GL +  YLPRED RD FIS     L  
Sbjct: 71  KGLFTKEIEEQLLSGGIDIAVHSMKDMPTEQPEGLVLDCYLPREDERDAFISPGHAGLAA 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A A  LA AG++R+ 
Sbjct: 131 LPEGTVVGTSSLRRRAQLLNRRPDLQVVEFRGNVQTRLKKLEDGVAAATFLAMAGLRRMD 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              +    ++ +D  P+  QGAI IE   ++ +  +++  I+  DT   +  ER FLA L
Sbjct: 191 MTDIPMTAMSPDDMLPAIAQGAIGIERRSDDSRTGDMLAAIHDTDTATRLAAERTFLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A   G  L   G +LA DG   H    +G   D   +GR  A+ +   +
Sbjct: 251 DGSCETPIAGLAELDGDRLRLRGEILAPDGSASHAGELSGPAADGPAMGRALAEELLARA 310

Query: 301 NKNVFNF 307
             + F +
Sbjct: 311 GPDFFAW 317


>gi|89069761|ref|ZP_01157097.1| porphobilinogen deaminase [Oceanicola granulosus HTCC2516]
 gi|89044707|gb|EAR50818.1| porphobilinogen deaminase [Oceanicola granulosus HTCC2516]
          Length = 313

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 132/304 (43%), Positives = 176/304 (57%), Gaps = 1/304 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P +IGTR SPLALA A ETR  L   H +P     ++ + T GDR+ +R L EIGGKGL
Sbjct: 9   RPLKIGTRGSPLALAQAHETRDRLAAAHGLPGEAFEVVVIRTTGDRVVDRPLKEIGGKGL 68

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EIE+ ++SG ID AVHS KDMP    +GL +  YLPRED RD F+S     +K L  
Sbjct: 69  FTKEIEEAMLSGAIDIAVHSMKDMPVAQPEGLVLDCYLPREDPRDAFVSLLHAGIKALPD 128

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRKA LL  R D+ V++FRG ++TRL KL +  A A  LA AG+ RL  + 
Sbjct: 129 GATVGTSSLRRKAQLLHRRPDLHVVEFRGNVQTRLRKLESGVAVATFLAVAGLNRLGADD 188

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V +  +  ED  P+  QGAI IE   ++    E++  I+   T + +  ERAFLA LDGS
Sbjct: 189 VPQAPIAPEDMLPAVAQGAIGIERRASDEGLGEMLAAIHDRATGERLAAERAFLAALDGS 248

Query: 244 CKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           C++ IAG A   G   L   G +LA DG             D   +G D A+ +   +  
Sbjct: 249 CETPIAGLAELIGDGRLRLRGEILAHDGSRCLADEAEAQIADGAALGTDMARRLLAQAGP 308

Query: 303 NVFN 306
             F+
Sbjct: 309 GFFD 312


>gi|84685204|ref|ZP_01013103.1| porphobilinogen deaminase [Maritimibacter alkaliphilus HTCC2654]
 gi|84666936|gb|EAQ13407.1| porphobilinogen deaminase [Rhodobacterales bacterium HTCC2654]
          Length = 319

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 186/311 (59%), Gaps = 9/311 (2%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIG 59
           KP +IGTR SPLALA A+ETR  L     +P     I+ + T GD       +R L EIG
Sbjct: 10  KPLKIGTRGSPLALAQAYETRDRLAAAFDLPETAFEIVVIKTTGDDRAMIAADRPLKEIG 69

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
            KGLFT EIE +L++G ID AVHS KDMPT+   GL +  YLPRED RD FIS     + 
Sbjct: 70  NKGLFTREIEDQLLNGGIDLAVHSMKDMPTEQPPGLTLDCYLPREDTRDAFISLGGGGIH 129

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            LA  +V+GTSSLRRKA LL  R D++V++FRG ++TRL KL +  A A  LA AGI RL
Sbjct: 130 GLAEGAVVGTSSLRRKAQLLNRRPDLNVVEFRGNVQTRLTKLRDGVAEATFLAMAGITRL 189

Query: 180 KK-EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
              ++V  + +  ED  P+  QGAI IE   ++    ++++ I+H  T   +  ER+FLA
Sbjct: 190 GMLDEVPHDAIAPEDMLPAIAQGAIGIERRSHDTNVADMLEAIHHGGTERRLAAERSFLA 249

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSRNGNRCDAINIGRDAAQYI 296
            LDGSC++ IAG A   G TL   G +L +DG   +  E+S  G   D  ++GR  AQ +
Sbjct: 250 TLDGSCETPIAGLAEIDGGTLRLRGEILRTDGSEALADEIS--GAVEDGPDMGRALAQKL 307

Query: 297 RFISNKNVFNF 307
              +  + F++
Sbjct: 308 LSRAGPDFFDW 318


>gi|224094087|ref|XP_002310073.1| predicted protein [Populus trichocarpa]
 gi|222852976|gb|EEE90523.1| predicted protein [Populus trichocarpa]
          Length = 363

 Score =  242 bits (617), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 140/307 (45%), Positives = 188/307 (61%), Gaps = 6/307 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  LM  H        I I+ + T GD+I ++ L +IGGKGL
Sbjct: 56  IRIGTRGSPLALAQAHETRDKLMASHSDLAEEGAIQIVIIKTTGDKIQSQPLADIGGKGL 115

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI++ LI+G+ID AVHS KD+PT L +   +   LPRED+RD FIS +A SL DL  
Sbjct: 116 FTKEIDEALINGDIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDAFISLSAASLADLPA 175

Query: 124 HSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            S+IGT+SLRRK+ +L     +SV + FRG ++TRL KLN     A LLA AG+KRL   
Sbjct: 176 GSIIGTASLRRKSQILHRYPSLSVEENFRGNVQTRLRKLNEGVVKATLLALAGLKRLNMT 235

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  IL ++D  P+  QGAI I    N+ K    +  +NHE+T  +V CERAFL  LDG
Sbjct: 236 ENVTSILPLDDMLPAVAQGAIGIACRSNDDKMVNYLASLNHEETRLAVACERAFLETLDG 295

Query: 243 SCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFI 299
           SC++ IAG+A   +     F G+V + DG+   E SR G     D I +G+DA + +   
Sbjct: 296 SCRTPIAGYARKDENGDCIFKGLVASPDGRRVLETSRKGPYAFDDMIAMGKDAGKELLSQ 355

Query: 300 SNKNVFN 306
           +    F+
Sbjct: 356 AGPGFFD 362


>gi|312114941|ref|YP_004012537.1| porphobilinogen deaminase [Rhodomicrobium vannielii ATCC 17100]
 gi|311220070|gb|ADP71438.1| porphobilinogen deaminase [Rhodomicrobium vannielii ATCC 17100]
          Length = 313

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 131/307 (42%), Positives = 192/307 (62%), Gaps = 6/307 (1%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVH--KIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           + +  RIGTR S LALA A E ++ L  ++  ++    +VI    T GD+I ++ L+ +G
Sbjct: 6   DARQIRIGTRGSALALAQATEVQNRLAAIYGDEVKFERVVI---KTTGDKILDKALSLVG 62

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLFT+E+E+ L + +ID AVHS KD+   L  GL+I+  LPRED+RD FIS  A+SL 
Sbjct: 63  GKGLFTKELEEALFADQIDIAVHSMKDVQAFLPDGLEIACNLPREDVRDAFISMKAKSLA 122

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           D+   +VIGT+S+RR+A +   R D+  + FRG +++RL KL +  A A LLA AG+ RL
Sbjct: 123 DMPEGAVIGTASVRREAFIKNKRPDLKTVLFRGNVQSRLKKLEDGVADATLLASAGLNRL 182

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                I + + +ED  P+P QGAI IE   N+   +EL+  ++ E T  +++ ERAFL+E
Sbjct: 183 GLSDRITQHIPVEDMLPAPAQGAIGIEIRSNDQVTRELIMALHDEATGYAIDAERAFLSE 242

Query: 240 LDGSCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           LDGSC++ IA  A   G   + F G +L  DG   +E +R G+  DA  +G+DAAQ +  
Sbjct: 243 LDGSCRTPIAALARYDGHGRVSFKGAILTPDGARIYETTREGSANDAAAMGKDAAQELYA 302

Query: 299 ISNKNVF 305
              K+VF
Sbjct: 303 RGGKDVF 309


>gi|255635113|gb|ACU17914.1| unknown [Glycine max]
          Length = 350

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 188/297 (63%), Gaps = 6/297 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A+ETR  LM  H        I I+ + T GD+I ++ L +IGGKGL
Sbjct: 43  LRIGTRGSPLALAQAYETRDKLMASHAELAEEGAIQIVIIKTTGDKILSQPLADIGGKGL 102

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI++ LI+G+ID AVHS KD+PT L     +   LPRED+RD FIS +A SL DL  
Sbjct: 103 FTKEIDEALINGDIDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFISLSAASLADLPS 162

Query: 124 HSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            S++GT+SLRRK+ +L     ++V + FRG ++TRL KL+     A LLA AG+KRL   
Sbjct: 163 GSIVGTASLRRKSQILHRYPSLNVEENFRGNVQTRLRKLSEGIVQATLLALAGLKRLNMT 222

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  IL+I+D  P+  QGAI I    N+ K  E +  +NHE+T  +V+CERAFL +L+G
Sbjct: 223 ENVTSILSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHEETRLAVSCERAFLEKLEG 282

Query: 243 SCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYI 296
           SC++ IAG+A   +     F G+V + DG    E SR G     D I +G+DA + +
Sbjct: 283 SCRTPIAGYASRNEDGNCLFRGLVASPDGIRVLETSRIGPYAFEDTIKMGKDAGEEL 339


>gi|159486921|ref|XP_001701485.1| porphobilinogen deaminase [Chlamydomonas reinhardtii]
 gi|158271667|gb|EDO97482.1| porphobilinogen deaminase [Chlamydomonas reinhardtii]
          Length = 349

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/312 (43%), Positives = 195/312 (62%), Gaps = 11/312 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRS----SLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           K  +IGTR SPLALA A+ TR     S  ++ +     IVII   T GD+I N+ L +IG
Sbjct: 41  KTVKIGTRGSPLALAQAYMTRDLLKKSFPELSEEGALEIVII--KTTGDKILNQPLADIG 98

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLFT+EI+  L+SG+ID AVHS KD+PT L +G  +   LPRED+RDVFIS  A+ L 
Sbjct: 99  GKGLFTKEIDDALLSGKIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDVFISPVAKDLS 158

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +++G++SLRR+A +L     + V +FRG ++TRL KLN     A LLA AG+KRL
Sbjct: 159 ELPAGAIVGSASLRRQAQILAKYPHLKVENFRGNVQTRLRKLNEGACSATLLALAGLKRL 218

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
              + I + L+I++  P+  QGAI I    ++  ++ L+  +NHE+T  +V CERAFL  
Sbjct: 219 DMTEHITKTLSIDEMLPAVSQGAIGIACRTDDGASRNLLAALNHEETRIAVVCERAFLTA 278

Query: 240 LDGSCKSAIAGFAYCKGS--TLYFYGIVLASDGKIFHEVSR--NGNRCDAINIGRDAAQY 295
           LDGSC++ IAG+A+ KG+   L+F G+V   DGK     SR       DA+  G +A + 
Sbjct: 279 LDGSCRTPIAGYAH-KGADGMLHFSGLVATPDGKQIMRASRVVPFTEADAVKCGEEAGKE 337

Query: 296 IRFISNKNVFNF 307
           ++    K +F +
Sbjct: 338 LKANGPKELFMY 349


>gi|56698469|ref|YP_168844.1| porphobilinogen deaminase [Ruegeria pomeroyi DSS-3]
 gi|56680206|gb|AAV96872.1| porphobilinogen deaminase [Ruegeria pomeroyi DSS-3]
          Length = 319

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 134/307 (43%), Positives = 188/307 (61%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRIT----NRTLTEIGG 60
           P +IGTR SPLALA A+ETR  L     +P     I+ +ST GD       +R L EIG 
Sbjct: 11  PLKIGTRGSPLALAQAYETRHRLGAAFDLPEDAFEIVVISTTGDNRAMIEADRPLKEIGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ ++ G+ID AVHS KDMP +   GL +  +LPRED+RD FIS    +++D
Sbjct: 71  KGLFTKEIEEAMLRGDIDIAVHSTKDMPVEQPAGLVLDTFLPREDVRDAFISPGHSAIRD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L +V+GTSSLRRKA LL  R D+ V++FRG ++TRL KL+   A    LA AGI+RL 
Sbjct: 131 LPLGAVVGTSSLRRKAQLLNRRPDLKVVEFRGNVQTRLRKLSEGVAECTFLAMAGIRRLN 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             +V    ++ +D  P+  QGAI IE  +++ +A E++  I+H +T   +  ERA LA L
Sbjct: 191 MAEVPATAISPDDMLPAIAQGAIGIERRMDDTRAAEMLTAIHHGETGQRLAAERALLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A   G+TL   G VL  DG     + R+G+  D   +G + A+ +   +
Sbjct: 251 DGSCETPIAGLAELDGTTLRLRGEVLRPDGSEAITLDRSGDVADGPALGTEMARELLAQA 310

Query: 301 NKNVFNF 307
               F++
Sbjct: 311 GPGFFDW 317


>gi|298292774|ref|YP_003694713.1| porphobilinogen deaminase [Starkeya novella DSM 506]
 gi|296929285|gb|ADH90094.1| porphobilinogen deaminase [Starkeya novella DSM 506]
          Length = 309

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 124/300 (41%), Positives = 176/300 (58%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            R+GTR SPLAL  A   R +L+  H   P  + +  + T GD IT+R L+E GGKGLFT
Sbjct: 8   LRLGTRGSPLALWQAHAVRDALVKAHGWAPEAVEVQVIRTTGDAITDRALSEAGGKGLFT 67

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E+ L+   ID AVHSAKDM TKL  GL +  YLPR D+RD  I     SL DL   +
Sbjct: 68  KELEEALLDRRIDLAVHSAKDMATKLPDGLHLVGYLPRADVRDALILREGSSLADLKPGA 127

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GT+SLRR+A L R R D+ V   RG + TRL+K+ + +    LLA AG+ RL      
Sbjct: 128 KVGTASLRREAQLRRLRPDLQVSLLRGNVHTRLSKVESGEFDGTLLALAGLTRLGMADKA 187

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L++ DF P+ GQGA+ IE+   +     L+  +    T  ++  ERA+L ELDGSC+
Sbjct: 188 SALLDVADFLPAVGQGAVAIESRFGDIAVDALLVPVTCPATGLALRVERAYLGELDGSCR 247

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + I G A  +G  + F G+VL+ DG  ++E+ R G    A+ +G  A Q +R +   ++ 
Sbjct: 248 TPIGGLAEVQGEEIRFRGVVLSPDGSRYYEIVRYGPANRALELGLAAGQEMRAMVPADLL 307


>gi|86139102|ref|ZP_01057673.1| porphobilinogen deaminase [Roseobacter sp. MED193]
 gi|85824333|gb|EAQ44537.1| porphobilinogen deaminase [Roseobacter sp. MED193]
          Length = 319

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 176/310 (56%), Gaps = 10/310 (3%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR  L +   +P     I+ + T GD       ++ L E+GG
Sbjct: 11  PLKIGTRGSPLALAQAYETRRRLAEAFDLPHEAFEIVVIKTSGDNQALIAADKPLKELGG 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L+SG ID AVHS KDMP    +GL +  YLPRED+RD F+S     L+D
Sbjct: 71  KGLFTKEIEEDLLSGAIDIAVHSMKDMPVAQPEGLLLDCYLPREDVRDAFVSPKFSRLQD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A L+  R D+ V++FRG ++TRL KLN   A    LA AG+ RL 
Sbjct: 131 LEPGAVVGTSSLRRRAQLMNRRPDLKVVEFRGNVQTRLKKLNEGVAECTFLAMAGLNRLA 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V    +   D  P+  QGAI IE   ++ +   +++ I+   T   +  ERAFLA L
Sbjct: 191 MADVPATAIETNDMLPAVAQGAIGIERRGDDSRTAAMLEAIHDVTTGKRLAAERAFLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC---DAINIGRDAAQYIR 297
           DGSC++ IAG A   G TL   G VL  DG    E       C   D   +GR+ A  + 
Sbjct: 251 DGSCETPIAGLAELDGGTLRLRGEVLRPDG---SEALAEDQSCAIEDGGELGREMAAKLL 307

Query: 298 FISNKNVFNF 307
             +    F++
Sbjct: 308 ATAGPGFFDW 317


>gi|255634492|gb|ACU17610.1| unknown [Glycine max]
          Length = 350

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 136/297 (45%), Positives = 187/297 (62%), Gaps = 6/297 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            +IGTR SPLALA A+ETR  LM  H        I I+ + T GD+I ++ L +IGGKGL
Sbjct: 43  LKIGTRGSPLALAQAYETRDKLMASHPELAEEGAIQIVIIKTTGDKILSQPLADIGGKGL 102

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI++ LI+G+ D AVHS KD+PT L     +   LPRED+RD FIS +A SL DL  
Sbjct: 103 FTKEIDEALINGDSDIAVHSMKDVPTYLPDKTILPCNLPREDVRDAFISLSAASLADLPS 162

Query: 124 HSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            SV+GT+SLRRK+ +L     ++V + FRG ++TRL KL+     A LLA AG+KRL   
Sbjct: 163 GSVVGTASLRRKSQILHRYPSLNVEENFRGNVQTRLRKLSEGIVQATLLALAGLKRLNMT 222

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  IL+I+D  P+  QGAI I    N+ K  E +  +NHE+T  +V+CERAFL +L+G
Sbjct: 223 ENVSSILSIDDMLPAVAQGAIGIACRSNDDKMAEYLASLNHEETRLAVSCERAFLEKLEG 282

Query: 243 SCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYI 296
           SC + IAG+A   +     F G+V + DG    E SR G+    D I +G+DA + +
Sbjct: 283 SCHTPIAGYASRNEDGNCLFRGLVASPDGTRVLETSRIGSYAFEDMIKMGKDAGEEL 339


>gi|83594897|ref|YP_428649.1| porphobilinogen deaminase [Rhodospirillum rubrum ATCC 11170]
 gi|83577811|gb|ABC24362.1| Porphobilinogen deaminase [Rhodospirillum rubrum ATCC 11170]
          Length = 321

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 127/313 (40%), Positives = 177/313 (56%), Gaps = 7/313 (2%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKI--PPHNIVIIPLSTKGDRITNRTLTEI 58
           +EK   RIGTR SPLALA   + R  L+  +     P  + I  + T GD I +R L+E+
Sbjct: 5   IEKSKLRIGTRGSPLALAQTHQVRDLLIAANPDLGEPGAVTIEVIKTTGDAILDRPLSEL 64

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLFT EI+  +++G ID AVHS KD+PT L  G+ +   L RED+RD F+      L
Sbjct: 65  GGKGLFTREIDDAMLAGTIDIAVHSMKDVPTYLPDGIVLPCMLEREDVRDAFLGRDHARL 124

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            DL   SV+GT+SLRR A +L  R DI VI FRG ++TRL+KL   +A A +LA AG+ R
Sbjct: 125 ADLPEGSVVGTASLRRGAQILAMRPDIKVISFRGNVQTRLDKLARGEADATMLAIAGLNR 184

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L        +L I++  P+  QGA+ +     +  A   +  +NH  T   V  ERAFL 
Sbjct: 185 LGMADKASSVLEIDEMLPAVAQGAVGVTCRAGDETAHRWLAPLNHRATQLCVEIERAFLT 244

Query: 239 ELDGSCKSAIAGFAYCK-----GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
            LDGSC++ I G A  K       T++F G+++ +DGK+ H+ +R G   D I +G DA 
Sbjct: 245 RLDGSCRTPIGGLARLKRVEDPSGTVFFRGMIIRTDGKVIHQTTREGLAADGIALGDDAG 304

Query: 294 QYIRFISNKNVFN 306
             +   +    F 
Sbjct: 305 AELLAKAGPGFFQ 317


>gi|307103191|gb|EFN51453.1| hypothetical protein CHLNCDRAFT_33052 [Chlorella variabilis]
          Length = 361

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 133/312 (42%), Positives = 191/312 (61%), Gaps = 10/312 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHN----IVIIPLSTKGDRITNRTLTEIG 59
           K  +IGTR SPLALA A+ TR  L      P  N    + II + T GD+I N+ L++IG
Sbjct: 52  KTLKIGTRGSPLALAQAYLTRDLLKST--FPELNEEGALEIIIIKTTGDKILNQPLSDIG 109

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLFT+EI+  L+ G ID AVHS KD+PT L  G  +   LPRED+RDVFIS   +S+ 
Sbjct: 110 GKGLFTKEIDDALLDGRIDIAVHSMKDVPTYLPAGTVLPCNLPREDVRDVFISAKYKSIA 169

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
           +L   +V+G++SLRR+A +L     + V++FRG ++TRL KL      A LLA AG+KRL
Sbjct: 170 ELPEGAVVGSASLRRQAQILAKYPTLQVVNFRGNVQTRLRKLQEGACDATLLALAGLKRL 229

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
                   IL+ ++  P+  QGAI I     + ++   +  +NHE+T  ++ CERAFLA 
Sbjct: 230 GLADKATSILSTDEMLPAVAQGAIGIACREGDDRSAAALAALNHEETRLAIVCERAFLAA 289

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIR 297
           LDGSC++ IAG+A+     L F G+V   DGK  +E +R G+    +A  IG+DA   ++
Sbjct: 290 LDGSCRTPIAGWAHKADGQLAFRGLVSTPDGKKMYETTRTGSLTEDEARAIGQDAGTELK 349

Query: 298 FISNKN--VFNF 307
             + ++  VF++
Sbjct: 350 QQAQQDGTVFDW 361


>gi|224081346|ref|XP_002306378.1| predicted protein [Populus trichocarpa]
 gi|222855827|gb|EEE93374.1| predicted protein [Populus trichocarpa]
          Length = 363

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 138/306 (45%), Positives = 188/306 (61%), Gaps = 6/306 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHN--IVIIPLSTKGDRITNRTLTEIGGKGLF 64
           RIGTR SPLALA A ETR  LM  H     +  I I+ + T GD+I ++ L +IGGKGLF
Sbjct: 57  RIGTRGSPLALAQAHETRDKLMASHAELAEDGAIQIVIIKTTGDKILSQPLADIGGKGLF 116

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EI++ LI+G+ID AVHS KD+PT L +   +   LPRED+RD FIS +A SL DL   
Sbjct: 117 TKEIDEALINGDIDIAVHSMKDVPTYLPEMTILPCNLPREDVRDAFISMSATSLADLPAG 176

Query: 125 SVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
           S++GT+SLRRK+ +L     +SV + FRG ++TRL KLN     A LLA AG+KRL   +
Sbjct: 177 SIVGTASLRRKSQILHRFPSLSVEENFRGNVQTRLRKLNEGVVKATLLALAGLKRLNMTE 236

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            +  IL I+D  P+  QGAI I    ++ K    +  +NHE+T  +V CERAFL  LDGS
Sbjct: 237 NVTSILPIDDMLPAVAQGAIGIACRDSDDKMANYLASLNHEETRLAVACERAFLETLDGS 296

Query: 244 CKSAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFIS 300
           C++ IAG+A   +     F G+V + DG    + SR G     D I +G+DA + +   +
Sbjct: 297 CRTPIAGYARRDENGDCIFKGLVASPDGTRVLKTSRKGPYAFDDMIAMGKDAGKELLSQA 356

Query: 301 NKNVFN 306
               F+
Sbjct: 357 GPGFFD 362


>gi|88770654|gb|ABD51930.1| chloroplast hydroxymethylbilane synthase [Guillardia theta]
          Length = 346

 Score =  234 bits (598), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 126/312 (40%), Positives = 188/312 (60%), Gaps = 9/312 (2%)

Query: 1   MEKKP-FRIGTRCSPLALAHAFETRSSLMDVHKIPPH------NIVIIPLSTKGDRITNR 53
           M  +P  ++GTR SPLALA A+ETR  L ++   P         + I  ++T GD   ++
Sbjct: 13  MSGEPVIKLGTRGSPLALAQAYETRRRLAEL--FPEELGEKGEKVSINIINTSGDMELSK 70

Query: 54  TLTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISH 113
            L+EIGGKGLFT+E++  L+  E+D  VHS KD+PT L  G  + A LPRED RD FIS 
Sbjct: 71  ALSEIGGKGLFTKELDVALLKKEVDFCVHSMKDVPTYLPDGTHLEAMLPREDTRDAFISP 130

Query: 114 TAQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAY 173
             QS +++   +VIG++SLRR+A +      I  ++FRG ++TRL KL++    A LLA 
Sbjct: 131 KYQSFEEMPEGTVIGSASLRRQAQIFAKNPKIKCVNFRGNVQTRLRKLDDEVVDATLLAL 190

Query: 174 AGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCE 233
           AG+KR+     + ++L+ ++  P+  QGAI I+   ++ K  + +  +NH+DT   V+CE
Sbjct: 191 AGLKRMNMADCVTKVLDWDEMLPAVAQGAIGIQVRSDDDKTLKYISALNHKDTKTCVDCE 250

Query: 234 RAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
           R+FLA LDGSCK+ IAG A      ++F G+V + DG       R G+  D + IG+DA 
Sbjct: 251 RSFLATLDGSCKTPIAGQARIIDGKIHFRGLVASPDGSKIFRAERVGDVSDYMKIGKDAG 310

Query: 294 QYIRFISNKNVF 305
           + IR  + +  F
Sbjct: 311 EEIRKEAGEQFF 322


>gi|255262497|ref|ZP_05341839.1| porphobilinogen deaminase [Thalassiobium sp. R2A62]
 gi|255104832|gb|EET47506.1| porphobilinogen deaminase [Thalassiobium sp. R2A62]
          Length = 316

 Score =  234 bits (596), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 127/267 (47%), Positives = 166/267 (62%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           KP +IGTR SPLALA A ETR  L     +P     I  + T GDRI +R L EIGGKGL
Sbjct: 10  KPLKIGTRGSPLALAQAHETRERLAAAFDLPHEAFAIQVIQTTGDRIIDRPLKEIGGKGL 69

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT EIE+ ++ G ID AVHS KDMPT    GL +  YLPRED+RD FI+    +L DL  
Sbjct: 70  FTREIEQAMLDGSIDIAVHSMKDMPTLQPDGLLLDTYLPREDVRDAFIALDGGTLADLPD 129

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
             V+GTSSLRR+A L   R D+ V++FRG ++TRL KL +  A A  LA AG+ RLK + 
Sbjct: 130 GGVVGTSSLRRQAQLRLRRPDLQVVEFRGNLQTRLRKLGDKVADATFLAMAGLNRLKMDD 189

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V +  + +E+  P+  QGAI IE   N+ +A +++  I+   T   ++ ERAFL  LDGS
Sbjct: 190 VTRTPIEVEEMLPAVAQGAIGIERRANDLRAADMLAAIHDRLTGQRLSAERAFLQALDGS 249

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDG 270
           C++ IA  A   G+++   G VL  DG
Sbjct: 250 CETPIAALAELDGTSMRLRGEVLRPDG 276


>gi|297810933|ref|XP_002873350.1| hypothetical protein ARALYDRAFT_908776 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297319187|gb|EFH49609.1| hypothetical protein ARALYDRAFT_908776 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 382

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 133/297 (44%), Positives = 184/297 (61%), Gaps = 6/297 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A+ETR  L   H   +    I I  + T GD+I ++ L +IGGKGL
Sbjct: 75  IRIGTRGSPLALAQAYETREKLKSKHPELVEDGAIHIEIIKTTGDKILSQPLADIGGKGL 134

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI++ LI+G ID AVHS KD+PT L +   +   LPRED+RD FI  TA SL +L  
Sbjct: 135 FTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDAFICLTAASLAELPA 194

Query: 124 HSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            SV+GT+SLRRK+ +L     + V + FRG ++TRL+KL   K  A LLA AG+KRL   
Sbjct: 195 GSVVGTASLRRKSQILHKYPALRVEENFRGNVQTRLSKLQGGKVQATLLALAGLKRLSMT 254

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  IL++++  P+  QGAI I    ++ K    +  +NHE+T  +++CERAFL  LDG
Sbjct: 255 ENVASILSLDEMLPAVAQGAIGIACRTDDDKMATYLASLNHEETRLAISCERAFLETLDG 314

Query: 243 SCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYI 296
           SC++ IAG+A   +     F G+V + DG    E SR G     D + +G+DA Q +
Sbjct: 315 SCRTPIAGYAAKDEEGNCIFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQEL 371


>gi|119386338|ref|YP_917393.1| porphobilinogen deaminase [Paracoccus denitrificans PD1222]
 gi|166217779|sp|A1B853|HEM3_PARDP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|119376933|gb|ABL71697.1| porphobilinogen deaminase [Paracoccus denitrificans PD1222]
          Length = 313

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 130/305 (42%), Positives = 179/305 (58%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           + P RIGTR S LALA A ETR  LM  H +      I+ + T GDR+ +R L EIGGKG
Sbjct: 8   QNPIRIGTRGSALALAQAHETRDRLMAAHGLAADAFRIVVIKTTGDRVLDRPLKEIGGKG 67

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE  L++ EID AVHS KDMPT   +GL I  YLPRED+RD F+S    ++ +L 
Sbjct: 68  LFTREIEDALLAHEIDIAVHSMKDMPTIQPEGLVIDCYLPREDVRDAFVSAQFAAISELP 127

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+G+SSLRR+A L   R D+ +++FRG ++TRL KL +  A A  LA AG+ RL   
Sbjct: 128 QGAVVGSSSLRRRAQLAARRPDLKLVEFRGNVQTRLKKLEDGVAVATFLAMAGLTRLGML 187

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V +  +  ++  P+  QG I +E   ++ +   L+  I+  D+   V  ERAFLA LDG
Sbjct: 188 HVARGAVEPDEMLPAVAQGCIGVERRADDARTASLLAAISDRDSALRVTAERAFLARLDG 247

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IAG A  +G  L   G +L  DG       R G   D   +G D A+ +R  +  
Sbjct: 248 SCQTPIAGLAELQGDRLRLRGEILRPDGSEVIAAERVGPAADGAAMGTDLAEELRGRAPA 307

Query: 303 NVFNF 307
           + F++
Sbjct: 308 DFFDW 312


>gi|260574199|ref|ZP_05842204.1| porphobilinogen deaminase [Rhodobacter sp. SW2]
 gi|259023665|gb|EEW26956.1| porphobilinogen deaminase [Rhodobacter sp. SW2]
          Length = 314

 Score =  233 bits (593), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 130/303 (42%), Positives = 180/303 (59%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P +IGTR SPLAL  A ETR SLM    +P     I+ +   GD++ +R L EIGGKGLF
Sbjct: 11  PLKIGTRGSPLALWQAHETRRSLMAAFSLPEAAFEIVVIKVTGDQVQDRALKEIGGKGLF 70

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T EIE  L+ G ID AVHS KDMPT   +GL +  YLPRED+RD F+S T   L DL   
Sbjct: 71  TREIEDALLDGSIDIAVHSMKDMPTLQPEGLLLDCYLPREDVRDAFVSPTVARLADLPHG 130

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +G+SSLRR+A L   R D+++++FRG ++TR+ KL +  A A  LA AG+ RL    V
Sbjct: 131 ATVGSSSLRRRAQLAARRPDLNLVEFRGNVQTRMKKLEDGVAVATFLAMAGLNRLGMAHV 190

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            +  + +E+  P+  QGAI IE    +P+A+ L+  I+H  T   + CERA+L ELDGSC
Sbjct: 191 ARSAIEVEEMLPAVAQGAIGIERRTADPRAEALLAGIHHGPTGIRLACERAYLQELDGSC 250

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
            + IAG +  +G  ++  G +L  DG             DA   GRD A+ +   + +  
Sbjct: 251 ATPIAGMSVLEGDRIWLRGEILRPDGSEVIAGEIRAAASDAAEAGRDLARQLLGRAPEGF 310

Query: 305 FNF 307
           F++
Sbjct: 311 FSW 313


>gi|15241573|ref|NP_196445.1| HEMC (HYDROXYMETHYLBILANE SYNTHASE); hydroxymethylbilane synthase
           [Arabidopsis thaliana]
 gi|2495179|sp|Q43316|HEM3_ARATH RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG;
           AltName: Full=Hydroxymethylbilane synthase; Short=HMBS;
           AltName: Full=Pre-uroporphyrinogen synthase; Flags:
           Precursor
 gi|16930521|gb|AAL31946.1|AF419614_1 AT5g08280/F8L15_10 [Arabidopsis thaliana]
 gi|313150|emb|CAA51941.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
 gi|313838|emb|CAA52061.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
 gi|10178270|emb|CAC08328.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
 gi|17979402|gb|AAL49926.1| putative hydroxymethylbilane synthase [Arabidopsis thaliana]
 gi|21689853|gb|AAM67570.1| putative hydroxymethylbilane synthase [Arabidopsis thaliana]
 gi|332003894|gb|AED91277.1| Porphobilinogen deaminase [Arabidopsis thaliana]
          Length = 382

 Score =  232 bits (591), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 132/297 (44%), Positives = 184/297 (61%), Gaps = 6/297 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A+ETR  L   H   +    I I  + T GD+I ++ L +IGGKGL
Sbjct: 75  IRIGTRGSPLALAQAYETREKLKKKHPELVEDGAIHIEIIKTTGDKILSQPLADIGGKGL 134

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI++ LI+G ID AVHS KD+PT L +   +   LPRED+RD FI  TA +L +L  
Sbjct: 135 FTKEIDEALINGHIDIAVHSMKDVPTYLPEKTILPCNLPREDVRDAFICLTAATLAELPA 194

Query: 124 HSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            SV+GT+SLRRK+ +L     + V + FRG ++TRL+KL   K  A LLA AG+KRL   
Sbjct: 195 GSVVGTASLRRKSQILHKYPALHVEENFRGNVQTRLSKLQGGKVQATLLALAGLKRLSMT 254

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  IL++++  P+  QGAI I    ++ K    +  +NHE+T  +++CERAFL  LDG
Sbjct: 255 ENVASILSLDEMLPAVAQGAIGIACRTDDDKMATYLASLNHEETRLAISCERAFLETLDG 314

Query: 243 SCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYI 296
           SC++ IAG+A   +     F G+V + DG    E SR G     D + +G+DA Q +
Sbjct: 315 SCRTPIAGYASKDEEGNCIFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQEL 371


>gi|296446253|ref|ZP_06888200.1| porphobilinogen deaminase [Methylosinus trichosporium OB3b]
 gi|296256290|gb|EFH03370.1| porphobilinogen deaminase [Methylosinus trichosporium OB3b]
          Length = 308

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 128/296 (43%), Positives = 168/296 (56%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M      IGTR SPLALA   E R  L      P   + I  + T GD I +R L E GG
Sbjct: 1   MTTAILTIGTRGSPLALAQTHEVRRLLAAALGAPEEALPIEIIRTTGDMIQDRPLAESGG 60

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT E++  L  G ID AVHS+KD+PT L   + I+ +LPRED+RD +I     SL D
Sbjct: 61  KGLFTRELDIALAEGRIDLAVHSSKDLPTHLPPEIAIAGFLPREDVRDAWIGRGGASLAD 120

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT+SLRR A + R R D+SV   RG +ETRL+K+ + +    LLA AG+KRL 
Sbjct: 121 LPQGAVVGTASLRRGAQVKRLRPDVSVTLLRGNVETRLHKVESGEVDGTLLALAGLKRLG 180

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
                  IL +EDF P+ GQGAI I     + + ++ +  I    T  ++  ERAFL  L
Sbjct: 181 LADKATAILPLEDFLPAAGQGAIAITKRAGDARTRDALAPILDAATGAALAAERAFLTVL 240

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           DGSC++ IA  A   G  + F+G+ L +DG   +E  R G   DA  +G DAA  I
Sbjct: 241 DGSCRTPIAAHARVDGDAMEFHGLALRADGSEIYEARRRGAAIDAARLGDDAANEI 296


>gi|288957245|ref|YP_003447586.1| hydroxymethylbilane synthase [Azospirillum sp. B510]
 gi|288909553|dbj|BAI71042.1| hydroxymethylbilane synthase [Azospirillum sp. B510]
          Length = 312

 Score =  231 bits (589), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 134/307 (43%), Positives = 175/307 (57%), Gaps = 2/307 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEI 58
           M   P RIGTR SPLALA A ETR  L+  H     P  I I+   T GDRI +RTL E 
Sbjct: 1   MTTHPLRIGTRGSPLALAQAHETRDRLIAAHPHLAAPGAIEIVVFKTTGDRILDRTLAEA 60

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLFT+E+E+ L  G  D AVHS KD+PT+L  GL+I+  LPRED RD F S +   L
Sbjct: 61  GGKGLFTKELEEALFDGRADLAVHSMKDVPTQLPDGLEIATLLPREDPRDAFFSRSGGGL 120

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            DL   +V+GT+ LRR+A +L  R D+ +   RG ++TRL+KL+  +  A LLA AG++R
Sbjct: 121 ADLPAGAVVGTAGLRRQAQVLELRPDLRIFPLRGNVQTRLSKLDAGEVDATLLALAGLRR 180

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L     I  +L  E   P+  QGAI IE    +   + L+  +N  +T   V  ERA LA
Sbjct: 181 LGLTGRISAVLEPETMLPAVAQGAIGIEIRSADDATRALLAPLNCAETMVRVTAERALLA 240

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            LDGSC++ IA  A   G  L+    VL+ DG+      R G   +A ++G DA   IR 
Sbjct: 241 ALDGSCRTPIAALALLDGDALHLRAKVLSCDGRSIFRAERRGKAANAESLGADAGAEIRA 300

Query: 299 ISNKNVF 305
               + F
Sbjct: 301 QLPPDFF 307


>gi|218190145|gb|EEC72572.1| hypothetical protein OsI_06012 [Oryza sativa Indica Group]
          Length = 358

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 127/307 (41%), Positives = 182/307 (59%), Gaps = 7/307 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  L   H        + I+ + T GD I ++ L +IGGKGL
Sbjct: 50  IRIGTRGSPLALAQAHETRDKLKAAHSELAEEGAVEIVIIKTTGDMILDKPLADIGGKGL 109

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FI  TA SL +L  
Sbjct: 110 FTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTASSLAELPA 169

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+G++SLRR++ +L     + V++FRG ++TRL KL     HA LLA AG+KRL   +
Sbjct: 170 GSVVGSASLRRQSQILYKYPSLKVVNFRGNVQTRLRKLKEGDVHATLLALAGLKRLNMAE 229

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
               +L++++  P+  QGAI I    ++      +  +NHEDT  +V CER FL+ LDG+
Sbjct: 230 TATSVLSVDEMLPAVAQGAIGIACRSSDDTMMNYLSSLNHEDTRLAVACEREFLSVLDGN 289

Query: 244 CKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRCD---AINIGRDAAQYIRFI 299
           C++ IA +A   K     F G++ + DG   +E SR G+  D    + +G+DA   ++  
Sbjct: 290 CRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGSY-DFDIMVEMGKDAGHELKAK 348

Query: 300 SNKNVFN 306
           +    F+
Sbjct: 349 AGPGFFD 355


>gi|168034136|ref|XP_001769569.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162679111|gb|EDQ65562.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 361

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 135/305 (44%), Positives = 186/305 (60%), Gaps = 4/305 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           RIGTR SPLALA A++TR  L   H        + I+ + T GD+I ++ L +IGGKGLF
Sbjct: 57  RIGTRGSPLALAQAYQTRDKLKAAHPELAEEGALDIVIIKTTGDKILSQPLADIGGKGLF 116

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EI+  L++G+ID AVHS KD+PT L +G  +   LPRED+RD FI     SL +L   
Sbjct: 117 TKEIDDALLNGDIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICPKYSSLAELPEG 176

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           SV+G++SLRR++ LL     + V++FRG ++TRL KLN     A LLA AG+KRL   + 
Sbjct: 177 SVVGSASLRRQSQLLHRYPHLQVVNFRGNVQTRLRKLNEGVCAATLLALAGLKRLDMTEH 236

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I  IL  +D  P+  QGAI I     + K +E +  +NHEDT  +++CERAFLA+LDGSC
Sbjct: 237 ITAILETDDMLPAIAQGAIGIACRTGDTKMEEYLASLNHEDTRLAISCERAFLAKLDGSC 296

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFISNK 302
           ++ IAG A        F G+V  +DGK   E SR G+    D I + +DA Q +   +  
Sbjct: 297 RTPIAGLAQRTEDGCLFRGLVATTDGKQVLETSRTGSFSYDDMIALAQDAGQELISRAGP 356

Query: 303 NVFNF 307
             F +
Sbjct: 357 GFFQW 361


>gi|115444475|ref|NP_001046017.1| Os02g0168800 [Oryza sativa Japonica Group]
 gi|75259105|sp|Q6H6D2|HEM3_ORYSJ RecName: Full=Porphobilinogen deaminase, chloroplastic; Short=PBG;
           AltName: Full=Hydroxymethylbilane synthase; Short=HMBS;
           AltName: Full=Pre-uroporphyrinogen synthase; Flags:
           Precursor
 gi|49388602|dbj|BAD25717.1| putative porphobilinogen deaminase [Oryza sativa Japonica Group]
 gi|113535548|dbj|BAF07931.1| Os02g0168800 [Oryza sativa Japonica Group]
 gi|222622259|gb|EEE56391.1| hypothetical protein OsJ_05540 [Oryza sativa Japonica Group]
          Length = 358

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 181/306 (59%), Gaps = 5/306 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  L   H        + I+ + T GD I ++ L +IGGKGL
Sbjct: 50  IRIGTRGSPLALAQAHETRDKLKAAHSELAEEGAVEIVIIKTTGDMILDKPLADIGGKGL 109

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FI  TA SL +L  
Sbjct: 110 FTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTASSLAELPA 169

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+G++SLRR++ +L     + V++FRG ++TRL KL     HA LLA AG+KRL   +
Sbjct: 170 GSVVGSASLRRQSQILYKYPSLKVVNFRGNVQTRLRKLKEGDVHATLLALAGLKRLNMAE 229

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
               +L++++  P+  QGAI I    ++      +  +NHEDT  +V CER FL+ LDG+
Sbjct: 230 TATSVLSVDEMLPAVAQGAIGIACRSSDDTMMNYLSSLNHEDTRLAVACEREFLSVLDGN 289

Query: 244 CKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNG--NRCDAINIGRDAAQYIRFIS 300
           C++ IA +A   K     F G++ + DG   +E SR G  +    + +G+DA   ++  +
Sbjct: 290 CRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGPYDFDIMVEMGKDAGHELKAKA 349

Query: 301 NKNVFN 306
               F+
Sbjct: 350 GPGFFD 355


>gi|254511195|ref|ZP_05123262.1| porphobilinogen deaminase [Rhodobacteraceae bacterium KLH11]
 gi|221534906|gb|EEE37894.1| porphobilinogen deaminase [Rhodobacteraceae bacterium KLH11]
          Length = 318

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 123/276 (44%), Positives = 168/276 (60%), Gaps = 5/276 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A+ETR  L     +P     I+ + T GD       +R L E+G 
Sbjct: 11  PLKIGTRGSPLALAQAYETRRRLSTAFDLPEDAFEIVVIKTTGDNRAMIDADRPLKEVGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ ++ GEID AVHS KDMP    +GL +  +LPRED+RD FIS    S+ D
Sbjct: 71  KGLFTKEIEEAMLKGEIDIAVHSTKDMPVAQPQGLVLDTFLPREDVRDAFISPGLNSIHD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D+ V++FRG ++TRL KL +  A    LA AG++RL+
Sbjct: 131 LPRGAVVGTSSLRRRAQLLNRRPDLKVVEFRGNVQTRLKKLADGVADCTFLAMAGLRRLE 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V    ++ +D  P+  QGAI IE   ++ +A  ++  I+H +T   +  ER+ LA L
Sbjct: 191 MADVPATAISPDDMLPAIAQGAIGIERRNDDSRAAGMLAAIHHPETAQRLAAERSLLAGL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG-KIFHE 275
           DGSC++ IAG A  +   L   G VL  DG +  HE
Sbjct: 251 DGSCETPIAGLAEIRDGQLRLRGEVLRPDGTESIHE 286


>gi|224008054|ref|XP_002292986.1| porphobilinogen deaminase [Thalassiosira pseudonana CCMP1335]
 gi|220971112|gb|EED89447.1| porphobilinogen deaminase [Thalassiosira pseudonana CCMP1335]
          Length = 330

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 124/309 (40%), Positives = 181/309 (58%), Gaps = 8/309 (2%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHN----IVIIPLSTKGDRITNRTLTEIGG 60
           P RIGTR SPLALA A+ETR  L  +   P       I I  + T+GD I +++L E+GG
Sbjct: 9   PLRIGTRGSPLALAQAYETRRRL--IENFPELEAEGAIEICVMKTQGDMILDKSLMELGG 66

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA--QSL 118
           KGLFT+E++  L+  E+D  VHS KD+PT L +G  +   LPRED  D FI+     + +
Sbjct: 67  KGLFTKELDTALLGDEVDICVHSMKDVPTWLPEGTVLPCNLPREDTNDAFITANGDIKRI 126

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            DL  +SVIGT+SLRR+A +L     +  ++FRG ++TRL KL++    A LLA AG+KR
Sbjct: 127 ADLPDNSVIGTASLRRQAQILAQNPTLKCVNFRGNVQTRLRKLDDGVVDATLLAIAGLKR 186

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           +  +     IL  ++  P+  QGAI I+   ++ ++ + +  +N  DT   VNCERAFL 
Sbjct: 187 MDMDDCATAILEWDEMLPAVAQGAIGIQCRSDDTRSLKYIDALNCMDTHVCVNCERAFLE 246

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
            LDG+CK+ IAG A      + F G++   DG + +E    G   DA+ IGR A + ++ 
Sbjct: 247 ALDGNCKTPIAGQARIVDGKIVFKGLIAMPDGSLKYETEATGEIADAVEIGRKAGEELKA 306

Query: 299 ISNKNVFNF 307
            + +  F  
Sbjct: 307 QAGEKFFEM 315


>gi|154251802|ref|YP_001412626.1| porphobilinogen deaminase [Parvibaculum lavamentivorans DS-1]
 gi|154155752|gb|ABS62969.1| porphobilinogen deaminase [Parvibaculum lavamentivorans DS-1]
          Length = 308

 Score =  228 bits (581), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 131/305 (42%), Positives = 182/305 (59%), Gaps = 1/305 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFET-RSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           ++ +RIGTR S LAL  A E  R   + +H        I+ +ST GDR+ +R L+EIGGK
Sbjct: 2   QRRYRIGTRGSRLALIQANEVARRIALALHAPVEEVTEIVVISTAGDRVQDRALSEIGGK 61

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFTEEIE++L    ID AVHS KDMPT L +GL I   L R D RD F+S  A SL  L
Sbjct: 62  GLFTEEIEEQLADARIDVAVHSMKDMPTLLPEGLVIDCLLERADPRDAFLSSKANSLMSL 121

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GTSSLRR A +   R D++V+ FRG ++TRL KL +  A A LLA AG+ R+  
Sbjct: 122 PQGAVVGTSSLRRAAQVRARRPDVTVVPFRGNVDTRLKKLADGVADATLLAMAGLTRMDL 181

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            + +   L+ E+  P+  QGAI IE    + +A  L++ ++H +T   V  ERAFLA LD
Sbjct: 182 LECVTAPLSPEELLPAVAQGAIGIERRAADDEAAHLLEKLHHTETGLRVAAERAFLAVLD 241

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IA  A   G  +    ++L  DG   HE  R G   DA+ +G+DA + ++  + 
Sbjct: 242 GSCRTPIAALAEISGDHMRLRTMILTPDGAEIHETEREGLAADAVLLGQDAGEELKGRAG 301

Query: 302 KNVFN 306
            + F+
Sbjct: 302 PHFFD 306


>gi|21592624|gb|AAM64573.1| hydroxymethylbilane synthase [Arabidopsis thaliana]
          Length = 382

 Score =  228 bits (581), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 183/297 (61%), Gaps = 6/297 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A+ETR  L   H   +    I I  + T GD+I ++ L +IGGKGL
Sbjct: 75  IRIGTRGSPLALAQAYETREKLKKKHPELVEDGAIHIEIIKTTGDKILSQPLADIGGKGL 134

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI++ LI+G ID AVHS K +PT L +   +   LPRED+RD FI  TA +L +L  
Sbjct: 135 FTKEIDEALINGHIDIAVHSMKYVPTYLPEKTILPCNLPREDVRDAFICLTAATLAELPA 194

Query: 124 HSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            SV+GT+SLRRK+ +L     + V + FRG ++TRL+KL   K  A LLA AG+KRL   
Sbjct: 195 GSVVGTASLRRKSQILHKYPALHVEENFRGNVQTRLSKLQGGKVQATLLALAGLKRLSMT 254

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  IL++++  P+  QGAI I    ++ K    +  +NHE+T  +++CERAFL  LDG
Sbjct: 255 ENVASILSLDEMLPAVAQGAIGIACRTDDDKMATYLASLNHEETRLAISCERAFLETLDG 314

Query: 243 SCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYI 296
           SC++ IAG+A   +     F G+V + DG    E SR G     D + +G+DA Q +
Sbjct: 315 SCRTPIAGYASKDEEGNCIFRGLVASPDGTKVLETSRKGPYVYEDMVKMGKDAGQEL 371


>gi|190683048|gb|ACE81820.1| hydroxymethylbilane synthetase [Oxyrrhis marina]
          Length = 395

 Score =  228 bits (580), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 181/301 (60%), Gaps = 3/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR SPLALA A +  S   +  +     I I  +ST+GDRI +R L ++GGKGLFT
Sbjct: 76  LRIGTRGSPLALAQARDVESRAREQLQ-QGGEIDICVISTEGDRILDRALADVGGKGLFT 134

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+++ L+SGE+DC VHS KD+PT +  G +I AYLPRED RDVF+S    +L DL   +
Sbjct: 135 KELDRALLSGEVDCCVHSMKDVPTTVAPGTEIVAYLPREDTRDVFLSAKYATLADLPDGA 194

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GT+SLRR+A +L  + ++ V +FRG ++TRL KL         LAYAG+KRL      
Sbjct: 195 VVGTASLRRQAQILAQK-NVVVTNFRGNVQTRLRKLAAGTVDCTFLAYAGLKRLGMLAEA 253

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L   D  P+  QGA+ I+   N+   +  +  ++HE T  +V  ERAFL  LDGSC+
Sbjct: 254 TQVLEWSDMLPAIAQGAVGIQIRSNDAALRGTLSQLDHEPTRLAVETERAFLRALDGSCR 313

Query: 246 SAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           + IAG A+    S L F G VL++DGK   E   +   CD   +G+     +R  + +  
Sbjct: 314 TPIAGQAWIGPDSRLAFRGQVLSADGKQRFERVGDCLPCDGPELGKTLGDDLRREAGEEF 373

Query: 305 F 305
           F
Sbjct: 374 F 374


>gi|302756929|ref|XP_002961888.1| hypothetical protein SELMODRAFT_164683 [Selaginella moellendorffii]
 gi|300170547|gb|EFJ37148.1| hypothetical protein SELMODRAFT_164683 [Selaginella moellendorffii]
          Length = 353

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 132/314 (42%), Positives = 190/314 (60%), Gaps = 17/314 (5%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHN--IVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A++TR  L   H     +  + I+ + T GD+I N+ L +IGGKGL
Sbjct: 44  IRIGTRGSPLALAQAYQTRDLLKGAHPELAEDGALEIVIIKTTGDKILNQPLADIGGKGL 103

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L+   ID AVHS KD+PT L +G  +   L RED RD FIS  A+SL +L  
Sbjct: 104 FTKEIDDALLDNRIDIAVHSMKDVPTYLPQGTILPCNLRREDARDAFISLKAKSLAELPP 163

Query: 124 HSVIGTSSLRRKALLLRWRSDISV-IDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            SV+GT+SLRRK+ +L+    + V  +FRG ++TRL KL      A LLA AG+KRL   
Sbjct: 164 GSVVGTASLRRKSQILKRYPHLQVDTNFRGNVQTRLKKLQEGIVTATLLALAGLKRLNMT 223

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  +L +++  P+  QGAI I     + K +  +  +NHE+T  +V+CERAFL  LDG
Sbjct: 224 EHVTGVLPMDEMLPAIAQGAIGIACRQGDEKMERYLASLNHEETRLAVSCERAFLEMLDG 283

Query: 243 SCKSAIAGFAY-------CKGSTLYFYGIVLASDGKIFHEVSRNG--NRCDAINIGRDAA 293
           SC++ IAG+A+       CK     F G+V + DG    E +R+G  N  + + +G+DAA
Sbjct: 284 SCRTPIAGYAHRDKLTDECK-----FRGLVASPDGTQVLETTRSGQYNLDEMVAMGKDAA 338

Query: 294 QYIRFISNKNVFNF 307
           + +   S  ++ N+
Sbjct: 339 KELLSKSGPSLLNW 352


>gi|303274460|ref|XP_003056550.1| porphobilinogen deaminase, chloroplast precursor [Micromonas
           pusilla CCMP1545]
 gi|226462634|gb|EEH59926.1| porphobilinogen deaminase, chloroplast precursor [Micromonas
           pusilla CCMP1545]
          Length = 376

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 184/305 (60%), Gaps = 8/305 (2%)

Query: 7   RIGTRCSPLALAHAFETRSSL----MDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           +IGTR SPLALA A+ TR  L    +++ +     I II   T GD++ ++ L +IGGKG
Sbjct: 64  KIGTRGSPLALAQAYMTRDLLKKNFVELSEEGALEICII--KTTGDKVLDQPLADIGGKG 121

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT E++  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FIS     L +L 
Sbjct: 122 LFTRELDVALLDGRIDIAVHSMKDVPTYLPEGSILPCMLPREDVRDAFISVKYDDLSELP 181

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +++GT+SLRR++ LL     +  ++FRG +++R+ KL        LLA AG+ R+   
Sbjct: 182 DGALVGTASLRRQSQLLAKFPTLKCVNFRGNVQSRIRKLQEGVVDCTLLAIAGLNRMDMT 241

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           +   +IL  +   P+  QGAI I     + +  E ++ +NHE+T  +V CERAFLA LDG
Sbjct: 242 EHATKILETDVMLPAVAQGAIGIACRTGDSRQLEFLEKLNHEETRIAVECERAFLASLDG 301

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNR--CDAINIGRDAAQYIRFIS 300
           SC++ IAG+AY  G+ L F G+V + DGK   E +R+ N    DAI+ G+DA   ++ ++
Sbjct: 302 SCRTPIAGYAYKSGNNLEFRGLVASLDGKQILETTRSSNWSFTDAIDAGKDAGNELKALA 361

Query: 301 NKNVF 305
               F
Sbjct: 362 PSEFF 366


>gi|302817137|ref|XP_002990245.1| hypothetical protein SELMODRAFT_447969 [Selaginella moellendorffii]
 gi|300141954|gb|EFJ08660.1| hypothetical protein SELMODRAFT_447969 [Selaginella moellendorffii]
          Length = 353

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 132/314 (42%), Positives = 190/314 (60%), Gaps = 17/314 (5%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHN--IVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A++TR  L   H     +  + I+ + T GD+I N+ L +IGGKGL
Sbjct: 44  IRIGTRGSPLALAQAYQTRDLLKGAHPELAEDGALEIVIIKTTGDKILNQPLADIGGKGL 103

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L+   ID AVHS KD+PT L +G  +   L RED RD FIS  A+SL +L  
Sbjct: 104 FTKEIDDALLDNRIDIAVHSMKDVPTYLPQGTILPCNLRREDARDAFISLKAKSLAELPP 163

Query: 124 HSVIGTSSLRRKALLLRWRSDISV-IDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            SV+GT+SLRRK+ +L+    + V  +FRG ++TRL KL      A LLA AG+KRL   
Sbjct: 164 GSVVGTASLRRKSQILKRYPHLQVDTNFRGNVQTRLKKLQEGIVTATLLALAGLKRLNMT 223

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + +  +L +++  P+  QGAI I     + K +  +  +NHE+T  +V+CERAFL  LDG
Sbjct: 224 EHVTGVLPMDEMLPAIAQGAIGIACRQGDEKMERYLASLNHEETRLAVSCERAFLEMLDG 283

Query: 243 SCKSAIAGFAY-------CKGSTLYFYGIVLASDGKIFHEVSRNG--NRCDAINIGRDAA 293
           SC++ IAG+A+       CK     F G+V + DG    E +R+G  N  + + +G+DAA
Sbjct: 284 SCRTPIAGYAHRDKLTDECK-----FRGLVASPDGTQVLETTRSGQYNFDEMVAMGKDAA 338

Query: 294 QYIRFISNKNVFNF 307
           + +   S  ++ N+
Sbjct: 339 KELLSKSGPSLLNW 352


>gi|289548019|ref|YP_003473007.1| porphobilinogen deaminase [Thermocrinis albus DSM 14484]
 gi|289181636|gb|ADC88880.1| porphobilinogen deaminase [Thermocrinis albus DSM 14484]
          Length = 300

 Score =  226 bits (576), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 180/291 (61%), Gaps = 6/291 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A   +  L D+     H + ++P++T GD+IT+  L +IGGKGLF 
Sbjct: 3   IRIGTRRSQLALWQANYVKRKLEDMG----HTVELVPITTTGDKITDAPLAKIGGKGLFV 58

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G+ID AVHS KD+PTKL  GL + A   RE   DV IS   Q L++L   +
Sbjct: 59  KEIEEALLRGDIDVAVHSLKDVPTKLPDGLTLGAITERELPYDVLISRDGQRLENLPTGA 118

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRRK  + R R D+ + D RG ++TR+ KL+  +  AI+LAYAGI+R+  E  I
Sbjct: 119 VVGTSSLRRKVQIKRMRRDLVIKDLRGNVDTRIRKLDEGQYDAIVLAYAGIRRMGWENRI 178

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            +IL  EDF P+ GQG++ +E   ++ K +E++ +++H ++   V  ERAFL  ++G C+
Sbjct: 179 VQIL--EDFIPAVGQGSMAVEIREDDEKIREVISLLDHRESRIRVEAERAFLEVMEGGCQ 236

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +   A+  GS L+  G +   +G+ F E    GN   A  +GR+ A+ I
Sbjct: 237 VPMGAIAWLDGSRLFMKGFLSDLEGENFVEAYVEGNVEKAQLLGRELAEKI 287


>gi|168057909|ref|XP_001780954.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162667588|gb|EDQ54214.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 299

 Score =  226 bits (575), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 127/299 (42%), Positives = 179/299 (59%), Gaps = 4/299 (1%)

Query: 13  SPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEK 70
           SPLALA A++TR  L   H        + II + T GD+I ++ L +IGGKGLFT+EI+ 
Sbjct: 1   SPLALAQAYQTRDKLKAAHPGLAEEGALEIIIIKTTGDKILSQPLADIGGKGLFTKEIDD 60

Query: 71  KLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTS 130
            L++G+ID AVHS KD+PT L +G  +   LPRED+RD FI     SL +L   SV+G++
Sbjct: 61  ALLNGDIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICPNYSSLAELPEGSVVGSA 120

Query: 131 SLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILN 190
           SLRR++ +L     + V +FRG ++TRL KL+     A LLA AG+KRL   + I  IL 
Sbjct: 121 SLRRQSQILHKYPHLKVENFRGNVQTRLRKLSEGTVQATLLALAGLKRLDMTEHITAILA 180

Query: 191 IEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAG 250
            +D  P+  QGAI I     + K +E +  +NHE T  +++CERAFLA+LDGSC++ IAG
Sbjct: 181 TDDMLPAIAQGAIGIACRTGDSKMEEYLASLNHEGTRLAISCERAFLAKLDGSCRTPIAG 240

Query: 251 FAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFISNKNVFNF 307
            A        F G+V  +DGK   E SR G+    D I + +DA   +   +  + F +
Sbjct: 241 LAERTEDGCSFRGLVATTDGKQVLETSRKGSFSYDDMIALAQDAGAELISRAGPDFFKW 299


>gi|294676723|ref|YP_003577338.1| hydroxymethylbilane synthase [Rhodobacter capsulatus SB 1003]
 gi|12280937|gb|AAG50298.1| porphobilinogen deaminase [Rhodobacter capsulatus]
 gi|294475543|gb|ADE84931.1| hydroxymethylbilane synthase [Rhodobacter capsulatus SB 1003]
          Length = 317

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 178/305 (58%), Gaps = 4/305 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRIT----NRTLTEIGG 60
           P +IGTR SPLALA AFETRS LM    +P     I+ + T GD       ++ L E+GG
Sbjct: 10  PLKIGTRGSPLALAQAFETRSRLMAAFDLPEEAFEIVVIKTSGDNAALIAADKPLKEVGG 69

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ +++G ID AVHS KDMPT   +GL +  YLPRED RD F+S    SL +
Sbjct: 70  KGLFTKEIEEAMLAGSIDIAVHSMKDMPTLQPEGLILDCYLPREDTRDAFVSMKYNSLAE 129

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A L   R D+ +++FRG ++TR+ KL    A A  LA AG+ RL 
Sbjct: 130 LPEGAVVGTSSLRRRAQLAARRPDLKMVEFRGNVQTRMKKLGEGVADATFLALAGLNRLG 189

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             +V K  +  ED  P+  QG I IE    + +A+ L+  I+H  +   + CER+FL  L
Sbjct: 190 MSEVAKSAIEPEDMLPAVAQGCIGIERREADTRAKMLLDAIHHAPSGLRLACERSFLLTL 249

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ I G +  +G  ++  G +L  DG         G   D + +G + A+ +   +
Sbjct: 250 DGSCETPIGGLSVLEGDQIWLRGEILRPDGSETITGEIRGPAADGVALGAELAKQLLAKA 309

Query: 301 NKNVF 305
             + F
Sbjct: 310 PADFF 314


>gi|154245106|ref|YP_001416064.1| porphobilinogen deaminase [Xanthobacter autotrophicus Py2]
 gi|154159191|gb|ABS66407.1| porphobilinogen deaminase [Xanthobacter autotrophicus Py2]
          Length = 317

 Score =  225 bits (573), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 172/302 (56%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR SPLAL  A   +++L     +    I +  + T GD+I +R L+E GGKGLFT
Sbjct: 16  LRIGTRGSPLALWQAHAVQAALAVALGVEKEAIAVEVIKTSGDQIQDRALSEAGGKGLFT 75

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G +D AVHSAKD+ T L  GL ++ YLPR D+RD  I  +  +L DL   +
Sbjct: 76  KEIEEALLDGRVDLAVHSAKDVATVLPDGLHLAGYLPRADVRDALILKSGAALADLPAGA 135

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GT+SLRR+A L R R D+ V   RG + TRL K+ +    A LLA AG+ RL   +  
Sbjct: 136 KVGTASLRREAQLRRIRPDLKVELLRGNVHTRLAKVKDGDFDATLLALAGLTRLGMAQAA 195

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L  +DF P+ GQGA+ IE  + +P     +  I   DT  ++  ERAFLA LDGSC+
Sbjct: 196 SCVLATDDFLPAVGQGAVAIECRIADPDTNAAIAAIACRDTGIALEAERAFLAALDGSCR 255

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           + IAG A  +G ++   G+VL+ DG    E++      DA  +G +    +R  +     
Sbjct: 256 TPIAGLATVEGESVRLRGLVLSPDGSDAAEIAELAPIADAARLGAECGARLRTSAPARAL 315

Query: 306 NF 307
             
Sbjct: 316 GL 317


>gi|260431649|ref|ZP_05785620.1| porphobilinogen deaminase [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415477|gb|EEX08736.1| porphobilinogen deaminase [Silicibacter lacuscaerulensis ITI-1157]
          Length = 320

 Score =  224 bits (571), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 130/307 (42%), Positives = 178/307 (57%), Gaps = 4/307 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDR----ITNRTLTEIGG 60
           P +IGTR SPLALA A ETR  L D   +P     I+ + T GD       +R L EIG 
Sbjct: 11  PLKIGTRGSPLALAQAHETRQRLCDAFDLPEQAFEIVVIKTTGDNRAMIDADRPLKEIGN 70

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ ++ G ID AVHS KDMP +  +GL +  +LPRED+RD FIS    S+ D
Sbjct: 71  KGLFTKEIEEAMLGGYIDIAVHSTKDMPVEQPQGLVLDTFLPREDVRDAFISPRLNSIHD 130

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+A LL  R D++V++FRG ++TRL KL +  A    LA AG++RL 
Sbjct: 131 LPEGAVVGTSSLRRRAQLLYRRPDLNVVEFRGNVQTRLKKLADGVAECTFLAMAGLRRLN 190

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            + V    ++ +D  P+  QG I IE   ++ +A E+++ I+H +T   +  ERA LA L
Sbjct: 191 MQDVPATAISPDDMLPAIAQGTIGIERRADDHRAAEMLEAIHHPETAQRLAAERALLAAL 250

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           DGSC++ IAG A      L   G VL  DG       + G   DA  +GR  A  +   +
Sbjct: 251 DGSCETPIAGLAEITDGQLRLRGEVLRPDGSESVVSEQMGATEDATEMGRAMASDLLRQA 310

Query: 301 NKNVFNF 307
               F +
Sbjct: 311 GPGFFEW 317


>gi|254488942|ref|ZP_05102147.1| porphobilinogen deaminase [Roseobacter sp. GAI101]
 gi|214045811|gb|EEB86449.1| porphobilinogen deaminase [Roseobacter sp. GAI101]
          Length = 297

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 165/291 (56%)

Query: 17  LAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLISGE 76
           +A A ETR+ L     +P     I+ +   GD I +R L EIGGKGLFT EIE+ L++G+
Sbjct: 1   MAQAVETRARLSAAFDLPLTAFEIVVIKVTGDMIQDRPLKEIGGKGLFTREIEEDLLAGK 60

Query: 77  IDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLRRKA 136
           ID AVHS KDMPT    GL +  YLPRED RD F++    +L  L   +V+GTSSLRR+A
Sbjct: 61  IDIAVHSMKDMPTVQPGGLLLDTYLPREDPRDAFVAPLMSALDQLTEGAVVGTSSLRRRA 120

Query: 137 LLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDFPP 196
            LL  R D+ V++FRG ++TRL KL +  A    LA AG+ RL  E V    ++  D  P
Sbjct: 121 QLLHKRPDLQVVEFRGNVQTRLRKLADGVAECTFLAMAGLNRLGMENVPATPIDDTDMLP 180

Query: 197 SPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAYCKG 256
           +  QGAI IE    +   + L+  I+   T   +  ERAFL  LDGSC++ IAG A   G
Sbjct: 181 AVAQGAIGIERRAGDLDTEALLAAIHDTPTGQRLIAERAFLLTLDGSCETPIAGLATLDG 240

Query: 257 STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFNF 307
            TL+  G VL  DG       R+G   D   +G D A+ +   +  N F++
Sbjct: 241 DTLHLRGEVLRPDGSEVISGDRSGPIGDGGQMGVDLARELLSQAGPNFFDW 291


>gi|254440462|ref|ZP_05053956.1| porphobilinogen deaminase [Octadecabacter antarcticus 307]
 gi|198255908|gb|EDY80222.1| porphobilinogen deaminase [Octadecabacter antarcticus 307]
          Length = 321

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 177/308 (57%), Gaps = 10/308 (3%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTE------- 57
           P +IGTR SPLALA A ETR+ LM    +      +  + T GD   +R+L +       
Sbjct: 11  PLKIGTRGSPLALAQAHETRARLMVAFDLAEAAFEVCVIKTTGD---DRSLIDADIPLKV 67

Query: 58  IGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQS 117
           IG KGLFT+EIE+ +++G+ID AVHS KDMP     GL +  +LPRED RD F+S     
Sbjct: 68  IGNKGLFTKEIEEAMLAGQIDIAVHSTKDMPVAQPDGLVLDVFLPREDARDAFVSVKYSG 127

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           + DL   +++GTSSLRR+A LL  R D++V++FRG ++TRL KL +  A A  LA AG+ 
Sbjct: 128 IPDLPEGAIVGTSSLRRRAQLLAKRPDLTVVEFRGNVQTRLKKLADGLADATFLAMAGLN 187

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           R+  +      +++ D  P+  QG I IE  +++ +A++++  I+       +  ER+FL
Sbjct: 188 RMGMDDAAMGAIDLADMLPAIAQGTISIERRIDDLRARDMLAAIHDVQAGQQMAAERSFL 247

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           A LDGSC++ IAG A   G  ++  G +L  DG       R G   +   +G++ AQ + 
Sbjct: 248 AALDGSCETPIAGLAMIDGDNMWLRGEILKPDGSQVFTGERRGLVTEGRAMGKELAQELL 307

Query: 298 FISNKNVF 305
             +  + F
Sbjct: 308 GQAGPDFF 315


>gi|209965647|ref|YP_002298562.1| porphobilinogen deaminase [Rhodospirillum centenum SW]
 gi|209959113|gb|ACI99749.1| porphobilinogen deaminase [Rhodospirillum centenum SW]
          Length = 323

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 131/298 (43%), Positives = 177/298 (59%), Gaps = 3/298 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           K+P RIGTR SPLALA A ETR  L + H     P  I I+ + T GDRI +RTL E GG
Sbjct: 2   KQPLRIGTRGSPLALAQAHETRRRLAEAHPHLAEPDAIEIVVIKTTGDRILDRTLMEAGG 61

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+EIE+ L +  ID AVHS KD+PT    GLQ++A LPRED RD +       L +
Sbjct: 62  KGLFTKEIEEALQAETIDLAVHSMKDVPTWRQTGLQLTAMLPREDPRDAWFCRHGCGLDE 121

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT+SLRR+A +L  R D+ V+ FRG ++TR+ KL   +  A LLA AG++RL 
Sbjct: 122 LPAGAVVGTASLRRQAQILARRPDLKVVPFRGNVQTRMTKLAEGQVDATLLALAGLRRLG 181

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + +   +  +   P+  QGAI IET   +     LV  +NH +T   V  ER  LA L
Sbjct: 182 LVEHMTAAIETDVMLPAVAQGAIGIETRAADDVTNALVAALNHAETMTRVTAERGVLATL 241

Query: 241 DGSCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           DGSC++ IA  A   G  +L    +V+  +G+ F+   R G+  DA  +G DA Q ++
Sbjct: 242 DGSCRTPIAALAELPGDGSLTLSALVIRPNGQEFYRTERRGDPDDAEAMGIDAGQELK 299


>gi|254452699|ref|ZP_05066136.1| porphobilinogen deaminase [Octadecabacter antarcticus 238]
 gi|198267105|gb|EDY91375.1| porphobilinogen deaminase [Octadecabacter antarcticus 238]
          Length = 321

 Score =  223 bits (567), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 120/309 (38%), Positives = 177/309 (57%), Gaps = 10/309 (3%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTE------- 57
           P +IGTR SPLALA A ETR+ LM    +P     +  + T GD   +R+L +       
Sbjct: 11  PLKIGTRGSPLALAQAHETRARLMIAFDLPESAFEVCVIKTSGD---DRSLIDADIPLKV 67

Query: 58  IGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQS 117
           IG KGLFT+EIE+ +++G ID AVHS KDMP     GL ++ +LPRED RD F+S     
Sbjct: 68  IGNKGLFTKEIEEAMLAGRIDIAVHSTKDMPVAQPDGLVLNVFLPREDARDAFVSVKYAG 127

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           + DL   +++GTSSLRR+A LL  R D++V++FRG ++TRL KL +  A A  LA AG+ 
Sbjct: 128 IADLPEGAIVGTSSLRRRAQLLVKRPDLTVVEFRGNVQTRLKKLADGLADATFLAMAGLN 187

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           R+         ++++D  P+  QG I IE  V++ +A++++  I++      +  ERAFL
Sbjct: 188 RMGMHDAAIGAIDLDDMLPAIAQGTISIERRVDDLRARDMLAAIHNVQAGQQMAAERAFL 247

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           A LDGSC++ IAG A      ++  G +L  DG       R G   +   +G + AQ + 
Sbjct: 248 AALDGSCETPIAGLAMIDCDQMWLRGEILKPDGSQVFTGERRGLVSEGAAMGMELAQELL 307

Query: 298 FISNKNVFN 306
             +  + F 
Sbjct: 308 GQAGPDFFE 316


>gi|194707246|gb|ACF87707.1| unknown [Zea mays]
 gi|223947939|gb|ACN28053.1| unknown [Zea mays]
          Length = 356

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 184/306 (60%), Gaps = 5/306 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  L   H        I I+ + T GD I ++ L +IGGKGL
Sbjct: 48  IRIGTRGSPLALAQAHETREKLKAAHSELAEEGAIEIVIIKTTGDMILDKPLADIGGKGL 107

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FI  TA SL +L  
Sbjct: 108 FTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLAELPA 167

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+G++SLRR++ +L     + V++FRG ++TRL KL      A LLA AG++RLK  +
Sbjct: 168 GSVVGSASLRRQSQILYRYPSLKVVNFRGNVQTRLRKLKEGDVSATLLALAGLRRLKMAE 227

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
               +L++E+  P+  QGAI I    N+ K  E +  +NHEDT  +V CER FLA LDG+
Sbjct: 228 NATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSSLNHEDTRLAVTCEREFLAVLDGN 287

Query: 244 CKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFIS 300
           C++ IA +AY  K     F G++ + DG    E +R+G     D + +G+DA   ++  +
Sbjct: 288 CRTPIAAYAYRDKDGNCSFRGLLSSPDGSKVFETARSGPYSFDDMVEMGKDAGHELKAKA 347

Query: 301 NKNVFN 306
               F+
Sbjct: 348 GPGFFD 353


>gi|212275007|ref|NP_001130048.1| hypothetical protein LOC100191140 [Zea mays]
 gi|194688160|gb|ACF78164.1| unknown [Zea mays]
          Length = 394

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 132/297 (44%), Positives = 181/297 (60%), Gaps = 5/297 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  L   H        I I+ + T GD I ++ L +IGGKGL
Sbjct: 48  IRIGTRGSPLALAQAHETREKLKAAHSELAEEGAIEIVIIKTTGDMILDKPLADIGGKGL 107

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FI  TA SL +L  
Sbjct: 108 FTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLAELPA 167

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+G++SLRR++ +L     + V++FRG ++TRL KL      A LLA AG++RLK  +
Sbjct: 168 GSVVGSASLRRQSQILYRYPSLKVVNFRGNVQTRLRKLKEGDVSATLLALAGLRRLKMAE 227

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
               +L++E+  P+  QGAI I    N+ K  E +  +NHEDT  +V CER FLA LDG+
Sbjct: 228 NATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSSLNHEDTRLAVTCEREFLAVLDGN 287

Query: 244 CKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIR 297
           C++ IA +AY  K     F G++ + DG    E +R+G     D + +G+DA   +R
Sbjct: 288 CRTPIAAYAYRDKDGNCSFRGLLSSPDGSKVFETARSGPYSFDDMVEMGKDAGHELR 344


>gi|170749246|ref|YP_001755506.1| porphobilinogen deaminase [Methylobacterium radiotolerans JCM 2831]
 gi|170655768|gb|ACB24823.1| porphobilinogen deaminase [Methylobacterium radiotolerans JCM 2831]
          Length = 307

 Score =  222 bits (566), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 122/291 (41%), Positives = 174/291 (59%), Gaps = 2/291 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +P RIGTR SP+ALA     R  ++  +  P     ++ ++T  D+I +R L+EIGG
Sbjct: 1   MLNRPLRIGTRGSPMALAQTGMVRDRIVAAN--PGLETELVVVTTVADKILDRPLSEIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E+ L +GE+D AVHS KD+ T L  GL I+  L R+D RD F+S  A  L  
Sbjct: 59  KGLFTKELEQALFAGEVDVAVHSMKDVETWLPDGLTIACILERDDPRDAFLSPHADGLAG 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           LA  + +GTSSLRR A +L  R D+ V+  RG   TR+ KL   +  A LLA AG++RL 
Sbjct: 119 LAAGARVGTSSLRRGAQVLMRRPDLRVVPLRGNANTRMRKLEAGECDATLLALAGLQRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E + + +L++E+  P+  QGA+ IE   ++   ++L+  I  E T  +V+ ERA LAEL
Sbjct: 179 LESMARSVLSVEEMLPAVAQGALGIECRADDAVIRDLLAPIACERTTVAVSAERALLAEL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRD 291
           DGSC++ IA  A   G +L   G++   DG      SR G   +A  IGR+
Sbjct: 239 DGSCRTPIAALAQIDGDSLRIDGLLFLPDGSRHWAASRQGLVAEAERIGRE 289


>gi|242060650|ref|XP_002451614.1| hypothetical protein SORBIDRAFT_04g004640 [Sorghum bicolor]
 gi|241931445|gb|EES04590.1| hypothetical protein SORBIDRAFT_04g004640 [Sorghum bicolor]
          Length = 340

 Score =  221 bits (563), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 123/299 (41%), Positives = 177/299 (59%), Gaps = 5/299 (1%)

Query: 13  SPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEK 70
           S LALA A ETR  L   H        + II + T GD I ++ L +IGGKGLFT+EI+ 
Sbjct: 41  SDLALAQARETRDKLKAAHSELAEEGAVEIIIIKTTGDMILDKPLADIGGKGLFTKEIDD 100

Query: 71  KLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTS 130
            ++ G ID AVHS KD+PT L +G  +   LPRED RD FI  TA SL +L    V+G++
Sbjct: 101 AILQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDARDAFICLTANSLAELPSGCVVGSA 160

Query: 131 SLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILN 190
           SLRR++ +L     + V++ RG ++TRL KL N   HA LLA AG+KRL   + +  IL+
Sbjct: 161 SLRRQSQILCRYPSLKVVNLRGNVQTRLTKLKNGDVHATLLALAGLKRLNMVENVTSILS 220

Query: 191 IEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAG 250
           +E+  P+  QGAI I    N+ K  E +  +NHEDT  +V CER FL  LDG+C++ IA 
Sbjct: 221 MEEMLPAVAQGAIGIACRSNDNKMMEYLSSLNHEDTRSAVACEREFLTVLDGNCRTPIAA 280

Query: 251 FAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFISNKNVFN 306
           +A+  K  +  F G++ + DG   +E +R G     D + +G+DA   ++  +    ++
Sbjct: 281 YAHRDKDGSCSFRGLLASPDGSKVYETTRIGPYSFDDMVEMGKDAGHELKAKAGPGFYD 339


>gi|89894971|ref|YP_518458.1| hypothetical protein DSY2225 [Desulfitobacterium hafniense Y51]
 gi|219669373|ref|YP_002459808.1| porphobilinogen deaminase [Desulfitobacterium hafniense DCB-2]
 gi|123091755|sp|Q24VC8|HEM3_DESHY RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800248|sp|B8G2M2|HEM3_DESHD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|89334419|dbj|BAE84014.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539633|gb|ACL21372.1| porphobilinogen deaminase [Desulfitobacterium hafniense DCB-2]
          Length = 308

 Score =  221 bits (563), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 122/290 (42%), Positives = 174/290 (60%), Gaps = 4/290 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +IGTR S LAL  A   +  L + +  P    V++P+ TKGD+I +  L +IG KGLFT+
Sbjct: 5   KIGTRDSQLALWQAEWVKRKLEEYY--PEREFVLVPMKTKGDKILDVPLAKIGDKGLFTK 62

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           E+E  L++GEIDCAVHS KD+PT L  GL+I+A+  RE+ RDVF+S     L  L   S+
Sbjct: 63  ELEVGLLNGEIDCAVHSLKDLPTVLPPGLEIAAFCEREEPRDVFLSKDGTPLGSLPAGSI 122

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           IGTSSLRRKA L  +RSD+S  D RG ++TR  KL  +    I+LA AG+KRL  E  I 
Sbjct: 123 IGTSSLRRKAQLQNYRSDLSFADLRGNLQTRWRKLQESDMAGIVLAAAGVKRLGWEDRIT 182

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E ++ E    + GQGAI +E        +E++ ++NH DT  +V  ERA L  L+G C+ 
Sbjct: 183 EYISEEIMLSAVGQGAIAVEIAAQRADVREMLDLLNHGDTERAVKAERALLYRLEGGCQI 242

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            I  +A  +   +   G+V + DG+   +V+ +G   +   +GR AA  +
Sbjct: 243 PIGAWAVTEQQQIVLKGMVASLDGQRILKVTLSGEHPE--ELGRQAADLL 290


>gi|219117329|ref|XP_002179459.1| hydroxymethylbilane synthase [Phaeodactylum tricornutum CCAP
           1055/1]
 gi|217409350|gb|EEC49282.1| hydroxymethylbilane synthase [Phaeodactylum tricornutum CCAP
           1055/1]
          Length = 329

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 122/309 (39%), Positives = 180/309 (58%), Gaps = 8/309 (2%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIP----PHNIVIIPLSTKGDRITNRTLTEIG 59
           +P RIGTR SPLALA A+ETR  L  +   P       I I  L T+GD I +++L E+G
Sbjct: 7   QPLRIGTRGSPLALAQAYETRKRL--IENFPDLEAEGAIEICVLKTQGDMILDKSLMELG 64

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI--SHTAQS 117
           GKGLFT+E++  L+S E+D  VHS KD+PT L  G  +   LPRED  D FI    + + 
Sbjct: 65  GKGLFTKELDTALLSDEVDICVHSMKDVPTWLPDGTVLPCNLPREDTNDAFIYKDDSVKR 124

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           ++D+   SVIGT+SLRR+A L+     +  ++FRG ++TRL KL++    A LLA AG+K
Sbjct: 125 IEDIPDGSVIGTASLRRQAQLMAKNPTLKCVNFRGNVQTRLRKLDDGVVDATLLAIAGLK 184

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           R+  +     IL  ++  P+  QGAI I+   ++ ++ + +  +NH +T   V+CER FL
Sbjct: 185 RMDMDGCATSILEWDEMLPAVAQGAIGIQCRDDDERSLKYLAALNHPETKACVDCERGFL 244

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
             LDG+CK+ IAG A      + F G++   DG    E    G   +A  IGR+A + ++
Sbjct: 245 EALDGNCKTPIAGQARIVDGKIMFRGLIAMPDGSKKFECESEGAIEEAAKIGREAGEGLK 304

Query: 298 FISNKNVFN 306
             + +  F 
Sbjct: 305 KEAGEEFFQ 313


>gi|218533190|ref|YP_002424006.1| porphobilinogen deaminase [Methylobacterium chloromethanicum CM4]
 gi|218525493|gb|ACK86078.1| porphobilinogen deaminase [Methylobacterium chloromethanicum CM4]
          Length = 309

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 123/303 (40%), Positives = 175/303 (57%), Gaps = 3/303 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RIGTR SP+ALA     R  ++  +  P     I+ +ST  DR+ +R L+EIGGKGL
Sbjct: 5   RALRIGTRGSPMALAQTGMVRDRIVAAN--PGLETEIVVVSTVADRVLDRPLSEIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFIS-HTAQSLKDLA 122
           FT+E+E+ L + EID AVHS KD+ T L  GL I+  L R+D RD F+S + A  L DL 
Sbjct: 63  FTKELEQALFADEIDVAVHSMKDVETWLPDGLAIACILERDDPRDAFLSANGANGLADLP 122

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR A +L  R D++++  RG   TR+ KL   +  A LLA AG++RL  E
Sbjct: 123 PGARVGTSSLRRGAQVLMHRPDLTIVPLRGNANTRMRKLEAGECDATLLALAGLQRLGME 182

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V + +L++E+  P+  QGA+ IE    +   + L+  +    T  +++ ER  LAELDG
Sbjct: 183 DVARSVLSVEEMLPAVAQGALGIECRAGDDAIRALLAPVACATTTTALDAERGLLAELDG 242

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IA  A  KG  +   G++   DG    EV R G   DA  IGRDA   ++  +  
Sbjct: 243 SCRTPIAALAQVKGDRISLDGLLFLPDGSRHWEVHREGLAADADAIGRDAGAELKRAAGD 302

Query: 303 NVF 305
             F
Sbjct: 303 VYF 305


>gi|158421885|ref|YP_001523177.1| porphobilinogen deaminase [Azorhizobium caulinodans ORS 571]
 gi|158328774|dbj|BAF86259.1| porphobilinogen deaminase [Azorhizobium caulinodans ORS 571]
          Length = 313

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 162/300 (54%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           IGTR SPLAL  A   R +L      P  +I I  + T GD I +R L+E GGKGLFT+E
Sbjct: 14  IGTRGSPLALWQAHAVRDALAAALARPVESISITVIRTSGDSIQDRALSEAGGKGLFTKE 73

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE++L+ G ID AVHSAKDM T L  GL +S +LPR D+RD  I    +SL DL   + I
Sbjct: 74  IEEQLLDGRIDLAVHSAKDMATALPDGLFLSGFLPRADVRDALILREGKSLADLPAGARI 133

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GT+SLRR+A L R R D+ V   RG + TRL K+        LLA AG+ RL        
Sbjct: 134 GTASLRREAQLRRLRPDLDVSLLRGNVHTRLAKVREGTFDGTLLALAGLTRLGLAHEASA 193

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
           +L+ + F P+ GQGA+ IE+ V +      +  I    T  ++  ERA L  LDGSC++ 
Sbjct: 194 VLDTDAFLPAVGQGAVAIESRVGDEATNGAIAAIACRATGIALAAERALLTALDGSCRTP 253

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFNF 307
           I G A  +G  +   G++L+ DG+   E        DA  +G D    +R  +       
Sbjct: 254 IGGLATVEGDMVRLRGLILSPDGRDAAEADETAPVSDAARLGADMGARLRATAPARALGL 313


>gi|242060648|ref|XP_002451613.1| hypothetical protein SORBIDRAFT_04g004630 [Sorghum bicolor]
 gi|241931444|gb|EES04589.1| hypothetical protein SORBIDRAFT_04g004630 [Sorghum bicolor]
          Length = 356

 Score =  220 bits (561), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 183/306 (59%), Gaps = 5/306 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  L   H        I I+ + T GD I ++ L +IGGKGL
Sbjct: 48  IRIGTRGSPLALAQAHETREKLKAAHSELAEEGAIEIVIIKTTGDMILDKPLADIGGKGL 107

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FI  TA SL +L  
Sbjct: 108 FTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLAELPA 167

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+G++SLRR++ +L     + V++FRG ++TRL KL      A LLA AG++RL   +
Sbjct: 168 GSVVGSASLRRQSQILYRYPSLKVVNFRGNVQTRLRKLKEGDVSATLLALAGLRRLNMAE 227

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
               +L++E+  P+  QGAI I    N+ K  E +  +NHEDT  +V CER FLA LDG+
Sbjct: 228 NATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSSLNHEDTRLAVACEREFLAVLDGN 287

Query: 244 CKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFIS 300
           C++ IA +AY  K     F G++ + DG    E +R+G     D + +G+DA   ++  +
Sbjct: 288 CRTPIAAYAYRDKDGNCSFRGLLASPDGSKVFETTRSGPYSFDDMVELGKDAGHELKAKA 347

Query: 301 NKNVFN 306
               F+
Sbjct: 348 GPGFFD 353


>gi|114566228|ref|YP_753382.1| hydroxymethylbilane synthase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|122318683|sp|Q0AZ43|HEM3_SYNWW RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|114337163|gb|ABI68011.1| hydroxymethylbilane synthase [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 306

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 177/291 (60%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            R+GTR S LAL  A    +SL++   IP   + I  + T GD+I +  L++IG KGLFT
Sbjct: 4   LRLGTRGSQLALWQARHV-ASLLE-SSIPDLKVEIKTIKTTGDKILDVALSKIGDKGLFT 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIEK+L+ GEID AVHS KD+P++L  GL I+A L RED RDV +SH   SL DL   +
Sbjct: 62  KEIEKELLDGEIDIAVHSMKDLPSELPPGLCIAAVLEREDPRDVLLSHKNYSLADLPQAA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           +IGTSSLRR A L  WR D+ ++D RG +ETR+ K+       I+LA AG+KRL  E++I
Sbjct: 122 LIGTSSLRRIAQLKAWRPDLQLVDMRGNVETRIRKMKEQDLDGIILACAGVKRLGLEEMI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L      P+ GQG I +E   +     +L+  INH+D++ +   ER FL EL G C+
Sbjct: 182 SDYLPAHLVLPAVGQGMIAVEARSDEQDVLKLLSRINHQDSFLAGQAERGFLHELGGGCQ 241

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A  A  +G  L+  G++ + DGK  +  S + +  +A   GR+ A+ +
Sbjct: 242 VPVASLAELQGGQLHIRGLIASLDGKEKYSGSSDCSPPEAEEAGRELARSL 292


>gi|226509736|ref|NP_001150986.1| LOC100284619 [Zea mays]
 gi|195643410|gb|ACG41173.1| porphobilinogen deaminase [Zea mays]
          Length = 356

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 130/306 (42%), Positives = 181/306 (59%), Gaps = 5/306 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
            RIGTR SPLALA A ETR  L   H        I I+ + T GD I ++ L +IGGKGL
Sbjct: 48  IRIGTRGSPLALAQAHETREKLKATHSELAEERAIEIVIIKTTGDMILDKPLADIGGKGL 107

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+EI+  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FI  TA SL +L  
Sbjct: 108 FTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLAELPA 167

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SVIG++SLRR++ +L     + V++FRG ++TRL KL      A LLA AG++RL   +
Sbjct: 168 GSVIGSASLRRQSQILYRYPSLKVVNFRGNVQTRLRKLKEGDVSATLLALAGLRRLNMAE 227

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
               +L++E+  P+  QGAI I    N+ K  E +  +NHEDT  +V CER FLA LDG+
Sbjct: 228 NATAVLSVEEMLPAVAQGAIGIACRSNDDKMMEYLSALNHEDTRLAVACEREFLAVLDGN 287

Query: 244 CKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFIS 300
           C++ IA +AY        F G++ +  G    E +R+G     D + +G+DA   ++  +
Sbjct: 288 CRTPIAAYAYRDNDGNCSFRGLLASPGGSKVFETTRSGPYSFDDMVEMGKDAGHELKAKA 347

Query: 301 NKNVFN 306
               F+
Sbjct: 348 GPGFFD 353


>gi|163854244|ref|YP_001642287.1| porphobilinogen deaminase [Methylobacterium extorquens PA1]
 gi|163665849|gb|ABY33216.1| porphobilinogen deaminase [Methylobacterium extorquens PA1]
          Length = 309

 Score =  216 bits (551), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 121/303 (39%), Positives = 173/303 (57%), Gaps = 3/303 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RIGTR SP+ALA     R  ++  +  P     I+ +ST  DR+ +R L+EIGGKGL
Sbjct: 5   RALRIGTRGSPMALAQTGMVRDRIVAAN--PGLETEIVVVSTVADRVLDRPLSEIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFIS-HTAQSLKDLA 122
           FT+E+E+ L + EID AVHS KD+ T L  GL I+  L R+D RD F+S + A  L DL 
Sbjct: 63  FTKELEQALFADEIDVAVHSMKDVETWLPDGLAIACILERDDPRDAFLSANGANGLADLP 122

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR A +L  R D++++  RG   TR+ KL   +  A LLA AG++RL   
Sbjct: 123 PGARVGTSSLRRGAQVLMHRPDLTIVPLRGNANTRMRKLEAGECDATLLALAGLQRLGMA 182

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V + +L++E+  P+  QGA+ IE    +   + L+  +    T  +++ ER  LAELDG
Sbjct: 183 DVARSVLSVEEMLPAVAQGALGIECRAGDDAIRALLAPVACATTTTALDAERGLLAELDG 242

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IA  A  KG  +   G++   DG     V R G   DA  IGRDA   ++  +  
Sbjct: 243 SCRTPIAALAQVKGDRISLDGLLFLPDGSRHWAVHREGLAADADTIGRDAGAELKRAAGD 302

Query: 303 NVF 305
             F
Sbjct: 303 VYF 305


>gi|114770079|ref|ZP_01447617.1| porphobilinogen deaminase [alpha proteobacterium HTCC2255]
 gi|114548916|gb|EAU51799.1| porphobilinogen deaminase [alpha proteobacterium HTCC2255]
          Length = 307

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 117/266 (43%), Positives = 160/266 (60%), Gaps = 1/266 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P  IGTR SPLALA A ET   L+    +      I  + T GD+I +R L+E+GGKGLF
Sbjct: 8   PLVIGTRGSPLALAQAHETMGRLIRSTGLDESCFKITVIKTSGDKIQDRPLSEVGGKGLF 67

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+EIE  ++   ID AVHS KDMP    +GL++S YLPRED+RD FIS   +++ +L   
Sbjct: 68  TKEIEDAMLDYGIDIAVHSMKDMPVICPEGLKLSCYLPREDVRDSFISTKYKNINELPKG 127

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRR+A LL  R D+ +++FRG ++TRL KLN   A A  LA AG+ RL + ++
Sbjct: 128 ATVGTSSLRRRAQLLNKRPDLKIVEFRGNVQTRLRKLNEGVAEATFLACAGLNRLGRNEI 187

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
              I   +D  P+  QG I IE    + +  E++  IN +     +  ER  LAELDGSC
Sbjct: 188 SNPI-EPDDMLPAIAQGCIGIEQREGDTEIAEILTKINDKSASLRLAAERTLLAELDGSC 246

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDG 270
           ++ IAG A   G  +   G V+  DG
Sbjct: 247 QTPIAGLAELDGQKMRLRGEVIRPDG 272


>gi|255070965|ref|XP_002507564.1| hydroxymethylbilane synthase [Micromonas sp. RCC299]
 gi|226522839|gb|ACO68822.1| hydroxymethylbilane synthase [Micromonas sp. RCC299]
          Length = 353

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 176/298 (59%), Gaps = 8/298 (2%)

Query: 6   FRIGTRCSPLALAHAFETR----SSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
            +IGTR SPLALA A+ TR    +S  ++       I II   T GD++ ++ L +IGGK
Sbjct: 40  IKIGTRGSPLALAQAYMTRDLLKASFPELGNDGALEICII--KTTGDKVLDQPLADIGGK 97

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLFT E++  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FIS     L +L
Sbjct: 98  GLFTRELDVALLDGRIDIAVHSMKDVPTYLPEGTILPCMLPREDVRDAFISVKYDDLSEL 157

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              S++GT+SLRR++ LL     +  ++FRG +++R+ KL        LLA AG+ R+  
Sbjct: 158 PEGSLVGTASLRRQSQLLARFPGLKCVNFRGNVQSRIRKLQEGVVDCTLLAIAGLNRMDM 217

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
            +   +IL+++   P+  QGAI I     + K    ++ +NHE+T  +V CER+FLA LD
Sbjct: 218 TQHATKILDVDVMLPAVAQGAIGIACRTGDSKQITYLESLNHEETRIAVECERSFLAALD 277

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSR--NGNRCDAINIGRDAAQYIR 297
           GSC++ IAGFA   G  L F G+V A DG    E SR    +  DAI  G++A   ++
Sbjct: 278 GSCRTPIAGFARKDGDNLRFNGLVAALDGSEILETSRVTKWSYADAIAAGKEAGAELK 335


>gi|83313519|ref|YP_423783.1| porphobilinogen deaminase [Magnetospirillum magneticum AMB-1]
 gi|82948360|dbj|BAE53224.1| Porphobilinogen deaminase [Magnetospirillum magneticum AMB-1]
          Length = 262

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 160/258 (62%)

Query: 50  ITNRTLTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDV 109
           + +R L EIGGKGLFT+E+++ ++SG I  AVHS KD+PT+L  G+ +   LPRED+RD 
Sbjct: 1   MQDRPLAEIGGKGLFTKELDEAMLSGRIHLAVHSMKDVPTQLPDGIVLPCILPREDVRDA 60

Query: 110 FISHTAQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAI 169
           F+S    SL +L   +V+GTSSLRR A +L  R D+ V++FRG ++TRL KL      A 
Sbjct: 61  FLSLKVGSLAELPQGAVVGTSSLRRGAQILHRRPDLKVVNFRGNVQTRLRKLEEGVVDAT 120

Query: 170 LLAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDS 229
           +LA AG++RL   +     L+ +D  P+  QGAI I    ++  + + +  +N  D++  
Sbjct: 121 MLAMAGLRRLGLAQHATSALSEDDMLPAVAQGAIGITCRADDQASLDYLAALNCPDSFVR 180

Query: 230 VNCERAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           V  ERAFL  LDGSC++ IA  A   G  L F G++++ DG   H  +R+G+R DA  +G
Sbjct: 181 VAAERAFLTRLDGSCRTPIAALAELDGDRLSFRGLIVSPDGTTVHATARSGSRADAEAMG 240

Query: 290 RDAAQYIRFISNKNVFNF 307
           +DAA+ +  ++    F+ 
Sbjct: 241 KDAAEELIKVAGPGFFDL 258


>gi|188584576|ref|YP_001928021.1| porphobilinogen deaminase [Methylobacterium populi BJ001]
 gi|179348074|gb|ACB83486.1| porphobilinogen deaminase [Methylobacterium populi BJ001]
          Length = 309

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 121/304 (39%), Positives = 171/304 (56%), Gaps = 3/304 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
            +P RIGTR SP+ALA     R  ++  +  P     I+ +ST  DR+ +R L+EIGGKG
Sbjct: 4   SRPLRIGTRGSPMALAQTGMVRDRIVAAN--PGLETEIVVVSTVADRVLDRPLSEIGGKG 61

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISH-TAQSLKDL 121
           LFT+E+E+ L +  ID AVHS KD+ T L  GL I+  L R+D RD F+S  TA  L DL
Sbjct: 62  LFTKELEQALFADTIDVAVHSMKDVETWLPDGLAIACILERDDPRDAFLSAGTANGLADL 121

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +GTSSLRR A +L  R D+ ++  RG   TR+ KL   +  A LLA AG++RL  
Sbjct: 122 PSGARVGTSSLRRGAQVLMHRPDLMIVPLRGNANTRMRKLEAGECDATLLALAGLQRLGM 181

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E V + +L +E+  P+  QGA+ IE    +   + L+  +    T  +++ ER  LAELD
Sbjct: 182 EDVARSVLPVEEMLPAVAQGALGIECRAGDDAIRALLAPVACATTTTALDAERGLLAELD 241

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           GSC++ IA  A   G  +   G++   DG     V R G   +A  IGRDA   ++  + 
Sbjct: 242 GSCRTPIAALAQVNGDRIALDGLLFLPDGSRHWAVHREGPAAEADAIGRDAGAELKRSAG 301

Query: 302 KNVF 305
              F
Sbjct: 302 DVYF 305


>gi|83308731|emb|CAJ01641.1| porphobilinogen deaminase (ec 4.3.1.8) [Methylocapsa acidiphila]
          Length = 293

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 117/267 (43%), Positives = 161/267 (60%)

Query: 15  LALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLIS 74
           +ALA A E R  L    +I    I I+ + T GD I +R L+E GGKGLFT+E++  L+ 
Sbjct: 1   MALAQAHELRGRLAASSRIDGDAIEIVVIKTSGDVIQDRALSEAGGKGLFTKELDFALMR 60

Query: 75  GEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLRR 134
           GE+D AVHSAKD+PT L   + I+ YLPRED+RD +IS  A    +L   +V+GT+SLRR
Sbjct: 61  GEVDIAVHSAKDLPTSLPGEIAIAGYLPREDVRDAWISPKAAHPLELPAGAVVGTASLRR 120

Query: 135 KALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDF 194
            A++ R R D+S++  RG +ETRL KL   +  A LLA AG+KRL  E     +L+  +F
Sbjct: 121 GAMVKRLRPDLSIVLLRGNVETRLGKLAAGEVDATLLALAGLKRLGLEDRATAVLDAGEF 180

Query: 195 PPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAYC 254
            P+ GQGAI I     +  A + +  +    T  ++  ERAFL  LDGSCK+ I   A  
Sbjct: 181 VPAAGQGAIAITLRAGDQAALDALAPVLDAATGAALAAERAFLHVLDGSCKTPIGAHARL 240

Query: 255 KGSTLYFYGIVLASDGKIFHEVSRNGN 281
            G  + F+G+VL  DG  F EV  +G+
Sbjct: 241 AGDEINFHGVVLKPDGSQFFEVVLSGS 267


>gi|170738754|ref|YP_001767409.1| porphobilinogen deaminase [Methylobacterium sp. 4-46]
 gi|168193028|gb|ACA14975.1| porphobilinogen deaminase [Methylobacterium sp. 4-46]
          Length = 311

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 116/305 (38%), Positives = 172/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEI 58
           M  +P RIGTR SP+ALA     R  +   H     P  + ++ ++T  DRI +R L+ I
Sbjct: 1   MAHRPLRIGTRGSPMALAQTGMVRDRIAAAHPHLAEPGAMELVVVNTVADRILDRPLSAI 60

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLFT+E+E+ L +GEID AVHS KD+ T L  GL I+  L R+D RD F+S  + SL
Sbjct: 61  GGKGLFTKELEQALFAGEIDVAVHSMKDVETWLPDGLVIACILERDDPRDAFLSLASGSL 120

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            +L   + +GTSSLRR A +L  R D+ ++  RG   TR+ KL      A LLA AG++R
Sbjct: 121 AELPAGARVGTSSLRRGAQVLMRRPDLRIVPLRGNANTRIRKLEEGVCDATLLAIAGLER 180

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L    + + ++ +E+  P+  QGA+ IE    +     L++ +    T  ++  ER  LA
Sbjct: 181 LGLAHLARTVIPVEEMLPAVAQGALGIECRAADEDVIALLQAVACPRTTTALAAERGLLA 240

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           ELDGSC++ IA  A   G  L   G++   DG      +R+G   +A +IGR+A   ++ 
Sbjct: 241 ELDGSCRTPIAALAQIDGDRLTLDGLLFLPDGSAHWATTRSGPAAEAASIGREAGADLKA 300

Query: 299 ISNKN 303
            + + 
Sbjct: 301 QAGET 305


>gi|109896672|ref|YP_659927.1| porphobilinogen deaminase [Pseudoalteromonas atlantica T6c]
 gi|123065108|sp|Q15Z15|HEM3_PSEA6 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|109698953|gb|ABG38873.1| hydroxymethylbilane synthase [Pseudoalteromonas atlantica T6c]
          Length = 309

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 174/296 (58%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LA+  A   ++ L++ H  P   + ++P+ST+GDRI +  L +IGG
Sbjct: 1   MSDRVIRIATRKSALAMWQAEYVQAKLLEAH--PQLKVELVPMSTQGDRILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +  G  D AVHS KD+P     G  +     RE+  D F+S+T  S+++
Sbjct: 59  KGLFIKELEVAMSEGRADIAVHSMKDVPVDFPAGFGLHCICERENPYDAFVSNTYASIEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  +   R D+++ D RG + TRL KL++ +  AI+LA AG+ RL+
Sbjct: 119 LPQGAIVGTSSLRRQCQIRSARPDLTIRDLRGNVNTRLAKLDDGQYDAIILAAAGLIRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  IK  +      P+ GQGA+ IE   ++ +  EL+K +NH DT   V  ERA  A+L
Sbjct: 179 MQDRIKTYIEPTVSLPAVGQGAVGIECRNDDAELIELLKPLNHSDTESRVKAERAMNAKL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  I  +A   G  LY  G+V + DG +  +  + GN  DA++IG D A+ +
Sbjct: 239 NGGCQVPIGSYAVLNGDELYLRGLVGSPDGSVLLQAEKRGNVNDALSIGVDVAEQL 294


>gi|220921724|ref|YP_002497025.1| porphobilinogen deaminase [Methylobacterium nodulans ORS 2060]
 gi|219946330|gb|ACL56722.1| porphobilinogen deaminase [Methylobacterium nodulans ORS 2060]
          Length = 318

 Score =  212 bits (540), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 173/299 (57%), Gaps = 2/299 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEI 58
           M  +P RIGTR SP+ALA     R  +   H     P  + ++ ++T  D++ +R L+ I
Sbjct: 8   MVHRPLRIGTRGSPMALAQTGMVRDRIAAAHPHLAEPGAMELVVVNTVADKVLDRPLSAI 67

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLFT+E+E+ L +GEID AVHS KD+ T L  GL I++ L R+D RD F+S  A+SL
Sbjct: 68  GGKGLFTKELEQALFAGEIDLAVHSMKDVETWLPDGLVIASILERDDPRDAFLSLKARSL 127

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            +L   S +GTSSLRR A +L  R D+ ++  RG   TR+ +L      A LLA AG++R
Sbjct: 128 AELPAGSRVGTSSLRRGAQVLMRRPDLQIVPLRGNANTRIRRLEEGACDATLLAIAGLER 187

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L    + +E++  +   P+  QGA+ IE    + +  +L++ +    T  ++  ER  LA
Sbjct: 188 LGLAHLAQEVMGTDTMLPAVAQGALGIECRAADQELIDLLQAVACPRTTTALAAERGLLA 247

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           ELDGSC++ IA  A  +G  L   G++   DG      +R+G   +A  IG++A   ++
Sbjct: 248 ELDGSCRTPIAALAEIEGDRLTLNGLLFLPDGSAHWATTRSGPAAEAAAIGKEAGADLK 306


>gi|297617596|ref|YP_003702755.1| porphobilinogen deaminase [Syntrophothermus lipocalidus DSM 12680]
 gi|297145433|gb|ADI02190.1| porphobilinogen deaminase [Syntrophothermus lipocalidus DSM 12680]
          Length = 316

 Score =  212 bits (540), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 120/300 (40%), Positives = 173/300 (57%), Gaps = 2/300 (0%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           RIGTR S LAL  A      L D    P H   I  + TKGD+IT+  L++IG KGLFT+
Sbjct: 12  RIGTRGSRLALWQANYVVKRLRDC--FPGHEFEITVIKTKGDKITDVALSKIGDKGLFTK 69

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE  L+  EID AVHS KD+PT L +G++++A L RE+  DV +S    SL  L   + 
Sbjct: 70  EIEMALLREEIDIAVHSLKDLPTTLPEGIRLAAVLERENPLDVLLSFKGYSLSGLPRGAR 129

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           IGTSSLRR A L R R DI  ++ RG +ETR+ K+ +     I+LAYAG+KR+    ++ 
Sbjct: 130 IGTSSLRRTAQLKRLRPDIETVNLRGNVETRIRKMEDEGLDGIVLAYAGVKRMGFLHLVT 189

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           EIL+ +   P+ GQG I +E   +   A+ELVK +NH+ TW  +  ERAFL  ++G C+ 
Sbjct: 190 EILHPDQVIPAVGQGVIALEIKEDGKVAEELVKPLNHQPTWAEITAERAFLKAIEGGCQV 249

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
                A  +   L   G+V + DG++ +    +G+   A  +G + A+ I  +   ++  
Sbjct: 250 PCGCHASYQEGYLTVDGLVASLDGQVVYRDRVSGSEAFAQQLGEELARRILAMGGGSLLE 309


>gi|256821394|ref|YP_003145357.1| porphobilinogen deaminase [Kangiella koreensis DSM 16069]
 gi|256794933|gb|ACV25589.1| porphobilinogen deaminase [Kangiella koreensis DSM 16069]
          Length = 311

 Score =  211 bits (538), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 170/306 (55%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLA+  A   +S L  +H  P   + ++P++T+GD+I    LT+IGG
Sbjct: 1   MSISTLRIATRQSPLAMWQAEYVQSRLQQLH--PDLTVELVPMTTQGDKILGTPLTKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +  +GL++     RED  D F+S+   +L D
Sbjct: 59  KGLFVKELEQAMLEGRADIAVHSMKDVPYQFPEGLELKVICEREDPTDAFVSNKYHNLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRRK  LLR R D+ + D RG + TRL+KL++    AI+LA AG+KRL 
Sbjct: 119 LPCGANVGTSSLRRKIQLLRARPDLKITDLRGNVGTRLSKLDDGNYDAIVLASAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+     E   P+PGQGA+ IE   N+P    +++ +  E T   V  ER     L
Sbjct: 179 LEERIRSQFEPELMLPAPGQGAVGIEARTNDPDLDAILQPLQDETTSLRVLAERTITKTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
             SC+  +A FA     TL    +V   D +I  E S  G   DA+ IG   +Q +  + 
Sbjct: 239 QASCQVPVAAFATINDDTLSLRALVGGVDQQII-EASAEGPAQDALAIGHKVSQELLELG 297

Query: 301 NKNVFN 306
            + +  
Sbjct: 298 ARELIQ 303


>gi|308051395|ref|YP_003914961.1| porphobilinogen deaminase [Ferrimonas balearica DSM 9799]
 gi|307633585|gb|ADN77887.1| porphobilinogen deaminase [Ferrimonas balearica DSM 9799]
          Length = 310

 Score =  211 bits (538), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 175/296 (59%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  RI TR SPLAL  A   ++ L   H  P   + ++ +STKGDRI +  L ++GG
Sbjct: 1   MARKEIRIATRKSPLALWQAEFVKAELEKAH--PGLTVTLLKMSTKGDRILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +++GE D AVHS KD+P +  +GL ++    RED RD F+S+T ++L D
Sbjct: 59  KGLFVKELEVAMLNGEADIAVHSMKDVPVEFPEGLGLAVICDREDPRDAFVSNTYKNLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++G+SSLRR+  L   R D+ V D RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPHGAIVGSSSLRRQCQLRAMRPDLDVRDLRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   +  E   P+ GQGA+ IE  +++ +   L+ V+NH  T   V  ERA    L
Sbjct: 179 LEERITAFIEPEQSLPANGQGAVGIECRLDDAELLALIGVLNHAPTHARVIAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  I  ++  +G TL+  G+V   DG    +    G   DA  +G + A+ +
Sbjct: 239 EGGCQVPIGAYSVIEGDTLWLRGLVGDPDGSKIIQDELRGPVADAQKLGIELAERL 294


>gi|193215989|ref|YP_001997188.1| porphobilinogen deaminase [Chloroherpeton thalassium ATCC 35110]
 gi|238058923|sp|B3QWI1|HEM3_CHLT3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|193089466|gb|ACF14741.1| porphobilinogen deaminase [Chloroherpeton thalassium ATCC 35110]
          Length = 314

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 164/269 (60%), Gaps = 2/269 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A   ++ L   +  P  +I +  + T GD+I +  L +IG KG
Sbjct: 2   KKALIIGTRSSPLALWQAEFIKAELSKHY--PSLDISLRHIKTTGDKILDAPLAKIGDKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT EIE  ++  EID AVHS KD+PT+  +GL I+A   RED RDV IS    +LK L 
Sbjct: 60  LFTREIEHVMLRNEIDLAVHSLKDLPTETPEGLVITAITEREDNRDVLISKGKYTLKTLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +++ TSSLRR++ LL  R D+ VID RG + TR  +     A A+LLA+AG+ RL+  
Sbjct: 120 QGAIVATSSLRRRSQLLHLRPDLEVIDMRGNLNTRFKRFEEGDAEAMLLAFAGVHRLEFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I EI++ +D  P+ GQGA+ IET +++ + +EL+KV+NH +T     CER+ L  L+G
Sbjct: 180 EHIAEIISFDDILPAVGQGALGIETRIDDEETRELLKVLNHAETELCTKCERSLLRTLEG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK 271
            C+  I   A  +  T +F   V + DGK
Sbjct: 240 GCQIPIGAHARIENGTFHFATYVGSIDGK 268


>gi|297581838|ref|ZP_06943759.1| porphobilinogen deaminase [Vibrio cholerae RC385]
 gi|297533932|gb|EFH72772.1| porphobilinogen deaminase [Vibrio cholerae RC385]
          Length = 317

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/306 (37%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   RSD+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARSDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G+T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGNTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|325918388|ref|ZP_08180519.1| hydroxymethylbilane synthase [Xanthomonas vesicatoria ATCC 35937]
 gi|325535411|gb|EGD07276.1| hydroxymethylbilane synthase [Xanthomonas vesicatoria ATCC 35937]
          Length = 304

 Score =  211 bits (537), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/292 (40%), Positives = 171/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDDPFVLPAILGRGDAADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  +  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLDARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  D+ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPDWLPAPAQGAVAVECRGDDARIHALLAVLDAPTTRVCVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  LY  G+V  ASDG++ H    +G+  D   +GR  AQ +
Sbjct: 242 VPVAAFATWEGEGLYLQGMVGSASDGRLIH-ADAHGSAGDTEELGRRVAQGL 292


>gi|308188851|ref|YP_003932982.1| Porphobilinogen deaminase [Pantoea vagans C9-1]
 gi|308059361|gb|ADO11533.1| Porphobilinogen deaminase [Pantoea vagans C9-1]
          Length = 317

 Score =  211 bits (536), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 164/289 (56%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 5   MLDKIFRIATRQSPLALWQAHYVQQRLMSAH--PGLRVELVPMVTKGDIILDTPLAKVGG 62

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +  G  D AVHS KD+P    +GL +     R+D RD F+SH   S+  
Sbjct: 63  KGLFVKELELAMQDGRADMAVHSMKDVPVSFPEGLGLVTICERDDPRDAFVSHHYDSIDA 122

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 123 LPQGAVVGTSSLRRQCQISARRPDLVIRSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 182

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I++ +  E   P+ GQGA+ IE  +N+    +L++ +NH+DT   V  ERA    L
Sbjct: 183 MQDRIRQAMPAEVSLPAVGQGAVGIECRLNDSVLIDLLRALNHDDTEVCVRAERAMNTRL 242

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  FA  +G  L+  G+V A DG++     R G R  A  +G
Sbjct: 243 EGGCQVPIGSFAVLEGDELWLRGMVGAPDGRVMVSGERRGPRAQAEQMG 291


>gi|153214841|ref|ZP_01949649.1| porphobilinogen deaminase [Vibrio cholerae 1587]
 gi|153830620|ref|ZP_01983287.1| porphobilinogen deaminase [Vibrio cholerae 623-39]
 gi|124115084|gb|EAY33904.1| porphobilinogen deaminase [Vibrio cholerae 1587]
 gi|148873892|gb|EDL72027.1| porphobilinogen deaminase [Vibrio cholerae 623-39]
          Length = 311

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G+T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGNTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|229525016|ref|ZP_04414421.1| porphobilinogen deaminase [Vibrio cholerae bv. albensis VL426]
 gi|229338597|gb|EEO03614.1| porphobilinogen deaminase [Vibrio cholerae bv. albensis VL426]
          Length = 317

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G+T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGNTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|255743926|ref|ZP_05417881.1| porphobilinogen deaminase [Vibrio cholera CIRS 101]
 gi|262151165|ref|ZP_06028304.1| porphobilinogen deaminase [Vibrio cholerae INDRE 91/1]
 gi|262167035|ref|ZP_06034752.1| porphobilinogen deaminase [Vibrio cholerae RC27]
 gi|262189994|ref|ZP_06048299.1| porphobilinogen deaminase [Vibrio cholerae CT 5369-93]
 gi|11386839|sp|Q9KVM1|HEM3_VIBCH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|255738409|gb|EET93799.1| porphobilinogen deaminase [Vibrio cholera CIRS 101]
 gi|262024553|gb|EEY43237.1| porphobilinogen deaminase [Vibrio cholerae RC27]
 gi|262031059|gb|EEY49684.1| porphobilinogen deaminase [Vibrio cholerae INDRE 91/1]
 gi|262034117|gb|EEY52552.1| porphobilinogen deaminase [Vibrio cholerae CT 5369-93]
          Length = 311

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|283780135|ref|YP_003370890.1| porphobilinogen deaminase [Pirellula staleyi DSM 6068]
 gi|283438588|gb|ADB17030.1| porphobilinogen deaminase [Pirellula staleyi DSM 6068]
          Length = 311

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 115/298 (38%), Positives = 174/298 (58%), Gaps = 5/298 (1%)

Query: 1   MEKKP-FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M   P  R+GTR SPLA   A   R  L+        ++ +I ++T+GD+ T++ L +IG
Sbjct: 1   MSDAPKLRLGTRASPLARWQADWVRDQLIAAGI----DVEMILITTEGDQQTSQPLGQIG 56

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           G+GLFT+EI+++L++G+ID AVHS KD+PT  + GL ++A   RED  D+ I     SL 
Sbjct: 57  GQGLFTKEIQRRLLAGDIDLAVHSLKDLPTLPIDGLSLAAVPEREDTADILIGPAGTSLA 116

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   + IGT SLRRKA LL  R+D+ ++D RG ++TRL KL+  + HAI+LA AG+KRL
Sbjct: 117 TLPSGAKIGTGSLRRKAQLLHARADLEILDIRGNVDTRLRKLDEGQYHAIILAAAGLKRL 176

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           K +  + E L      P+ GQGA+ IE+  ++P  ++L+  ++H  T  +V  ER+ LA 
Sbjct: 177 KLDDRMTERLEAPLMLPAVGQGALGIESRSDDPTTRKLLAPLSHAPTLQAVIAERSLLAA 236

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           L   C + +   A      L    +VL+ DG+     S      DA  +G + A+ +R
Sbjct: 237 LRAGCLAPVGAHAQVVDGQLTLAAVVLSIDGQSRLFASLTSAPADAAQLGEEVAELLR 294


>gi|294666828|ref|ZP_06732061.1| porphobilinogen deaminase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292603412|gb|EFF46830.1| porphobilinogen deaminase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 304

 Score =  209 bits (532), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 173/292 (59%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L +   + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDEPFVLPAILERGDPADGLVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  E  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLEARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++ + T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDADRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  L+  G+V  ASDG++ H    +G+  D   +GR  AQ +
Sbjct: 242 VPVAAFARWEGQDLFLQGMVGSASDGRLIH-ADAHGSADDTEALGRRVAQGL 292


>gi|304398148|ref|ZP_07380023.1| porphobilinogen deaminase [Pantoea sp. aB]
 gi|304354434|gb|EFM18806.1| porphobilinogen deaminase [Pantoea sp. aB]
          Length = 317

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 165/289 (57%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 5   MLDKIFRIATRQSPLALWQAHYVQQRLMSAH--PGLRVELVPMVTKGDIILDTPLAKVGG 62

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +  G  D AVHS KD+P    +GL +     R+D RD F+SH   S+  
Sbjct: 63  KGLFVKELELAMQDGRADMAVHSMKDVPVSFPEGLGLVTICERDDPRDAFVSHHYDSIDA 122

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  +   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 123 LPQGAIVGTSSLRRQCQISARRPDLVIRSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 182

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ +  E   P+ GQGA+ IE  +++    +L++ +NH+DT   V  ERA    L
Sbjct: 183 LEDRIRQAMPAEVSLPAVGQGAVGIECRLDDSVLIDLLRALNHDDTEVCVRAERAMNTRL 242

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  FA  +G+ L+  G+V A DG++     R G R  A  +G
Sbjct: 243 EGGCQVPIGSFAVLEGNDLWLRGMVGAPDGRVMVSGERRGPRAQAEQMG 291


>gi|254291929|ref|ZP_04962710.1| porphobilinogen deaminase [Vibrio cholerae AM-19226]
 gi|150422139|gb|EDN14105.1| porphobilinogen deaminase [Vibrio cholerae AM-19226]
          Length = 311

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSKIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|294625631|ref|ZP_06704254.1| porphobilinogen deaminase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292600054|gb|EFF44168.1| porphobilinogen deaminase [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 304

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 172/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L +   + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDEPFVLPAILERGDPADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  E  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLEARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  L+  G+V  ASDG++ H    +G+  D   +GR  AQ +
Sbjct: 242 VPVAAFARWEGQDLFLQGMVGSASDGRLIH-ADAHGSADDTEALGRRVAQGL 292


>gi|15640152|ref|NP_229779.1| porphobilinogen deaminase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121587718|ref|ZP_01677479.1| porphobilinogen deaminase [Vibrio cholerae 2740-80]
 gi|121728303|ref|ZP_01681334.1| porphobilinogen deaminase [Vibrio cholerae V52]
 gi|147675270|ref|YP_001218298.1| porphobilinogen deaminase [Vibrio cholerae O395]
 gi|153818935|ref|ZP_01971602.1| porphobilinogen deaminase [Vibrio cholerae NCTC 8457]
 gi|153822325|ref|ZP_01974992.1| porphobilinogen deaminase [Vibrio cholerae B33]
 gi|227080356|ref|YP_002808907.1| porphobilinogen deaminase [Vibrio cholerae M66-2]
 gi|229508398|ref|ZP_04397902.1| porphobilinogen deaminase [Vibrio cholerae BX 330286]
 gi|229508921|ref|ZP_04398411.1| porphobilinogen deaminase [Vibrio cholerae B33]
 gi|229517035|ref|ZP_04406481.1| porphobilinogen deaminase [Vibrio cholerae RC9]
 gi|229606671|ref|YP_002877319.1| porphobilinogen deaminase [Vibrio cholerae MJ-1236]
 gi|254851504|ref|ZP_05240854.1| porphobilinogen deaminase [Vibrio cholerae MO10]
 gi|298501111|ref|ZP_07010911.1| porphobilinogen deaminase [Vibrio cholerae MAK 757]
 gi|9654520|gb|AAF93298.1| porphobilinogen deaminase [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121548017|gb|EAX58095.1| porphobilinogen deaminase [Vibrio cholerae 2740-80]
 gi|121629433|gb|EAX61862.1| porphobilinogen deaminase [Vibrio cholerae V52]
 gi|126510497|gb|EAZ73091.1| porphobilinogen deaminase [Vibrio cholerae NCTC 8457]
 gi|126520151|gb|EAZ77374.1| porphobilinogen deaminase [Vibrio cholerae B33]
 gi|146317153|gb|ABQ21692.1| porphobilinogen deaminase [Vibrio cholerae O395]
 gi|227008244|gb|ACP04456.1| porphobilinogen deaminase [Vibrio cholerae M66-2]
 gi|227011878|gb|ACP08088.1| porphobilinogen deaminase [Vibrio cholerae O395]
 gi|229346098|gb|EEO11070.1| porphobilinogen deaminase [Vibrio cholerae RC9]
 gi|229354038|gb|EEO18971.1| porphobilinogen deaminase [Vibrio cholerae B33]
 gi|229354671|gb|EEO19593.1| porphobilinogen deaminase [Vibrio cholerae BX 330286]
 gi|229369326|gb|ACQ59749.1| porphobilinogen deaminase [Vibrio cholerae MJ-1236]
 gi|254847209|gb|EET25623.1| porphobilinogen deaminase [Vibrio cholerae MO10]
 gi|297540145|gb|EFH76206.1| porphobilinogen deaminase [Vibrio cholerae MAK 757]
          Length = 317

 Score =  209 bits (532), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|102139875|gb|ABF70028.1| porphobilinogen deaminase, chloroplast (hydroxymethylbilane
           synthase) (pre-uroporphyrinogen synthase), putative
           [Musa acuminata]
          Length = 426

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 126/301 (41%), Positives = 179/301 (59%), Gaps = 5/301 (1%)

Query: 11  RCSPLALAHAFETRSSLMDVHK--IPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEI 68
           R SPLALA A ETR  L   H        I I+ + T GD I ++ L +IGGKGLFT+EI
Sbjct: 123 RDSPLALAQAHETREKLKAAHSELAEEGAIEIVIIKTTGDMILDKPLADIGGKGLFTKEI 182

Query: 69  EKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIG 128
           +  L+ G ID AVHS KD+PT L +G  +   LPRED+RD FI  TA SL +L   SV+G
Sbjct: 183 DDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDAFICLTANSLAELPAGSVVG 242

Query: 129 TSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEI 188
           ++SLRR++ +L     + V++FRG ++TRL KL      A LLA AG++RL   +    +
Sbjct: 243 SASLRRQSQILYRYPSLKVVNFRGNVQTRLRKLKEGDVSATLLALAGLRRLNMAENATAV 302

Query: 189 LNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAI 248
           L++E+  P+  QGAI I    N+ K  E +  +NHEDT  +V CER FLA LDG+C++ I
Sbjct: 303 LSVEEMLPAVAQGAIGIACRSNDDKMMEYLSSLNHEDTRLAVACEREFLAVLDGNCRTPI 362

Query: 249 AGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNGNRC--DAINIGRDAAQYIRFISNKNVF 305
           A +AY  +     F G++ + DG    E +R+G     D + +G+DA   ++  +    F
Sbjct: 363 AAYAYRDEDGNCSFRGLLASPDGSKVFETTRSGPYSFDDMVELGKDAGHELKAKAGPGFF 422

Query: 306 N 306
           +
Sbjct: 423 D 423


>gi|260914569|ref|ZP_05921037.1| hydroxymethylbilane synthase [Pasteurella dagmatis ATCC 43325]
 gi|260631360|gb|EEX49543.1| hydroxymethylbilane synthase [Pasteurella dagmatis ATCC 43325]
          Length = 311

 Score =  209 bits (531), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 116/305 (38%), Positives = 172/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     +I TR SPLAL  A   +  L   +  P  N+V++P+ TKGD I +  L +IGG
Sbjct: 1   MTNNTLKIATRQSPLALWQANYVKQRLESFY--PDLNVVLVPMVTKGDVILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+SGE D AVHS KD+P +  +GL +S   PRED  D  +S+T ++L++
Sbjct: 59  KGLFVKELEIALLSGEADIAVHSMKDVPMQFPEGLGLSVICPREDPHDALVSNTYRTLEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L + R D+ +   RG + TRL+KL+     AI+LA AG+ RL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLKQLRPDLKIESLRGNVGTRLSKLDCGDYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++I+D  P+ GQGA+ IE   N+ + Q+L+  +   +T D V  ERA    L
Sbjct: 179 LTERIASFIDIQDMLPAAGQGAVGIECRKNDSRVQQLLAPLADIETTDCVLAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  IAG+A  +   +Y  G+V A DG             +A N+G   A+ +    
Sbjct: 239 QGGCQVPIAGYAIIENDQIYLRGLVGALDGSAILRAEAKSAVKNAENLGIQVAEMLLQQG 298

Query: 301 NKNVF 305
             N+ 
Sbjct: 299 AGNIL 303


>gi|167625822|ref|YP_001676116.1| porphobilinogen deaminase [Shewanella halifaxensis HAW-EB4]
 gi|189028156|sp|B0TJ54|HEM3_SHEHH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|167355844|gb|ABZ78457.1| porphobilinogen deaminase [Shewanella halifaxensis HAW-EB4]
          Length = 310

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 175/306 (57%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H+     + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNLIRIATRKSPLAMWQAEFVKAELEKIHE--GLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G+ D AVHS KD+P +  +GL +     RED RD F+S+T ++++D
Sbjct: 59  KGLFVKELEVAMLEGKADIAVHSMKDVPVEFPEGLGLEVICEREDPRDAFVSNTYKTIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRAARPDLVIKDLRGNVGTRLAKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E   P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERIASFISAEQSLPANGQGAVGIECRTDDARVKALLAPLEHAETRMRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G TL   G+V   DG      + +GN+ DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGAYAEIDGDTLSLRGLVGNPDGSQIITAASSGNKADAEKLGVALAEELLAKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|325927040|ref|ZP_08188311.1| hydroxymethylbilane synthase [Xanthomonas perforans 91-118]
 gi|325542591|gb|EGD14062.1| hydroxymethylbilane synthase [Xanthomonas perforans 91-118]
          Length = 304

 Score =  208 bits (530), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 171/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDAPFVLPAILERGDPADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  E  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLEARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  L+  G+V  ASDG++ H    +G+  D   +GR  AQ +
Sbjct: 242 VPVAAFARWEGQGLFLQGMVGSASDGRLIH-ADAHGSAEDTEALGRRVAQGL 292


>gi|288818572|ref|YP_003432920.1| porphobilinogen deaminase [Hydrogenobacter thermophilus TK-6]
 gi|288787972|dbj|BAI69719.1| porphobilinogen deaminase [Hydrogenobacter thermophilus TK-6]
 gi|308752163|gb|ADO45646.1| porphobilinogen deaminase [Hydrogenobacter thermophilus TK-6]
          Length = 304

 Score =  208 bits (530), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 172/288 (59%), Gaps = 6/288 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A   +  L  +     H + ++ ++T GD+I +  L +IGGKGLF 
Sbjct: 3   LRIGTRKSKLALWQANFVKEKLEKMG----HQVDLVHITTSGDKILDVPLAKIGGKGLFV 58

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+  EID AVHS KD+P  L +GL+I A   RE+  DV IS     L++L  ++
Sbjct: 59  KEIEEALMKKEIDLAVHSLKDVPMNLPEGLKIGAVTERENPFDVLISKDHLPLEELPSNA 118

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  + R R D+ V   RG ++TR+ KL+    HA++LAYAG+KR+  E  I
Sbjct: 119 KVGTSSLRRQVQIKRRRGDLRVEMLRGNVDTRIRKLDEGLYHAVILAYAGVKRMGLEDRI 178

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L  EDF P+ GQG++ IE   ++   +E+V   +H ++     CERAFL EL G C+
Sbjct: 179 TQVL--EDFIPAVGQGSLAIEIRQDDSAVEEIVSCFDHYESRLRAECERAFLRELQGGCQ 236

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
             I  +++ +G T++  G V   +G  F E  R+G   +A  IG+  A
Sbjct: 237 VPIGAYSWIEGDTIFIKGFVSDLEGIKFIEGMRSGEAKEAQQIGKSLA 284


>gi|148978777|ref|ZP_01815157.1| porphobilinogen deaminase [Vibrionales bacterium SWAT-3]
 gi|145962198|gb|EDK27482.1| porphobilinogen deaminase [Vibrionales bacterium SWAT-3]
          Length = 326

 Score =  208 bits (530), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 110/285 (38%), Positives = 168/285 (58%), Gaps = 2/285 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++GGKGLF
Sbjct: 20  PIRIATRKSPLALWQAYFVRDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVGGKGLF 77

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ +L   
Sbjct: 78  VKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNNIDELPQG 137

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GT SLRR+  LL +R D+ + + RG + TRL KL++ +  AI+LA AG+KRL+ E+ 
Sbjct: 138 AVVGTCSLRRQCQLLEYRPDLIIKELRGNVGTRLGKLDDGQYDAIVLAAAGLKRLELEER 197

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    L+G C
Sbjct: 198 IRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHQDTADRVLCERAMNLTLEGGC 257

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +  I  ++   G  ++   +V   DG        +G R DA  +G
Sbjct: 258 QVPIGSYSLLDGDNIWLRALVGEPDGSKMVRGEISGPRKDAEALG 302


>gi|322834934|ref|YP_004214961.1| porphobilinogen deaminase [Rahnella sp. Y9602]
 gi|321170135|gb|ADW75834.1| porphobilinogen deaminase [Rahnella sp. Y9602]
          Length = 313

 Score =  208 bits (529), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 118/296 (39%), Positives = 169/296 (57%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +S LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAQYVQSRLMACH--PGLQVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   SL D
Sbjct: 59  KGLFVKELELAMLDGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNQYASLAD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L + R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPQGSIVGTSSLRRQCQLRQKRPDLMIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   L  E+  P+ GQGA+ IE  +++   ++L+  + H +T   V  ERA    L
Sbjct: 179 LENRITYALTPEECLPAVGQGAVGIECRLDDQTTRDLLAPLAHRETTLRVQAERAMNMRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  I  +A  +G  L+   +V A DG       R G   +A  +G D A+ +
Sbjct: 239 EGGCQVPIGSYAELEGDELWLRALVGAPDGSQMVCGERRGPAANAHRMGVDLAEEL 294


>gi|167644091|ref|YP_001681754.1| porphobilinogen deaminase [Caulobacter sp. K31]
 gi|189042878|sp|B0T287|HEM3_CAUSK RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|167346521|gb|ABZ69256.1| porphobilinogen deaminase [Caulobacter sp. K31]
          Length = 318

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 115/275 (41%), Positives = 162/275 (58%), Gaps = 6/275 (2%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIV-----IIPLSTKGDRITNRTL 55
           M ++P RIG R S L+LA +   ++ +       P + +     +IP+ T GDRI +R L
Sbjct: 1   MSRQPIRIGARGSKLSLAQSGLMQARIAAALGAGPGDDIDAFAQLIPIVTSGDRIQDRRL 60

Query: 56  TEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA 115
            EIGGKGLFT+EIE+ L+ G IDCA+HS KDMP +L  GL ++A   RED RD FISH A
Sbjct: 61  MEIGGKGLFTKEIEEALLDGRIDCAIHSLKDMPAELPPGLVLAAVPEREDPRDAFISHVA 120

Query: 116 QSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAG 175
           + L+DL+  + +GT+SLRR+A  L  R D+ ++  RG ++TRL KL   +A AILLA +G
Sbjct: 121 ERLEDLSKGARLGTASLRRQAQALHVRPDLEIVMLRGNVDTRLAKLERGEADAILLAQSG 180

Query: 176 IKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERA 235
           + RL    +    L+    PP+PGQGA+ IET   +     L + +  + T  +V  ER 
Sbjct: 181 LNRLGLGHITNSWLDPLAAPPAPGQGALVIETRAEDVDLPWL-QAVRCQATTLAVAAERG 239

Query: 236 FLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            L  L+GSC++A+   A   G  L      L  DG
Sbjct: 240 ALYALEGSCRTAVGAHARLDGLILTMIVEALTPDG 274


>gi|153803403|ref|ZP_01957989.1| porphobilinogen deaminase [Vibrio cholerae MZO-3]
 gi|124121060|gb|EAY39803.1| porphobilinogen deaminase [Vibrio cholerae MZO-3]
          Length = 311

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVDDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G+T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGNTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|182677009|ref|YP_001831155.1| porphobilinogen deaminase [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182632892|gb|ACB93666.1| porphobilinogen deaminase [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 337

 Score =  207 bits (528), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 126/275 (45%), Positives = 162/275 (58%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            R+GTR SPLALA A E    L   H      + I  + T GD I +R L+  GGKGLFT
Sbjct: 19  LRLGTRGSPLALAQAHELADRLARAHGFAKEAVAITIIRTSGDMIQDRPLSLAGGKGLFT 78

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+++ LI G +D AVHSAKD+PT L + L I+ YLPRED+RDV+IS  A   +DL   S
Sbjct: 79  KELDQALIEGMVDLAVHSAKDLPTILPEDLIIAGYLPREDVRDVWISPKAGHPRDLPPGS 138

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GT+SLRR ALL R R D+ V   RG +ETRL KL   +  A LLA AG++RL      
Sbjct: 139 VVGTASLRRGALLKRLRPDLEVRLLRGNVETRLAKLAAGEVDATLLALAGLRRLGLADKA 198

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L IEDF P+ GQGAI I T  ++     L+  I    T  ++  ER FL  LDGSCK
Sbjct: 199 TQVLAIEDFLPAAGQGAIGITTRRDDAATLALLAPILDPATHVALAAERGFLTVLDGSCK 258

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNG 280
           + I   A  +   +   GIVL  DG  + E   +G
Sbjct: 259 TPIGAHATVEHDQVTLRGIVLRPDGSEWFEACESG 293


>gi|21241393|ref|NP_640975.1| porphobilinogen deaminase [Xanthomonas axonopodis pv. citri str.
           306]
 gi|23821681|sp|Q8PPR3|HEM3_XANAC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|21106726|gb|AAM35511.1| porphobilinogen deaminase [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 304

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 171/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +     +L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVADALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L +   + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDEPFVLPAILERGDPADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  E  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLEARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDAGRTRVCVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  L+  G+V  ASDG++ H    +G+  D   +GR  AQ +
Sbjct: 242 VPVAAFARWEGQDLFLQGMVGSASDGRLIH-ADAHGSADDTEALGRRVAQGL 292


>gi|229515846|ref|ZP_04405304.1| porphobilinogen deaminase [Vibrio cholerae TMA 21]
 gi|229527138|ref|ZP_04416532.1| porphobilinogen deaminase [Vibrio cholerae 12129(1)]
 gi|229335369|gb|EEO00852.1| porphobilinogen deaminase [Vibrio cholerae 12129(1)]
 gi|229347109|gb|EEO12070.1| porphobilinogen deaminase [Vibrio cholerae TMA 21]
          Length = 317

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVDDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|327483021|gb|AEA77428.1| Porphobilinogen deaminase [Vibrio cholerae LMA3894-4]
          Length = 311

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGAVGIECRVDDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G T++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDTIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|150387913|ref|YP_001317962.1| porphobilinogen deaminase [Alkaliphilus metalliredigens QYMF]
 gi|229836103|sp|A6TJD5|HEM3_ALKMQ RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|149947775|gb|ABR46303.1| porphobilinogen deaminase [Alkaliphilus metalliredigens QYMF]
          Length = 316

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 112/268 (41%), Positives = 162/268 (60%), Gaps = 2/268 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  +IG+R S LAL  A    + L +  K P +   II ++T GDRI ++TL +IGGKGL
Sbjct: 2   RTIKIGSRASQLALVQAEIIINMLKE--KFPQYTYEIIKITTLGDRILDKTLDKIGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +EI+K L   +ID A+HS KDMP +  + L + A   RED RDV I+   +SL++L  
Sbjct: 60  FVKEIQKALAEEKIDLAIHSMKDMPGETPEELVLGAITKREDPRDVLITRENKSLEELPK 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +VIG+SSLRR+A ++  R DI V+  RG + TRL K+       ++LA AG+ RL  ++
Sbjct: 120 GAVIGSSSLRRQAQVMALRGDIKVVPIRGNVGTRLGKIETESLDGVILAAAGLNRLGLKE 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I   L IEDF P+ GQGA+  E    + +  E++  INHE+T+  V  ERAFL  L+G 
Sbjct: 180 KISSYLEIEDFTPAVGQGALGCEARRKDIEMLEMLLAINHEETYRCVMAERAFLKLLEGG 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGK 271
           C   I  +   +G  L+  G+V +SDG+
Sbjct: 240 CHVPIGAYGQQQGQELHMTGMVASSDGR 267


>gi|163803631|ref|ZP_02197496.1| porphobilinogen deaminase [Vibrio sp. AND4]
 gi|159172579|gb|EDP57439.1| porphobilinogen deaminase [Vibrio sp. AND4]
          Length = 312

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/288 (37%), Positives = 167/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAHFVKDALQSAH--PGLEVELVTMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T  ++ DL
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPIDFPDGLGLVTICEREDPRDAFVSNTYNNIDDL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL+ 
Sbjct: 121 PQGAVVGTCSLRRQCQLKEYRPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLEL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+  +  E   P+ GQGA+ IE  +++ + ++L++ +NH DT D V CERA    L+
Sbjct: 181 EERIRSFIEPEQSLPAVGQGAVGIECRIDDERLRKLLEPLNHRDTADRVRCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  ++   G  ++   +V   DG +      +G+R DA  +G
Sbjct: 241 GGCQVPIGSYSLLDGDNIWLRALVGEPDGSLIVRGEIHGHRNDAEALG 288


>gi|262172879|ref|ZP_06040557.1| porphobilinogen deaminase [Vibrio mimicus MB-451]
 gi|261893955|gb|EEY39941.1| porphobilinogen deaminase [Vibrio mimicus MB-451]
          Length = 311

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLKVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    KGL +     RED RD F+S+T   + D
Sbjct: 59  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPKGLGLVTICEREDPRDAFVSNTYAKIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPSGAVVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 179 LESRIRNFIEPEQSLPAVGQGAVGIECRLDDQRVRELLAPLNHTDTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A   G  ++   +V   DG         G R +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLDGDEIWLRALVGEPDGSQIVRGEIRGPRSEAEQLGITLAEQLLGQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|251787830|ref|YP_003002551.1| porphobilinogen deaminase [Dickeya zeae Ech1591]
 gi|247536451|gb|ACT05072.1| porphobilinogen deaminase [Dickeya zeae Ech1591]
          Length = 322

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/284 (39%), Positives = 163/284 (57%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L D H  P   + ++P+ T+GD + +  L ++GGKGLF 
Sbjct: 16  LRIATRQSPLALWQAHFVKQRLEDCH--PGLQVELVPMVTRGDVLLDTPLAKVGGKGLFV 73

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     R+D RD F+S+   +L DL   +
Sbjct: 74  KELELALLENRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNHYATLDDLPEGA 133

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L  +R D+ V D RG + TRL+KL+N    AI+LA AG+KRL     I
Sbjct: 134 CVGTSSLRRQCQLRAYRPDLVVRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLGLAHRI 193

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E   P+ GQGA+ +E  +++ + + L+  +NHEDT   V  ERA    L+G C+
Sbjct: 194 RTALSPEQSLPAVGQGAVGVECRLDDARTRALLAPLNHEDTATRVLAERAMNTRLEGGCQ 253

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  +  TLY   +V A DG       R G+R DA  +G
Sbjct: 254 VPIGSYAELQDETLYLRALVGAPDGSRIIYAERRGSRQDAETLG 297


>gi|78046235|ref|YP_362410.1| porphobilinogen deaminase [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|123771497|sp|Q3BXV3|HEM3_XANC5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78034665|emb|CAJ22310.1| hydroxymethylbilane synthase HemC [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 304

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 171/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEMLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDAPFVLPAILERGDPADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  E  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLEARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIYSLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  L+  G+V  ASDG++ H    +G+  D   +GR  AQ +
Sbjct: 242 VPVAAFARWEGQGLFLQGMVGSASDGRLIH-ADAHGSAEDTEALGRRVAQGL 292


>gi|86148167|ref|ZP_01066465.1| porphobilinogen deaminase [Vibrio sp. MED222]
 gi|218710949|ref|YP_002418570.1| porphobilinogen deaminase [Vibrio splendidus LGP32]
 gi|254800262|sp|B7VMD9|HEM3_VIBSL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|85834014|gb|EAQ52174.1| porphobilinogen deaminase [Vibrio sp. MED222]
 gi|218323968|emb|CAV20330.1| Porphobilinogen deaminase [Vibrio splendidus LGP32]
          Length = 312

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 110/285 (38%), Positives = 168/285 (58%), Gaps = 2/285 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++GGKGLF
Sbjct: 6   PIRIATRKSPLALWQAYFVRDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ +L   
Sbjct: 64  VKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNNIDELPQG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GT SLRR+  LL +R D+ + + RG + TRL KL++ +  AI+LA AG+KRL+ E+ 
Sbjct: 124 AVVGTCSLRRQCQLLEYRPDLIIKELRGNVGTRLGKLDDGQYDAIVLAAAGLKRLELEER 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    L+G C
Sbjct: 184 IRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHKDTADRVLCERAMNLTLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +  I  ++   G  ++   +V   DG        +G R DA  +G
Sbjct: 244 QVPIGSYSLLDGDNIWLRALVGEPDGSKMVRGEISGLRKDAEALG 288


>gi|197106866|ref|YP_002132243.1| porphobilinogen deaminase [Phenylobacterium zucineum HLK1]
 gi|238058996|sp|B4RC21|HEM3_PHEZH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|196480286|gb|ACG79814.1| porphobilinogen deaminase [Phenylobacterium zucineum HLK1]
          Length = 320

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 118/283 (41%), Positives = 166/283 (58%), Gaps = 15/283 (5%)

Query: 1   MEKKPF-RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIV-------IIPLSTKGDRITN 52
           M  +P  RIG R S L+L  +   +  +     + P N         +IP++T GDR+ +
Sbjct: 1   MPTQPVVRIGARGSKLSLTQSGIVQRRIAAALGVDPDNAAEVERVAPLIPITTTGDRVQD 60

Query: 53  RTLTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFIS 112
           R L EIGGKGLFT+EIE+ L+ G IDCAVHS KDMP +L +GL I+A   RED RD FIS
Sbjct: 61  RRLLEIGGKGLFTKEIEEALMDGRIDCAVHSMKDMPAELPEGLCIAAIPEREDPRDAFIS 120

Query: 113 HTAQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLA 172
              + L+DL   +++GT+SLRR+A  L  R D+     RG +ETRL KL   +  AILLA
Sbjct: 121 RGPERLEDLTEGAILGTASLRRQAQCLHRRPDLEAKLLRGNVETRLGKLEAGEYDAILLA 180

Query: 173 YAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNN---PKAQELVKVINHEDTWDS 229
           Y+G++RL    + K +++ ++ PP+PGQGA+ +ET   +   P AQ L        T  +
Sbjct: 181 YSGLRRLGLGHLPKSLIDPKEAPPAPGQGALAVETRAADRDLPWAQAL----RCRPTTLA 236

Query: 230 VNCERAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKI 272
           V  ER  L  L+GSC++ I   A+ +G T       L+ DGK+
Sbjct: 237 VAAERGALIALEGSCRTPIGAHAWLEGGTCKLIVEALSPDGKL 279


>gi|258623142|ref|ZP_05718154.1| porphobilinogen deaminase [Vibrio mimicus VM573]
 gi|258584625|gb|EEW09362.1| porphobilinogen deaminase [Vibrio mimicus VM573]
          Length = 326

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 16  MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLKVELVTMVTRGDVILDTPLAKVGG 73

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + D
Sbjct: 74  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPQGLGLVTICEREDPRDAFVSNTYAKIDD 133

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 134 LPSGAVVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 193

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 194 LESRIRSFIEPEQSLPAVGQGAVGIECRLDDQRVRELLAPLNHTDTADRVRCERAMNLTL 253

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A   G  ++   +V   DG         G R +A  +G   A+ +    
Sbjct: 254 QGGCQVPIGSYALLDGDEIWLRALVGEPDGSQIVRGEIRGPRSEAEQLGITLAEQLLGQG 313

Query: 301 NKNVFN 306
            K +  
Sbjct: 314 AKEILE 319


>gi|262375167|ref|ZP_06068401.1| porphobilinogen deaminase [Acinetobacter lwoffii SH145]
 gi|262310180|gb|EEY91309.1| porphobilinogen deaminase [Acinetobacter lwoffii SH145]
          Length = 310

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 166/286 (58%), Gaps = 2/286 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L D+H      + ++   T+GD+I +  L +IGGKGL
Sbjct: 5   KTLKIATRQSPLALWQAEHIRARLQDLHA--GLQVELVTFVTQGDKILDTPLAKIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+T  S ++L  
Sbjct: 63  FVKELEAALLDGRADLAVHSMKDVPMALPEGLSLAVICEREDPLDAFVSNTYTSFEELPQ 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK  +L+ R D+ +ID RG + TRL+KL+  +  AI+LA AG+KRL   +
Sbjct: 123 GAKVGTSSLRRKTQILKQRPDLDIIDLRGNVGTRLSKLDAGQYDAIILASAGLKRLGLAE 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L  E   P+ GQGA+ +E   ++    +L++ + H DT   V  ERAF A L+G 
Sbjct: 183 RIRHTLTPEVSLPAVGQGALGLECRTHDQTVLDLIQPLLHADTDACVRAERAFNAYLEGG 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           C+  IAG+A  K   +   G V + DG +     + G   DA  +G
Sbjct: 243 CQVPIAGYATLKEGVISIEGRVGSIDGAVLLRAQQTGKTADAEQLG 288


>gi|289664026|ref|ZP_06485607.1| porphobilinogen deaminase [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 304

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 171/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDAPFVLPAILERGDPADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  +  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLDARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  L+  G+V  ASDG++ H    +G+  D   +GR  AQ +
Sbjct: 242 VPVAAFARWEGEGLFLQGMVGSASDGRLIH-ADAHGSADDTEALGRRVAQGL 292


>gi|253690341|ref|YP_003019531.1| porphobilinogen deaminase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259646261|sp|C6DHC2|HEM3_PECCP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|251756919|gb|ACT14995.1| porphobilinogen deaminase [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 313

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 117/284 (41%), Positives = 165/284 (58%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   IRIATRQSPLALWQARYVQQCLN--HLYPDLHVELVPMVTRGDIILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL+ L   S
Sbjct: 64  KELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNRYDSLEQLPEGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+KRL  E+ I
Sbjct: 124 CVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLAKLDNGEYDAIILAVAGLKRLGLEERI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E+  P+ GQGAI IE  +N+ + ++L+  +NH  T   V  ERA    L+G C+
Sbjct: 184 RCALSPEESLPAVGQGAIGIECRLNDDRIRQLLAPLNHPATAARVQAERAMNVRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  +G TL+   +V A DG       R GN  DA  IG
Sbjct: 244 VPIGSYAELEGDTLWLRALVGAPDGSQMIVGERRGNVSDAEQIG 287


>gi|84393564|ref|ZP_00992318.1| porphobilinogen deaminase [Vibrio splendidus 12B01]
 gi|84375843|gb|EAP92736.1| porphobilinogen deaminase [Vibrio splendidus 12B01]
          Length = 312

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 110/285 (38%), Positives = 167/285 (58%), Gaps = 2/285 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++GGKGLF
Sbjct: 6   PIRIATRKSPLALWQAYFVRDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    KGL +     RED RD F+S+T  ++ +L   
Sbjct: 64  VKELEVAMLEGRADLAVHSMKDVPVDFPKGLGLVTICEREDPRDAFVSNTYNNIDELPQG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GT SLRR+  LL +R D+ + + RG + TRL KL++ +  AI+LA AG+KRL+ E+ 
Sbjct: 124 AAVGTCSLRRQCQLLEYRPDLIIKELRGNVGTRLGKLDDGQYDAIVLAAAGLKRLELEER 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    L+G C
Sbjct: 184 IRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHKDTADRVLCERAMNLTLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +  I  ++   G  ++   +V   DG        +G R DA  +G
Sbjct: 244 QVPIGSYSLLDGDNIWLRALVGEPDGSKMVRGEISGLRKDAEALG 288


>gi|261210172|ref|ZP_05924469.1| porphobilinogen deaminase [Vibrio sp. RC341]
 gi|260840712|gb|EEX67261.1| porphobilinogen deaminase [Vibrio sp. RC341]
          Length = 311

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + D
Sbjct: 59  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYAKIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPSGAVVGTCSLRRQCQLKSARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 179 LESRIRNFIEPEQSLPAVGQGAVGIECRLDDQRVRELLAPLNHTDTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G R +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDHIWLRALVGEPDGSQIVRGEIRGPRSEAEQLGITLAEQLLEQG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKEILD 304


>gi|269961540|ref|ZP_06175903.1| porphobilinogen deaminase [Vibrio harveyi 1DA3]
 gi|269833769|gb|EEZ87865.1| porphobilinogen deaminase [Vibrio harveyi 1DA3]
          Length = 312

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 109/288 (37%), Positives = 167/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAHYVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNNIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL+ 
Sbjct: 121 PQGAVVGTCSLRRQCQLKEYRPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLEL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+  +  E   P+ GQGA+ IE  V++ +  +L++ +NH+DT D V CERA    L+
Sbjct: 181 EERIRSFIEPEQSLPAVGQGAVGIECRVDDERLLKLLEPLNHQDTADRVRCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  ++   G  ++   +V   DG +       G+R DA  +G
Sbjct: 241 GGCQVPIGSYSLLDGDNIWLRALVGEPDGSLIVRGEIRGHRNDAEALG 288


>gi|145346959|ref|XP_001417948.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144578176|gb|ABO96241.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 325

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 115/303 (37%), Positives = 174/303 (57%), Gaps = 4/303 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHN--IVIIPLSTKGDRITNRTLTEIGGKGLF 64
           +IGTR SPLALA A+ TR  L +       +  + I  + T GD++ ++ L +IGGKGLF
Sbjct: 13  KIGTRGSPLALAQAYMTRDLLKENFPELAEDGALEICIIKTTGDKVLDQPLADIGGKGLF 72

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T E++  L+ G ID AVHS KD+PT L +G+ +   LPRED+RD F+     SL  L   
Sbjct: 73  TRELDDALLDGRIDIAVHSMKDVPTYLPEGMVLPCMLPREDVRDAFLCLKYDSLSQLPEG 132

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GT+SLRR++ LL     +  ++FRG +++R+ KL        LLA AG+KR+   + 
Sbjct: 133 AVVGTASLRRQSQLLYKFPTLKCVNFRGNVQSRIRKLKEEVVDCTLLAIAGLKRMDLAQH 192

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
            K I+  E+  P+  QGAI I     + K    +  +NHEDT  +V  ER+FLA LDGSC
Sbjct: 193 AKVIIPTEEMLPAVAQGAIGITCRAGDDKQLAFLAKLNHEDTRMAVEGERSFLAALDGSC 252

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNG--NRCDAINIGRDAAQYIRFISNK 302
           ++ IA   +     + F G++ + DGK   E +R G  +    ++ G+DA   ++  +  
Sbjct: 253 RTPIAAHCHLVDGKMQFRGLIASLDGKQVLETTREGAWDAASLLDAGKDAGAELKGKAPA 312

Query: 303 NVF 305
           + F
Sbjct: 313 DFF 315


>gi|229520088|ref|ZP_04409516.1| porphobilinogen deaminase [Vibrio cholerae TM 11079-80]
 gi|229342876|gb|EEO07866.1| porphobilinogen deaminase [Vibrio cholerae TM 11079-80]
          Length = 317

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDAILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  VN+ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVNDQRVRALLAPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGDHIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|332304814|ref|YP_004432665.1| porphobilinogen deaminase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172143|gb|AEE21397.1| porphobilinogen deaminase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 309

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 172/296 (58%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LA+  A   ++ L++ H  P   + ++P+ST+GDRI +  L +IGG
Sbjct: 1   MSDRVIRIATRKSTLAMWQAEYVQAKLLEAH--PQLKVELVPMSTQGDRILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  +  G  D AVHS KD+P     G  +     RE+  D F+S+T  ++++
Sbjct: 59  KGLFIKELEIAMSEGRADIAVHSMKDVPVDFPDGFGLHCICERENPYDAFVSNTYSAIEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+++ D RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPQGAVVGTSSLRRQCQIRSARPDLTIRDLRGNVNTRLAKLDEGQYDAIILAAAGLIRLN 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            ++ IK  +      P+ GQGA+ IE   ++ +  EL+K +NH DT   V  ERA  A+L
Sbjct: 179 MQERIKAYIEPTVSLPAVGQGAVGIECRNDDAELIELLKPLNHADTESRVKAERAMNAKL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  I  +A   G  LY  G+V + DG +  +  + G+  DA +IG D A+ +
Sbjct: 239 NGGCQVPIGSYAVLNGDELYLRGLVGSPDGSLLLQAEKRGSINDAQSIGIDVAEQL 294


>gi|292486675|ref|YP_003529545.1| Porphobilinogen deaminase [Erwinia amylovora CFBP1430]
 gi|292897912|ref|YP_003537281.1| porphobilinogen deaminase [Erwinia amylovora ATCC 49946]
 gi|291197760|emb|CBJ44855.1| porphobilinogen deaminase [Erwinia amylovora ATCC 49946]
 gi|291552092|emb|CBA19129.1| Porphobilinogen deaminase [Erwinia amylovora CFBP1430]
 gi|312170741|emb|CBX79003.1| Porphobilinogen deaminase [Erwinia amylovora ATCC BAA-2158]
          Length = 313

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 167/289 (57%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L+D H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSDKILRIATRKSPLALWQAKYVQQRLIDCH--PRLRVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++SG  D AVHS KD+P    +GL + A   R+D  D F+S+   S+  
Sbjct: 59  KGLFVKELENAMLSGHADIAVHSMKDVPVAFPQGLGLVAICERDDPHDAFVSNHYASVDS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPAGAIVGTSSLRRQCQLSARRPDLVIHSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++++  E+  P+ GQGA+ IE  +++ +   L+  +NH+DT   V+ ERA    L
Sbjct: 179 LSGRIRQVMPAEESLPAVGQGAVGIECRLDDMRTIGLLAALNHDDTACRVSAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G  L+  G+V + DG       R G+R DA  +G
Sbjct: 239 EGGCQVPIGSYALLEGDRLWLRGLVGSPDGSQMVRGERRGSRADAEKMG 287


>gi|229593301|ref|YP_002875420.1| porphobilinogen deaminase [Pseudomonas fluorescens SBW25]
 gi|259646262|sp|C3K424|HEM3_PSEFS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|229365167|emb|CAY53424.1| porphobilinogen deaminase [Pseudomonas fluorescens SBW25]
          Length = 313

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 167/296 (56%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLKVSLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLENEADIAVHSMKDVPMDFPEGLGLFCICEREDPRDAFVSNTYASLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPLGSIVGTSSLRRQAQLLTRRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +++ED  P+ GQGA+ IE    +     L+K ++H DT   V  ERA    L
Sbjct: 179 FEDRITSAISVEDSLPAGGQGAVGIECRTADSDIHALLKPLDHHDTEVRVTAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  L+  G+V   +G         G +CDA  +G   AQ +
Sbjct: 239 NGGCQVPIACYAVLEGENLWLRGLVGDPEGGNLLTAEVRGPQCDATALGIQVAQAL 294


>gi|308803813|ref|XP_003079219.1| putative porphobilinogen deaminase (ISS) [Ostreococcus tauri]
 gi|116057674|emb|CAL53877.1| putative porphobilinogen deaminase (ISS) [Ostreococcus tauri]
          Length = 441

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 120/305 (39%), Positives = 173/305 (56%), Gaps = 8/305 (2%)

Query: 7   RIGTRCSPLALAHAFETRSSLMD----VHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           RIGTR SPLALA A+ TR  L +    + +     I II   T GD++ ++ L +IGGKG
Sbjct: 48  RIGTRGSPLALAQAYMTRDLLKENFPELAEDGALEICII--KTTGDKVLDQPLADIGGKG 105

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT E++  L+ G ID AVHS KD+PT L +G+ +   LPRED+RD F+     SL DL 
Sbjct: 106 LFTRELDDALLDGRIDIAVHSMKDVPTYLPEGMVLPCMLPREDVRDAFLCLKYDSLDDLP 165

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GT+SLRR++ LL     +  ++FRG +++R+ KL        LLA AG+KR+   
Sbjct: 166 EGAVVGTASLRRQSQLLYKYPTLKCVNFRGNVQSRIRKLKEEVVDCTLLAIAGLKRMDLA 225

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           +  K I+  E   P+  QGAI I     + K    +  +NHEDT  +V  ERAFLA LDG
Sbjct: 226 QHAKLIIPTEQMLPAVAQGAIGITCRGGDDKQLAFLAKLNHEDTRMAVEGERAFLAALDG 285

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNG--NRCDAINIGRDAAQYIRFIS 300
           SC++ IA   +     + F G++ + DGK   E +R G  +    +  G DA   ++  +
Sbjct: 286 SCRTPIAAHCHNVDGKMQFRGLIASLDGKEVLETTREGAWDAASLLAAGTDAGAELKGKA 345

Query: 301 NKNVF 305
             + F
Sbjct: 346 PADFF 350


>gi|37528461|ref|NP_931806.1| porphobilinogen deaminase [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|55976477|sp|Q7MYN1|HEM3_PHOLL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|36787899|emb|CAE17016.1| porphobilinogen deaminase (PBG) (hydroxymethylbilane synthase)
           (HMBS) (pre-uroporphyrinogen synthase) [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 313

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 163/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLA+  A   +  L   H  P   + ++P+ T+GD I +  L +IGG
Sbjct: 1   MSTKTIRIATRQSPLAMWQALYVQQKLQQCH--PDLEVQLVPMVTQGDVILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S    SL +
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPISFPEGLGLVTICERDDPRDAFVSVKYHSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ V D RG + TRLNKL+N    AI+LA AG+KRLK
Sbjct: 119 LPTGSIVGTSSLRRQCQLRELRPDLIVRDLRGNVGTRLNKLDNGHYDAIILAVAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L  E   P+ GQGA+ IE  +++ + Q L+  +NH DT   V  ERA    L
Sbjct: 179 LHERIRTPLTAEQSLPAVGQGAVGIECRLDDQQTQTLLAPLNHYDTEVCVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  I  +A  +   ++   +V A DG +     R     DA   G + A+ +
Sbjct: 239 EGGCQVPIGSYAIWQDGKIWLRALVGAPDGSVIIRGERTALPKDACQAGVELAEEL 294


>gi|194336060|ref|YP_002017854.1| porphobilinogen deaminase [Pelodictyon phaeoclathratiforme BU-1]
 gi|238058995|sp|B4SFI2|HEM3_PELPB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|194308537|gb|ACF43237.1| porphobilinogen deaminase [Pelodictyon phaeoclathratiforme BU-1]
          Length = 313

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 118/270 (43%), Positives = 159/270 (58%), Gaps = 2/270 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L      P  +I +  + T GD + +  L++IG  G
Sbjct: 2   KKQLIIGTRSSPLALWQAEFTKAEL--SRHFPELDITLKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK LI+ EID AVHS KD+PT    GL I+++  RED RDV IS     LKDL 
Sbjct: 60  LFTKDIEKHLITKEIDLAVHSLKDVPTATPDGLIITSFTEREDTRDVIISKNGVKLKDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            ++ + TSSLRR + LL  R D+ + D RG + TR  K +N +  A++LAYAG+ RL   
Sbjct: 120 QNAKMATSSLRRMSQLLSLRPDLDIRDIRGNLNTRFQKFDNGEFDAMMLAYAGVFRLNFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  E   P+ GQGA+ IET V++ + +E+V+++NH  T      ERA L  L G
Sbjct: 180 DRISEILPHEVMLPAVGQGALGIETRVDDEQTREIVRILNHSTTEYCCRAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKI 272
            C+  I  +A  K  TL     V + DGKI
Sbjct: 240 GCQIPIGAYASFKNGTLTLLAYVGSVDGKI 269


>gi|301062020|ref|ZP_07202731.1| hydroxymethylbilane synthase [delta proteobacterium NaphS2]
 gi|300443871|gb|EFK07925.1| hydroxymethylbilane synthase [delta proteobacterium NaphS2]
          Length = 316

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 116/292 (39%), Positives = 172/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  +   +  L   H     ++ +I + T GD+I +  L++IGGKGLF 
Sbjct: 3   IRIGTRGSKLALTQSEWIKEQLEIRHS--GIHVDLIKIKTTGDKILDTPLSKIGGKGLFV 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+   ID AVHS KD+P +L + L +S + PRED  D  I+   + L  L   +
Sbjct: 61  KEIEEALLQNRIDVAVHSMKDVPAELPEALMLSTFPPREDPSDALIAQENRRLDQLPEGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR A LL  R D++++  RG ++TRL KL + +  A++LA AG+ RL    VI
Sbjct: 121 RVGTSSLRRGAQLLHLRPDLTLVPLRGNVDTRLGKLKSGEVEAVILATAGLNRLGLSGVI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + +      P+ GQGA+ +E   ++ +    +  +NH+DT  +V  ER FL  L+G C+
Sbjct: 181 TQRIPFHQLLPAVGQGALGLEVRRDDRETIRRLDFLNHDDTRTAVTAERGFLKTLEGGCQ 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDG-KIFHEVSRNGNRCDAINIGRDAAQYI 296
             IAGFA   G  L F G+V   DG +I+ E++  G+R DA  IG +AA+ +
Sbjct: 241 VPIAGFAQIVGDNLSFEGLVAELDGSRIYKEIA-TGSRDDAEKIGIEAAKTL 291


>gi|218781846|ref|YP_002433164.1| porphobilinogen deaminase [Desulfatibacillum alkenivorans AK-01]
 gi|218763230|gb|ACL05696.1| porphobilinogen deaminase [Desulfatibacillum alkenivorans AK-01]
          Length = 310

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 120/301 (39%), Positives = 171/301 (56%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR SPLAL  A E  ++L++  + P     ++ + TKGD+I +  L ++GGKGLF 
Sbjct: 7   IKIGTRGSPLALWQA-EHVAALLE-RRNPNVKTELVVIKTKGDKILDVPLAKVGGKGLFV 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G  D AVHS KD+P++   GL ++A + RED RD  I   A+ L DL  ++
Sbjct: 65  KEIEESLLDGRTDMAVHSMKDVPSEFPPGLCLAAIMEREDPRDALICSRAKGLLDLPPNA 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTSSLRR A LL    D+ +   RG I TRL+KL +    AI+LA AG+KR+  +  +
Sbjct: 125 KIGTSSLRRSAQLLALMPDLQIEPLRGNIGTRLDKLTSLNLDAIVLAAAGVKRMAMDDKV 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E +  E   P+ GQGA+ IE   ++P A  L + +NHE T   V  ERAFL  LDG C+
Sbjct: 185 SEYIPEETVLPAVGQGAMGIEIREDDPVAGPLARALNHEPTQVIVTGERAFLKRLDGGCQ 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +A     KG  L   G++   DG      S +G + DA  +G   A+ +     K V 
Sbjct: 245 VPVAAHGRLKGDFLQLTGVIAGVDGTPIFRDSVSGKKEDAKELGVKLAEKLLNAGGKAVL 304

Query: 306 N 306
           +
Sbjct: 305 D 305


>gi|153835503|ref|ZP_01988170.1| porphobilinogen deaminase [Vibrio harveyi HY01]
 gi|156972662|ref|YP_001443569.1| porphobilinogen deaminase [Vibrio harveyi ATCC BAA-1116]
 gi|166217790|sp|A7MXU9|HEM3_VIBHB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|148867929|gb|EDL67139.1| porphobilinogen deaminase [Vibrio harveyi HY01]
 gi|156524256|gb|ABU69342.1| hypothetical protein VIBHAR_00314 [Vibrio harveyi ATCC BAA-1116]
          Length = 312

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 109/288 (37%), Positives = 167/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNNIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL+ 
Sbjct: 121 PQGAVVGTCSLRRQCQLKEYRPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLEL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+  +  E   P+ GQGA+ IE  V++ +  +L++ +NH+DT D V CERA    L+
Sbjct: 181 EERIRSFIEPEQSLPAVGQGAVGIECRVDDERLLKLLEPLNHQDTADRVRCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  ++   G  ++   +V   DG +       G+R DA  +G
Sbjct: 241 GGCQVPIGSYSLLDGDNIWLRALVGEPDGSLIVRGEIRGHRNDAEALG 288


>gi|16124327|ref|NP_418891.1| porphobilinogen deaminase [Caulobacter crescentus CB15]
 gi|221233009|ref|YP_002515445.1| porphobilinogen deaminase [Caulobacter crescentus NA1000]
 gi|24211766|sp|Q9ABZ8|HEM3_CAUCR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800240|sp|B8GXG1|HEM3_CAUCN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|13421169|gb|AAK22059.1| porphobilinogen deaminase [Caulobacter crescentus CB15]
 gi|220962181|gb|ACL93537.1| porphobilinogen deaminase [Caulobacter crescentus NA1000]
          Length = 322

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 160/276 (57%), Gaps = 9/276 (3%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPP--------HNIVIIPLSTKGDRITNRT 54
           + P RIG R S L+LA +   ++ +     +P             +IP+ T GDRI +R 
Sbjct: 4   QPPIRIGARGSKLSLAQSGLMQARIAHALGVPAGASKDEIEAAAPLIPIVTSGDRIQDRR 63

Query: 55  LTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHT 114
           L EIGGKGLFT+EIE+ L+ G IDCAVHS KDMP +L  GL ++A   RED RD FISH 
Sbjct: 64  LMEIGGKGLFTKEIEEALLDGRIDCAVHSLKDMPAELPPGLVLAATPEREDPRDAFISHV 123

Query: 115 AQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYA 174
            + L+DL   + +GT+SLRR+A  L  R D+ ++  RG ++TRL KL   +A AILLA +
Sbjct: 124 CERLEDLPKGARLGTASLRRQAQALHVRPDLEIVMLRGNVDTRLAKLERGEADAILLAQS 183

Query: 175 GIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCER 234
           G+ RL    + +  L+ +  PP+PGQGA+ IET   +  A  L + +    T  +V  ER
Sbjct: 184 GLNRLGLGHLTRSWLDPDACPPAPGQGALVIETRAEDIGAPWL-EAVRCRQTTIAVAAER 242

Query: 235 AFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
             L  L+GSC++AI   A   G+ L      L  DG
Sbjct: 243 GALLALEGSCRTAIGARAILDGARLSMIVEALTPDG 278


>gi|262404857|ref|ZP_06081411.1| porphobilinogen deaminase [Vibrio sp. RC586]
 gi|262348941|gb|EEY98080.1| porphobilinogen deaminase [Vibrio sp. RC586]
          Length = 311

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 116/307 (37%), Positives = 171/307 (55%), Gaps = 4/307 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + D
Sbjct: 59  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPQGLGLVTICEREDPRDAFVSNTYVKIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPSGAVVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 179 LESRIRNFIEPEQSLPAVGQGAVGIECRLDDQRVRELLAPLNHTDTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG-KIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
            G C+  I  +A   G  ++   +V   DG +I H   R G R +A  +G   A+ +   
Sbjct: 239 QGGCQVPIGSYALLDGDDIWLRALVGEPDGSQIVHGEIR-GPRSEAEQLGITLAEQLLEQ 297

Query: 300 SNKNVFN 306
             K +  
Sbjct: 298 GAKEILE 304


>gi|166710503|ref|ZP_02241710.1| porphobilinogen deaminase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 304

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 116/292 (39%), Positives = 172/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ G+ DCAVHS KD+P +L     + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAVLRGDADCAVHSLKDVPMELDDPFVLPAILERGDPADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  +  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLDARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  L+  G+V  ASDG++ H    +G+  D  ++GR  AQ +
Sbjct: 242 VPVAAFARWEGEGLFLQGMVGSASDGRLIH-ADAHGSADDTEDLGRRVAQGL 292


>gi|163748699|ref|ZP_02155952.1| porphobilinogen deaminase [Shewanella benthica KT99]
 gi|161331809|gb|EDQ02613.1| porphobilinogen deaminase [Shewanella benthica KT99]
          Length = 309

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 118/306 (38%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   ++ L   H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNVIRIATRKSPLALWQAEFVKAELEKFH--PGLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P     GL +     RED RD F+S+  +S+ D
Sbjct: 59  KGLFVKELEVAILEDRADIAVHSIKDVPVDFPDGLGLEVICEREDPRDAFVSNDYKSIGD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ +ID RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRGMRPDLKIIDLRGNVGTRLGKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ ED  P+ GQGA+ IE   +N + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERITSFISTEDSLPANGQGAVGIECRTDNERVKALLAPLEHAETRFRVTAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +G TL   G+V   DG      +  G + DA  IG   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIQGDTLTLRGLVGNPDGSKIITGTCVGPKTDAKAIGIALAEELLGKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKEILD 304


>gi|328472411|gb|EGF43277.1| porphobilinogen deaminase [Vibrio parahaemolyticus 10329]
          Length = 312

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 112/288 (38%), Positives = 165/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  S+ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSSIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRLK 
Sbjct: 121 PQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLKL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  I+  +  E   P+ GQGA+ IE  V++ +  +L++ +NH+DT D V CERA    L+
Sbjct: 181 EDRIRSFIEPEQSLPAVGQGAVGIECRVDDERLLKLLEPLNHKDTADRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  +A  +G  ++   +V   DG         G+R D   +G
Sbjct: 241 GGCQVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEVRGHRKDGEALG 288


>gi|254230107|ref|ZP_04923503.1| porphobilinogen deaminase [Vibrio sp. Ex25]
 gi|262392880|ref|YP_003284734.1| porphobilinogen deaminase [Vibrio sp. Ex25]
 gi|151937352|gb|EDN56214.1| porphobilinogen deaminase [Vibrio sp. Ex25]
 gi|262336474|gb|ACY50269.1| porphobilinogen deaminase [Vibrio sp. Ex25]
          Length = 312

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 166/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAYFVKDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSNIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRLK 
Sbjct: 121 PQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLKL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    L+
Sbjct: 181 EERIRSFIEPEQSLPAVGQGAVGIECRLDDERLLKLLEPLNHQDTVDRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  +A   G  ++   +V   DG         G+R D   +G
Sbjct: 241 GGCQVPIGSYALLDGDNIWLRALVGEPDGSEIVRGEIRGHRKDGEALG 288


>gi|261823396|ref|YP_003261502.1| porphobilinogen deaminase [Pectobacterium wasabiae WPP163]
 gi|261607409|gb|ACX89895.1| porphobilinogen deaminase [Pectobacterium wasabiae WPP163]
          Length = 313

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 167/284 (58%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   IRIATRQSPLALWQARYVQQRLN--HLYPDLSVELVPMVTRGDIILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL  L   S
Sbjct: 64  KELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNHYDSLDQLPQGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL  E+ I
Sbjct: 124 CVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLEERI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E+  P+ GQGAI IE  +++ + ++L+  +NH DT   V  ERA    L+G C+
Sbjct: 184 RCALSPEESLPAVGQGAIGIECRLDDDRIRQLLAPLNHTDTAARVLAERAMNVRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  +G+TL+   +V A DG       R G+  DA  IG
Sbjct: 244 VPIGSYAELEGNTLWLRALVGAPDGSQMIVGERKGSVVDAEKIG 287


>gi|260774857|ref|ZP_05883759.1| porphobilinogen deaminase [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609282|gb|EEX35437.1| porphobilinogen deaminase [Vibrio coralliilyticus ATCC BAA-450]
          Length = 312

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 167/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAYYVRDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYANIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  +  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL+ 
Sbjct: 121 PQGAVVGTCSLRRQCQIKEYRPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLEL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    L+
Sbjct: 181 EERIRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHKDTADRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  ++   G  ++   +V   DG         G+R DA  +G
Sbjct: 241 GGCQVPIGSYSLLDGDDIWLRALVGEPDGSKIVRGEIKGSRADAEKLG 288


>gi|94498044|ref|ZP_01304607.1| porphobilinogen deaminase [Sphingomonas sp. SKA58]
 gi|94422479|gb|EAT07517.1| porphobilinogen deaminase [Sphingomonas sp. SKA58]
          Length = 313

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 117/276 (42%), Positives = 157/276 (56%), Gaps = 5/276 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P R+GTR SPLALA A  T  +L+  H      I I+ + T GDRI +R L +IGGK L
Sbjct: 11  RPLRLGTRGSPLALAQARLTAQALIAAHGWSADAIEIVTVQTSGDRIQDRALADIGGKAL 70

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           +T+E+++ L++GE D +VHS KD+ T       I+A LPR D RD  I   A S   L  
Sbjct: 71  WTKELDRALVAGETDLSVHSMKDVETVRHDIFHIAAMLPRADPRDKLIG--AASFDALPP 128

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
           + ++GTSS RR A + R R D ++  FRG + TRL KL   + HA LLA AG+ RL +  
Sbjct: 129 NPIVGTSSPRRGAQVKRLRPDATITLFRGNVATRLAKLAAGEVHATLLAAAGLDRLDQGN 188

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V   I+ ++   P+P QGA+ IE    N    E V  INH DT+D+V  ERA L  L G+
Sbjct: 189 V-GTIIPVDTMLPAPSQGAVGIEILAGNAPVIEAVAAINHRDTFDTVMMERAVLRGLGGT 247

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRN 279
           C S IA  A   G  L     +++ DG+    VS N
Sbjct: 248 CHSPIAALALVDGDDLMLRAEIISPDGQ--ETVSEN 281


>gi|289667461|ref|ZP_06488536.1| porphobilinogen deaminase [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 304

 Score =  205 bits (522), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 116/292 (39%), Positives = 171/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ G+ DCAVHS KD+P +L     + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGDADCAVHSLKDVPMELDDPFVLPAILERGDPADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  +  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLDARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  L+  G+V  ASDG++ H    +G+  D   +GR  AQ +
Sbjct: 242 VPVAAFARWEGEGLFLQGMVGSASDGRLIH-ADAHGSADDTEALGRRVAQGL 292


>gi|320354663|ref|YP_004196002.1| hydroxymethylbilane synthase [Desulfobulbus propionicus DSM 2032]
 gi|320123165|gb|ADW18711.1| hydroxymethylbilane synthase [Desulfobulbus propionicus DSM 2032]
          Length = 319

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 112/301 (37%), Positives = 172/301 (57%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LA+  +   ++ +   H  P   + ++ ++TKGDRI +  L ++GGKGLF 
Sbjct: 5   LRIGTRASLLAVTQSTWVKTQIEQAH--PGTRVELVKITTKGDRILDVPLAKVGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L++GE+D AVHS KD+PT+L +GL I     RE   D F+S T  +L DL   +
Sbjct: 63  KEIEDALLAGEVDLAVHSMKDVPTELPEGLHIGVIPVRETPYDAFLSKTCTTLADLPQGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTSSLRRK+ L+  R D+ ++D RG I+TRL KL+     AI+LA AG++RL  E  I
Sbjct: 123 TIGTSSLRRKSQLMALRPDLDIVDLRGNIDTRLRKLDEGVYDAIILAGAGLRRLHLEHRI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L      P+  QGA+ IE   ++ +  + ++ ++H +T  +V  ERAFL  L+G C+
Sbjct: 183 TALLEPTQMLPAISQGALGIELRQDDTELADGLRFLHHGETAVAVEAERAFLLRLEGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             IA  A     ++   G++ + DG+   + +  G    A  +G   AQ +     K + 
Sbjct: 243 VPIAAHATLDSGSVTLTGLIASVDGRQILKEATTGPAEQAARLGAQLAQTLLDRGGKAIL 302

Query: 306 N 306
           +
Sbjct: 303 D 303


>gi|258626632|ref|ZP_05721462.1| porphobilinogen deaminase [Vibrio mimicus VM603]
 gi|258581136|gb|EEW06055.1| porphobilinogen deaminase [Vibrio mimicus VM603]
          Length = 311

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLKVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + D
Sbjct: 59  KGLFVKELEVAMLEGRADLAVHSMKDVPVDFPQGLGLVTICEREDPRDAFVSNTYAKIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPSGAVVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + +EL+  +NH DT D V CERA    L
Sbjct: 179 LESRIRNFIEPEQSLPAVGQGAVGIECRLDDQRVRELLVPLNHTDTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A   G  ++   +V   DG         G R +A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLDGDEIWLRALVGEPDGSQIVRGEIRGPRSEAEQLGITLAEQLLGQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|27364543|ref|NP_760071.1| porphobilinogen deaminase [Vibrio vulnificus CMCP6]
 gi|37678265|ref|NP_932874.1| porphobilinogen deaminase [Vibrio vulnificus YJ016]
 gi|33301181|sp|Q8DD85|HEM3_VIBVU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|55976475|sp|Q7MQC7|HEM3_VIBVY RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|27360662|gb|AAO09598.1| porphobilinogen deaminase [Vibrio vulnificus CMCP6]
 gi|37197004|dbj|BAC92845.1| porphobilinogen deaminase [Vibrio vulnificus YJ016]
          Length = 312

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 163/285 (57%), Gaps = 2/285 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++GGKGLF
Sbjct: 6   PIRIATRKSPLALWQAYYVKDALQKAH--PGLEVELVTMVTKGDVILDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + +L   
Sbjct: 64  VKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYHHVDELPQG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GT SLRR+  L  +R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+ E+ 
Sbjct: 124 AVVGTCSLRRQCQLKAYRPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLELEER 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  +  E   P+ GQGA+ IE   N+ +  +L++ +NH DT D V CERA    L+G C
Sbjct: 184 IRSFIEPEQSLPAVGQGAVGIECRTNDERILKLLEPLNHADTADRVKCERAMNLTLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +  I  +A  +G  ++   +V   DG         G R  A  +G
Sbjct: 244 QVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEIRGPRAQAEQLG 288


>gi|91227534|ref|ZP_01261871.1| porphobilinogen deaminase [Vibrio alginolyticus 12G01]
 gi|91188558|gb|EAS74850.1| porphobilinogen deaminase [Vibrio alginolyticus 12G01]
          Length = 312

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 165/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAYFVKDALQAAH--PSLEVELVTMVTKGDVILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + +L
Sbjct: 61  GLFVKELEIAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSHIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRLK 
Sbjct: 121 PQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLKL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    L+
Sbjct: 181 EERIRSFIEPEQSLPAVGQGAVGIECRLDDERLLKLLEPLNHQDTVDRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  +A   G  ++   +V   DG         G+R D   +G
Sbjct: 241 GGCQVPIGSYALLDGDNIWLRALVGEPDGSEIVRGEIRGHRKDGEALG 288


>gi|320154944|ref|YP_004187323.1| porphobilinogen deaminase [Vibrio vulnificus MO6-24/O]
 gi|319930256|gb|ADV85120.1| porphobilinogen deaminase [Vibrio vulnificus MO6-24/O]
          Length = 312

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 109/285 (38%), Positives = 163/285 (57%), Gaps = 2/285 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++GGKGLF
Sbjct: 6   PIRIATRKSPLALWQAYYVKDALQKAH--PGLEVELVTMVTKGDVILDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + +L   
Sbjct: 64  VKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYHHVDELPQG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +V+GT SLRR+  L  +R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+ E+ 
Sbjct: 124 AVVGTCSLRRQCQLKAYRPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLELEER 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  +  E   P+ GQGA+ IE   N+ +  +L++ +NH DT D V CERA    L+G C
Sbjct: 184 IRSFIEPEQSLPAVGQGAVGIECRTNDERILKLLEPLNHTDTADRVKCERAMNLTLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +  I  +A  +G  ++   +V   DG         G R  A  +G
Sbjct: 244 QVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEIRGPRAQAEQLG 288


>gi|323500165|ref|ZP_08105110.1| porphobilinogen deaminase [Vibrio sinaloensis DSM 21326]
 gi|323314794|gb|EGA67860.1| porphobilinogen deaminase [Vibrio sinaloensis DSM 21326]
          Length = 312

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 109/288 (37%), Positives = 166/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A+  R +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSSPIRIATRKSPLALWQAYFVRDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T  S+ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPSGLGLVTICEREDPRDAFVSNTYNSIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L  +R D+ + + RG + TRL KL+  +  AI+LA AG+KRL+ 
Sbjct: 121 PQGAVVGTCSLRRQCQLKEYRPDLIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLEL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    L+
Sbjct: 181 EERIRSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHQDTADRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  +A  +G  ++   +V   DG         G R ++  +G
Sbjct: 241 GGCQVPIGSYALLEGDDIWLRALVGEPDGSQIVRGEIKGPRSESEALG 288


>gi|310766129|gb|ADP11079.1| porphobilinogen deaminase [Erwinia sp. Ejp617]
          Length = 313

 Score =  205 bits (521), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 167/289 (57%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L+D H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSDKILRIATRKSPLALWQAKYVQQRLIDCH--PGLRVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++SG  D AVHS KD+P    +GL + A   R+D  D F+S+   S+  
Sbjct: 59  KGLFVKELEQAMLSGSADIAVHSMKDVPVAFPQGLGLVAICERDDPHDAFVSNRHASVDS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLSARRPDLVIHSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++++  E+  P+ GQGA+ IE  +++     L+  +NH++T   V+ ERA    L
Sbjct: 179 LSDRIRQVMPAEESLPAVGQGAVGIECRLDDMHTIGLLAALNHDETACRVSAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G  L+  G+V + DG       R G+R DA  +G
Sbjct: 239 EGGCQVPIGSYALLEGDQLWLRGLVGSPDGSQMVRGERRGSRADAEKMG 287


>gi|269964925|ref|ZP_06179095.1| porphobilinogen deaminase [Vibrio alginolyticus 40B]
 gi|269830401|gb|EEZ84625.1| porphobilinogen deaminase [Vibrio alginolyticus 40B]
          Length = 312

 Score =  205 bits (521), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 165/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A+  + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAYFVKDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T   + +L
Sbjct: 61  GLFVKELEIAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSHIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRLK 
Sbjct: 121 PQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLKL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I+  +  E   P+ GQGA+ IE  +++ +  +L++ +NH+DT D V CERA    L+
Sbjct: 181 EERIRSFIEPEQSLPAVGQGAVGIECRLDDERLLKLLEPLNHQDTVDRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  +A   G  ++   +V   DG         G+R D   +G
Sbjct: 241 GGCQVPIGSYALLDGDNIWLRALVGEPDGSEIVRGEIRGHRKDGEALG 288


>gi|332290269|ref|YP_004421121.1| porphobilinogen deaminase [Gallibacterium anatis UMN179]
 gi|330433165|gb|AEC18224.1| porphobilinogen deaminase [Gallibacterium anatis UMN179]
          Length = 309

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 166/296 (56%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+K   RI TR SPLAL  A   +  L  ++  P   + ++ + TKGD + +  L +IGG
Sbjct: 1   MQKDVLRIATRQSPLALWQANYIKHKLQVLY--PQLTVELVTMVTKGDVLLDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +  +GL +S    RED RD F+S+   SL +
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPMQFPQGLHLSVICEREDPRDAFVSNRYASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L  ++V+GTSSLRR+  L   R DI +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPQNAVVGTSSLRRQCQLKALRPDIELKTLRGNVGTRLRKLDEGEYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           +++ I+  +  E   P+ GQGA+ +E   ++    +L+K + H+DTWD V  ERA    L
Sbjct: 179 EQQRIRSFIAPEVSLPAVGQGAVGVECRQDDEWVNQLLKPLLHQDTWDRVIAERAMNNRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            G C+  IAG+A   G  L+   +V A DG           R  A  +G   A+ +
Sbjct: 239 QGGCQVPIAGYAILDGEQLFLRALVGAVDGSKVLRAEATAVRSQAEQLGIQVAEML 294


>gi|50123108|ref|YP_052275.1| porphobilinogen deaminase [Pectobacterium atrosepticum SCRI1043]
 gi|55976381|sp|Q6CZG3|HEM3_ERWCT RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|49613634|emb|CAG77085.1| porphobilinogen deaminase [Pectobacterium atrosepticum SCRI1043]
          Length = 313

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/284 (40%), Positives = 166/284 (58%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   IRIATRQSPLALWQARYVQQCLN--HFYPDLHVELVPMVTRGDIILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL+ L   S
Sbjct: 64  KELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNRYDSLEQLPEGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+KRL  E+ I
Sbjct: 124 CVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLAKLDNGEYDAIILAVAGLKRLGLEERI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E+  P+ GQGAI IE  +++ + ++L+  +NH DT   V  ERA    L+G C+
Sbjct: 184 RCALSPEESLPAVGQGAIGIECRLDDDRIRQLLAPLNHTDTAARVLAERAMNVRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  +G TL+   +V A DG       R G+  DA  IG
Sbjct: 244 VPIGSYAELEGDTLWLRALVGAPDGSQMIVGERKGSVSDAEKIG 287


>gi|294142612|ref|YP_003558590.1| porphobilinogen deaminase [Shewanella violacea DSS12]
 gi|293329081|dbj|BAJ03812.1| porphobilinogen deaminase [Shewanella violacea DSS12]
          Length = 309

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   ++ L   H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNVIRIATRKSPLALWQAEFVKAELEKFH--PGLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+  +S+ D
Sbjct: 59  KGLFVKELEIAMLDGRADIAVHSIKDVPVDFPDGLGLEVICEREDPRDAFVSNDYKSIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPKGAVVGTSSLRRQCQIRAMRPDLKITDLRGNVGTRLGKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E+  P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERISSFISAEESLPANGQGAVGIECRTDDERVKALLAPLEHTETRYRVTAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  FA  +G TL   G+V   DG      +  G + DA  IG   A+ +    
Sbjct: 239 QGGCQVPIGAFAEIQGDTLTLRGLVGNPDGSKIITGTSVGPKTDAKAIGITLAKELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKEILD 304


>gi|259906881|ref|YP_002647237.1| porphobilinogen deaminase [Erwinia pyrifoliae Ep1/96]
 gi|224962503|emb|CAX53958.1| Porphobilinogen deaminase [Erwinia pyrifoliae Ep1/96]
 gi|283476674|emb|CAY72503.1| hemC [Erwinia pyrifoliae DSM 12163]
          Length = 313

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 166/289 (57%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L+D H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSDKILRIATRKSPLALWQAKYVQQRLIDCH--PGLRVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++SG  D AVHS KD+P    +GL + A   R+D  D F+S+   S+  
Sbjct: 59  KGLFVKELEQAMLSGSADIAVHSMKDVPVAFPQGLGLVAICERDDPHDAFVSNRHASVDS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLSARRPDLVIHSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++++  E+  P+ GQGA+ IE  + +     L+  +NH++T   V+ ERA    L
Sbjct: 179 LSDRIRQVMPAEESLPAVGQGAVGIECRLEDMHTIGLLAALNHDETACRVSAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G  L+  G+V + DG       R G+R DA  +G
Sbjct: 239 EGGCQVPIGSYALLEGDQLWLRGLVGSPDGSQMVRGERRGSRADAEKMG 287


>gi|193212401|ref|YP_001998354.1| porphobilinogen deaminase [Chlorobaculum parvum NCIB 8327]
 gi|209572771|sp|P28464|HEM3_CHLP8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|193085878|gb|ACF11154.1| porphobilinogen deaminase [Chlorobaculum parvum NCIB 8327]
          Length = 312

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 114/269 (42%), Positives = 160/269 (59%), Gaps = 2/269 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L    + P  NI +  + T GD + +  L++IG  G
Sbjct: 2   KKEIIIGTRSSPLALWQAEFTKAEL--SKRFPDMNITLKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK L++GEID AVHS KD+PT   +GL I+++  RED RDV IS + + L DL 
Sbjct: 60  LFTKDIEKHLLAGEIDLAVHSLKDVPTGTPEGLVITSFTEREDTRDVIISKSGKGLMDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            ++ + TSSLRR + LL  R D+ ++D RG + TR  K +     A++LAYAG+ RL+  
Sbjct: 120 QNAKMATSSLRRMSQLLSLRPDLEIMDIRGNLNTRFKKFDEGDFDAMMLAYAGVYRLEFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  E   P+ GQGA+ IET  ++ + +E+V+V+N ++T      ERA L  L G
Sbjct: 180 DRITEILPHETMLPAVGQGALGIETRTDDAETREIVRVLNDDNTEMCCRAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK 271
            C+  I  F      TL     V + DGK
Sbjct: 240 GCQIPIGSFGSYIDGTLKLLAFVGSVDGK 268


>gi|255020135|ref|ZP_05292205.1| Porphobilinogen deaminase [Acidithiobacillus caldus ATCC 51756]
 gi|254970428|gb|EET27920.1| Porphobilinogen deaminase [Acidithiobacillus caldus ATCC 51756]
          Length = 319

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 117/302 (38%), Positives = 170/302 (56%), Gaps = 4/302 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RIGTR SPLAL  A   R+ L+  H  P   + I+P++T+GDR+    L EIGGKGLF
Sbjct: 17  PLRIGTRASPLALWQAEHVRAGLLRAH--PEIPVEIVPMTTQGDRMLAVPLHEIGGKGLF 74

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIE  L+ G +D AVHS KD+P +  +GL+I+A L RED+RD ++S+T    +DL   
Sbjct: 75  VKEIEAALLEGTVDLAVHSMKDVPAQQPEGLEIAAILAREDVRDAWVSNTFARPEDLPQG 134

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
             +G+SSLRR+A LL       V+D RG + TRL KL+      I+LA AG+KRL   + 
Sbjct: 135 GRVGSSSLRRRAQLLHRLPQTVVLDLRGNVATRLRKLDAGDYDGIVLAAAGLKRLGLLER 194

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+  L  E   P+ GQGAI +E   ++ + + L+K +N   T   V  ER     L G C
Sbjct: 195 IRHYLEPELSLPAVGQGAIGVEIRSDDARTRTLLKPLNDPTTSRCVGAERHMNRLLGGDC 254

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  +A  A   G+ L   G+V + DG+        G+   A ++G   AQ +     +++
Sbjct: 255 RLPVAALAEADGTGLRLRGLVASPDGRELLRAEAVGSL--AHSVGEQVAQALLAQGAQHI 312

Query: 305 FN 306
            +
Sbjct: 313 ID 314


>gi|83945095|ref|ZP_00957461.1| porphobilinogen deaminase [Oceanicaulis alexandrii HTCC2633]
 gi|83851877|gb|EAP89732.1| porphobilinogen deaminase [Oceanicaulis alexandrii HTCC2633]
          Length = 320

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 164/266 (61%), Gaps = 3/266 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVH--KIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
           I TR SPLA+A   + ++ L   H  K P  +  I+ ++T GDRIT+R L   GGKGLFT
Sbjct: 8   IATRTSPLAMAQTLDVQARLAKAHGEKDPEESFPILGMTTTGDRITDRALLLAGGKGLFT 67

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQS-LKDLALH 124
           +E+E+ L+ G+   AVHS KD+PT L  GL+I+  L RED RD  ++    S ++DL   
Sbjct: 68  KELERALLDGDARFAVHSMKDVPTTLPDGLEIACVLEREDPRDTLLTRDGISRIEDLPQG 127

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GT+S+RR++  L  R D++++  RG ++TRL KLN+ +  A  LA AG++RL +E+ 
Sbjct: 128 ATLGTASIRRQSQALALRPDLNIVLLRGNVDTRLEKLNSGEVDATFLARAGLRRLGREQA 187

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
               L +    P+P QGA+ IE   ++ +A++ ++ +NH  T  ++  ER FL  LDGSC
Sbjct: 188 ELPPLELTAVIPAPAQGAVGIEIRSDDVEARKALEPLNHLPTRIAIAAERGFLQALDGSC 247

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDG 270
           ++ IA  A  +G+ ++  G  L  DG
Sbjct: 248 RTPIAAHATLEGAEIHLRGEALMPDG 273


>gi|254226598|ref|ZP_04920179.1| porphobilinogen deaminase [Vibrio cholerae V51]
 gi|125620870|gb|EAZ49223.1| porphobilinogen deaminase [Vibrio cholerae V51]
          Length = 317

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 112/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 7   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 65  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 185 LESRIRSFIEPEQSLPAVGQGAVGIECRVDDQRVRALLTPLNHADTADRVRCERAMNLTL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G R  A  +G   A+ +    
Sbjct: 245 QGGCQVPIGSYALLEGDHIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 304

Query: 301 NKNVFN 306
            K +  
Sbjct: 305 AKEILE 310


>gi|78187286|ref|YP_375329.1| porphobilinogen deaminase [Chlorobium luteolum DSM 273]
 gi|123757188|sp|Q3B2Z5|HEM3_PELLD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78167188|gb|ABB24286.1| Porphobilinogen deaminase [Chlorobium luteolum DSM 273]
          Length = 313

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/280 (43%), Positives = 162/280 (57%), Gaps = 4/280 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L      P   I +  + T GD + +  L++IG  G
Sbjct: 2   KKQLIIGTRSSPLALWQAEFTKAEL--SRHFPDLEITLKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK LI+ EID AVHS KD+PT   +GL ISA+  RED RDV IS T   L DL 
Sbjct: 60  LFTKDIEKFLIAKEIDLAVHSLKDVPTATPEGLIISAFTEREDTRDVIISKTGAKLLDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            ++ + TSSLRR + L   R D  + D RG + TR  K +  +  A++LAYAG+ RL   
Sbjct: 120 KNAKVATSSLRRMSQLKSLRPDFEICDIRGNLNTRFKKFDEGEFDAMMLAYAGVYRLNFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  E   P+ GQGA+ IET V++ + +E+VKV+NH  T      ERA L  L G
Sbjct: 180 DRISEILPHEIMLPAVGQGALGIETRVDDEQTREIVKVMNHSTTEYCCKAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIF--HEVSRNG 280
            C+  I  +A  K  TL+    V ++DG I    E+++ G
Sbjct: 240 GCQIPIGAYASFKNGTLHLLAFVGSTDGTIGIRDEITKTG 279


>gi|28899762|ref|NP_799367.1| porphobilinogen deaminase [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838754|ref|ZP_01991421.1| porphobilinogen deaminase [Vibrio parahaemolyticus AQ3810]
 gi|260365170|ref|ZP_05777735.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus K5030]
 gi|260878130|ref|ZP_05890485.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus AN-5034]
 gi|260895813|ref|ZP_05904309.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus Peru-466]
 gi|260900854|ref|ZP_05909249.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus AQ4037]
 gi|32363175|sp|Q87KI9|HEM3_VIBPA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|28808014|dbj|BAC61251.1| porphobilinogen deaminase [Vibrio parahaemolyticus RIMD 2210633]
 gi|149747840|gb|EDM58724.1| porphobilinogen deaminase [Vibrio parahaemolyticus AQ3810]
 gi|308087192|gb|EFO36887.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus Peru-466]
 gi|308092784|gb|EFO42479.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus AN-5034]
 gi|308110595|gb|EFO48135.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus AQ4037]
 gi|308111033|gb|EFO48573.1| hydroxymethylbilane synthase [Vibrio parahaemolyticus K5030]
          Length = 312

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 111/288 (38%), Positives = 165/288 (57%), Gaps = 2/288 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDVILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYSNINEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L  +R DI + + RG + TRL KL+  +  AI+LA AG+KRLK 
Sbjct: 121 PQGAVVGTCSLRRQCQLKEYRPDIIIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLKL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  I+  +  E   P+ GQGA+ IE  V++ +  +L++ +NH+DT D V CERA    L+
Sbjct: 181 EDRIRSFIEPEQSLPAVGQGAVGIECRVDDERLLKLLEPLNHKDTADRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           G C+  I  +A  +G  ++   +V   DG         G+R D   +G
Sbjct: 241 GGCQVPIGSYALLEGDEIWLRALVGEPDGSEIVRGEVRGHRKDGEALG 288


>gi|84625435|ref|YP_452807.1| porphobilinogen deaminase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188575118|ref|YP_001912047.1| porphobilinogen deaminase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|123752694|sp|Q2NYU4|HEM3_XANOM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238059004|sp|B2SMV3|HEM3_XANOP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|84369375|dbj|BAE70533.1| porphobilinogen deaminase [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188519570|gb|ACD57515.1| porphobilinogen deaminase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 304

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 172/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ G+ DCAVHS KD+P +L     + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGDADCAVHSFKDVPMELDDPFVLPAILERGDPADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  ++ I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLDERI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A  A  +G  L+  G+V  ASDG++ H    +G+  D  ++GR  AQ +
Sbjct: 242 VPVAALARWEGEGLFLQGMVGSASDGRLIH-ADAHGSADDTEDLGRRVAQGL 292


>gi|153826278|ref|ZP_01978945.1| porphobilinogen deaminase [Vibrio cholerae MZO-2]
 gi|149739946|gb|EDM54125.1| porphobilinogen deaminase [Vibrio cholerae MZO-2]
          Length = 311

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/306 (36%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M + P RI TR SPLAL  A   + +LM  H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MTETPIRIATRQSPLALWQANYVKDALMAAH--PGLQVELVTMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T   ++D
Sbjct: 59  KGLFVKELEIAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYAKIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ + + RG + TRL+KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPSGAIVGTCSLRRQCQLKAARPDLVIKELRGNVGTRLSKLDAGEYDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  V++ + + L+  +NH DT D V CERA    L
Sbjct: 179 LESRIRSFIEPEQSLPAVGQGALGIECRVDDQRVRALLAPLNHADTADRVRCERAMNLTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G R  A  +G   A+ +    
Sbjct: 239 QGGCQVPIGSYALLEGDHIWLRALVGEPDGSQIVRGEIRGPRTQAEQLGITLAEQLLSQG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 AKEILE 304


>gi|157960202|ref|YP_001500236.1| porphobilinogen deaminase [Shewanella pealeana ATCC 700345]
 gi|189028157|sp|A8GZG4|HEM3_SHEPA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|157845202|gb|ABV85701.1| porphobilinogen deaminase [Shewanella pealeana ATCC 700345]
          Length = 310

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/306 (36%), Positives = 172/306 (56%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H+     + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNLIRIATRKSPLAMWQAEFVKAELEKIHE--GLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T ++++D
Sbjct: 59  KGLFVKELEVAMLEGLADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNTYKTIED 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRAARPDLVIKDLRGNVGTRLAKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E   P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERIASFISAEQSLPANGQGAVGIECRTDDARVKALLAPLEHAETRMRVTAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G TL   G+V   DG      S +G+  DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGAYAEIDGDTLSLRGLVGNPDGSQIITASSSGSTADAEKLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|188990080|ref|YP_001902090.1| porphobilinogen deaminase [Xanthomonas campestris pv. campestris
           str. B100]
 gi|229846307|sp|B0RNI9|HEM3_XANCB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|167731840|emb|CAP50024.1| hydroxymethylbilane synthase [Xanthomonas campestris pv.
           campestris]
          Length = 304

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 162/270 (60%), Gaps = 3/270 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVATALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D  +S+   +L+ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDAPFVLPAILERGDPADALVSNLYATLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  E  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLEARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +  +L+ V++   T   V  ERA    L GSC 
Sbjct: 182 TARLDAPEWLPAPAQGAVAVECRGDDARIHDLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFH 274
             +A FA  +G  L+  G+V  ASDG++ H
Sbjct: 242 VPVAAFARWEGEDLFLQGMVGSASDGRLIH 271


>gi|21232940|ref|NP_638857.1| porphobilinogen deaminase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66766987|ref|YP_241749.1| porphobilinogen deaminase [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|23821678|sp|Q8P536|HEM3_XANCP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|81307026|sp|Q4UYZ4|HEM3_XANC8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|21114777|gb|AAM42781.1| porphobilinogen deaminase [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66572319|gb|AAY47729.1| porphobilinogen deaminase [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 304

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 162/270 (60%), Gaps = 3/270 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVATALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D  +S+   +L+ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDAPFVLPAILERGDPADALVSNLYATLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  E  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLEARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +  +L+ V++   T   V  ERA    L GSC 
Sbjct: 182 TARLDAPEWLPAPAQGAVAVECRGDDARIHDLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFH 274
             +A FA  +G  L+  G+V  ASDG++ H
Sbjct: 242 VPVAAFARWEGEDLFLQGMVGSASDGRLIH 271


>gi|119357593|ref|YP_912237.1| porphobilinogen deaminase [Chlorobium phaeobacteroides DSM 266]
 gi|158512603|sp|A1BHD6|HEM3_CHLPD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|119354942|gb|ABL65813.1| porphobilinogen deaminase [Chlorobium phaeobacteroides DSM 266]
          Length = 313

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 117/280 (41%), Positives = 168/280 (60%), Gaps = 4/280 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L      P  +I +  + T GD + +  L++IG  G
Sbjct: 2   KKQLIIGTRSSPLALWQAEFTKAEL--SRHYPELDITLKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK LI+ EID AVHS KD+PT   +GL I+++  RED RDV IS + ++L +L 
Sbjct: 60  LFTKDIEKHLIAKEIDLAVHSLKDVPTSTPEGLIITSFTEREDTRDVIISRSGETLLNLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            ++ I TSSLRR + LL  R D  + D RG + TR  K +  +  A++LAYAG+ RLK  
Sbjct: 120 QNARIATSSLRRMSQLLSMRPDFEICDIRGNLNTRFKKFDEGEFDAMMLAYAGVFRLKFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  +   P+ GQGA+ IET V++ + +E+V+++NH +T      ERA L  L G
Sbjct: 180 DRISEILPHDVMLPAVGQGALGIETRVDDEQTREIVRILNHSNTEYCCRAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKI--FHEVSRNG 280
            C+  I  +A  K  TL     V + +GKI   +E+++ G
Sbjct: 240 GCQIPIGAYASFKNGTLKLLAFVGSVNGKIGLRNEITKTG 279


>gi|218550973|ref|YP_002384764.1| porphobilinogen deaminase [Escherichia fergusonii ATCC 35469]
 gi|226740637|sp|B7LU53|HEM3_ESCF3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|218358514|emb|CAQ91161.1| hydroxymethylbilane synthase [Escherichia fergusonii ATCC 35469]
          Length = 313

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 166/291 (57%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDALMAKH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL +L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNKYASLDELPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           ++ L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RDALPPEVSLPAVGQGAVGIECRLDDTRTRELLAALNHPETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A   G  ++   +V A DG       R G+  DA  +G   A+ +
Sbjct: 244 VPIGSYAELIGGEIWLRALVGAPDGSQMIRGERRGSPQDAEKMGISLAEEL 294


>gi|160872858|ref|ZP_02062990.1| porphobilinogen deaminase [Rickettsiella grylli]
 gi|159121657|gb|EDP46995.1| porphobilinogen deaminase [Rickettsiella grylli]
          Length = 311

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/308 (40%), Positives = 173/308 (56%), Gaps = 5/308 (1%)

Query: 1   MEKKPF-RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M KK F RI TR SPLA   A   ++ L  +   P   I ++P  T+GDR ++ +L + G
Sbjct: 1   MSKKKFLRIATRKSPLAYWQATSIKNQLEKI--FPFLKITLLPFVTEGDRPSH-SLNQWG 57

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L+ G+ D AVHS KD+P  L KGL + A   R D RDV IS + +   
Sbjct: 58  GKGLFVKELEAALLHGQADIAVHSLKDLPMTLEKGLVLGAICKRCDPRDVLISRSDRLFT 117

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   S +GTSSLRR++ LL  R D+ +   RG I TRLNKL   +  AI+LA AG+ RL
Sbjct: 118 QLPPGSYVGTSSLRRQSQLLALRPDLKIGVLRGNIGTRLNKLAAGEFDAIILAAAGLIRL 177

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           KK + I E   I+ F P+PGQGA+ IE H N+ ++   +  + H  T   V  ERA   E
Sbjct: 178 KKTECISEYFEIDHFLPAPGQGALGIECHENDEESLTYISALIHPITHSCVLAERALSRE 237

Query: 240 LDGSCKSAIAGFAYCKGST-LYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRF 298
           L G C+  +A +A   G   +     V +SDG    +V + G R +A  IG  AAQ +R 
Sbjct: 238 LGGGCQVPLAAYAASLGQDFIRLQAFVGSSDGTTQIKVEKQGPRVEAEKIGFLAAQDLRA 297

Query: 299 ISNKNVFN 306
           +  + + N
Sbjct: 298 LGVEEILN 305


>gi|324111028|gb|EGC05015.1| porphobilinogen deaminase [Escherichia fergusonii B253]
 gi|325499227|gb|EGC97086.1| porphobilinogen deaminase [Escherichia fergusonii ECD227]
          Length = 313

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 166/291 (57%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDALMAKH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL +L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNKYASLDELPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           ++ L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RDALPPEVSLPAVGQGAVGIECRLDDTRTRELLAALNHPETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A   G  ++   +V A DG       R G+  DA  +G   A+ +
Sbjct: 244 VPIGSYAELIGGEIWLRALVGAPDGSQMIRGERRGSPQDAEKMGISLAEEL 294


>gi|2495175|sp|Q59684|HEM3_PROMI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|726359|gb|AAC44329.1| porphobilinogen deaminase [Proteus mirabilis]
          Length = 313

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/271 (41%), Positives = 156/271 (57%), Gaps = 2/271 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K   RI TR SPLA+  A   +  L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MPKSTIRIATRQSPLAMWQALYVKEQLQIAH--PSLVVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+S   D AVHS KD+P    +GL +     RED RD F+S+   SL+ 
Sbjct: 59  KGLFVKELELALLSSRADIAVHSMKDVPIDFPEGLGLVTICEREDPRDAFVSNHYDSLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL+KL+N    AI+LA AG+KRLK
Sbjct: 119 LPAGSVVGTSSLRRQCQLKALRPDLIIRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ IE  +++   Q L+  +NH DT   V  ERA    L
Sbjct: 179 LTERIRSSLSAEQSLPAVGQGAVGIECRLDDHDTQALLAALNHADTATCVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGK 271
           +G C+  I  +A  +   ++   +V A DGK
Sbjct: 239 EGGCQVPIGSYAIWQNDKIWLRALVGAPDGK 269


>gi|189346422|ref|YP_001942951.1| porphobilinogen deaminase [Chlorobium limicola DSM 245]
 gi|238058917|sp|B3EIN1|HEM3_CHLL2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189340569|gb|ACD89972.1| porphobilinogen deaminase [Chlorobium limicola DSM 245]
          Length = 313

 Score =  203 bits (517), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 164/280 (58%), Gaps = 4/280 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L      P  +I +  + T GD + +  L++IG  G
Sbjct: 2   KKQLIIGTRSSPLALWQAEFTKAELS--RHFPELDITLKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK LI+ EID AVHS KD+PT   +GL I+++  RED RDV IS     L DL 
Sbjct: 60  LFTKDIEKHLIAKEIDLAVHSLKDVPTSTPEGLIITSFTEREDTRDVIISKGGAKLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
           L++ + TSSLRR + L   R D  + D RG + TR  K +  +  A++LAYAG+ RL   
Sbjct: 120 LNAKVATSSLRRMSQLKSLRPDFEICDIRGNLNTRFKKFDEGEFDAMMLAYAGVFRLNFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  E   P+ GQGA+ IET V++ + +E+V+++NH +T      ERA L  L G
Sbjct: 180 DRISEILPHEIMLPAVGQGALGIETRVDDEQTREIVRILNHSNTEYCCKAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSRNG 280
            C+  I  +A  K  TL     V + DG   I +E++R+G
Sbjct: 240 GCQIPIGAYASFKNGTLKLLAFVGSVDGTVGINNEITRSG 279


>gi|116750623|ref|YP_847310.1| porphobilinogen deaminase [Syntrophobacter fumaroxidans MPOB]
 gi|158512355|sp|A0LN73|HEM3_SYNFM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|116699687|gb|ABK18875.1| hydroxymethylbilane synthase [Syntrophobacter fumaroxidans MPOB]
          Length = 309

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 169/296 (57%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RIGTR S LAL  +   ++++  +   P   + +  + T GD+I +  L ++GG
Sbjct: 1   MTDRVIRIGTRGSMLALKQSGNVKAAMEALW--PGLRVELQVVRTTGDKILDVPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE  L++  +D AVHS KD+P  L +GL+I A   RED RDV ++ T + + D
Sbjct: 59  KGLFVKEIEDALLARTVDLAVHSMKDVPAILPEGLEIGAIPKREDPRDVIVTRTGKGIAD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L +   +GTSSLRR + + + R DI + + RG IETRL KL      AI+LA AG+ R+ 
Sbjct: 119 LPMGGRVGTSSLRRASQIRKLRPDIEIANLRGNIETRLRKLTEGAFDAIILAAAGLHRMG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  +   L+  DF P+ GQGAI IE   ++ + +EL+  ++  DT  +V  ER+ L  L
Sbjct: 179 WQNRVTSYLDPADFLPAIGQGAIGIELRCDDGEVRELLAPLHDPDTHVAVEAERSLLRTL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  I G A+    TL   G+V + DG+     SR G+   A  IGRD    +
Sbjct: 239 EGGCQVPIGGHAHLVDGTLTLSGMVASIDGEELFRASRAGSPAQARKIGRDVGMEL 294


>gi|325922553|ref|ZP_08184310.1| hydroxymethylbilane synthase [Xanthomonas gardneri ATCC 19865]
 gi|325546966|gb|EGD18063.1| hydroxymethylbilane synthase [Xanthomonas gardneri ATCC 19865]
          Length = 304

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 172/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVATALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L     + A + R D  D  +S+   +++ L L +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDAPFVLPAIMERGDAADALVSNLYATVQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  +  I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGFDARI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L++ ++ P+P QGA+ +E   ++     L+ V++   T   V  ERA    L GSC 
Sbjct: 182 TARLDVPEWLPAPAQGAVAVECRGDDAHIHGLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A FA  +G  L+  G+V  ASDG++ H    +G+  D  ++GR  AQ +
Sbjct: 242 VPVAAFARWEGDGLFLQGMVGSASDGRLIH-AEAHGSAEDTESLGRLVAQGL 292


>gi|307293495|ref|ZP_07573339.1| porphobilinogen deaminase [Sphingobium chlorophenolicum L-1]
 gi|306879646|gb|EFN10863.1| porphobilinogen deaminase [Sphingobium chlorophenolicum L-1]
          Length = 308

 Score =  203 bits (516), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 155/268 (57%), Gaps = 3/268 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P R+GTR SPLALA A  T ++L   H      + I+ + T GDRI +R L EIGGK L
Sbjct: 6   RPLRLGTRGSPLALAQAHMTIAALRARHGWDEGAVEIVVVQTSGDRIQDRALAEIGGKAL 65

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           +T+E+++ L+ GEID AVHS KD+ T     ++I+A LPR D+RD  +   A S   L  
Sbjct: 66  WTKELDRALLEGEIDFAVHSMKDVETIRPAEIRIAAMLPRADVRDRLVG--AASFDALPE 123

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
             V+GTSS RR A + R R D  V+ FRG + TRL KL   +AHA LLA AG+ RL +  
Sbjct: 124 KPVVGTSSPRRAAQVKRLRPDAGVVLFRGNVATRLAKLEKGEAHATLLAAAGLDRLGQSD 183

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           V   I   E   P+P QGA+ IET   N    +L+  IN  DT+D V  ERA L  L G+
Sbjct: 184 VGVAI-PAEVMLPAPSQGAVGIETLSGNGAMLDLLATINDADTFDCVMAERAVLVGLGGT 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGK 271
           C S IA     +   +Y    +++ DG+
Sbjct: 243 CHSPIAALGRLEEGRIYLRAEIISPDGQ 270


>gi|261250035|ref|ZP_05942612.1| porphobilinogen deaminase [Vibrio orientalis CIP 102891]
 gi|260939539|gb|EEX95524.1| porphobilinogen deaminase [Vibrio orientalis CIP 102891]
          Length = 312

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 172/305 (56%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QSTPIRIATRKSPLALWQAHFVKDALKAAH--PGLEVELVTMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYHNIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +++GT SLRR+  L  +R D+ + + RG + TRL KL++ +  AI+LA AG+KRL+ 
Sbjct: 121 PQGAIVGTCSLRRQCQLKEYRPDLVIKELRGNVGTRLGKLDDGQYDAIILAAAGLKRLEL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ IK  +  E   P+ GQGA+ IE  +++ +  +L++ +NH++T D V CERA    L+
Sbjct: 181 EERIKSFIEPEQSLPAVGQGAVGIECRLDDERLIKLLEPLNHKETADRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  ++   G  ++   +V   DG         G+R DA  +G + A  +     
Sbjct: 241 GGCQVPIGSYSLIDGDNIWLRALVGEPDGSKIIRGEIRGSRADAETLGVELANQLLDDGA 300

Query: 302 KNVFN 306
           K +  
Sbjct: 301 KEILT 305


>gi|119776386|ref|YP_929126.1| porphobilinogen deaminase [Shewanella amazonensis SB2B]
 gi|119768886|gb|ABM01457.1| Hydroxymethylbilane synthase [Shewanella amazonensis SB2B]
          Length = 326

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 115/306 (37%), Positives = 172/306 (56%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 17  MSQNLIRIATRKSPLAMWQAEFVKAELERIH--PDLTVELLPMSTKGDVILDTPLAKVGG 74

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T +S+ +
Sbjct: 75  KGLFVKELEVAMLEGRADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNTYKSIDE 134

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL++ +  AI+LA AG+ RLK
Sbjct: 135 LPQGAVVGTSSLRRQCQLRARRPDLIIKDLRGNVGTRLAKLDSGEYDAIILAAAGLIRLK 194

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE   N+ + + L+  + H++T   V  ERA    L
Sbjct: 195 LAERIAGFISTEESLPANGQGAVGIECRTNDERVKALLAPLEHKETRLRVLAERAMNTRL 254

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA  +  TL   G+V   DG      S  G+  DAI +G   A  +    
Sbjct: 255 EGGCQVPIGAFAEIEADTLTLRGLVGNPDGSEVITGSVTGSTADAIALGHQLADDLLSRG 314

Query: 301 NKNVFN 306
            K + +
Sbjct: 315 AKTILD 320


>gi|189499889|ref|YP_001959359.1| porphobilinogen deaminase [Chlorobium phaeobacteroides BS1]
 gi|238058915|sp|B3EPK0|HEM3_CHLPB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189495330|gb|ACE03878.1| porphobilinogen deaminase [Chlorobium phaeobacteroides BS1]
          Length = 313

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 121/278 (43%), Positives = 163/278 (58%), Gaps = 4/278 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L      P   I +  + T GD + +  L++IG  G
Sbjct: 2   KKKLIIGTRSSPLALWQADFTQAEL--SKHFPDLEIELKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK LISGEID AVHS KD+PT+  +GL +SA+  RED RDV IS   +SLK L 
Sbjct: 60  LFTKDIEKHLISGEIDLAVHSLKDVPTETPEGLMLSAFTEREDTRDVIISKNGESLKTLK 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + I TSSLRR + LL  R D  + D RG + TR  K + +   A++LAYAG+ RL   
Sbjct: 120 QDAKIATSSLRRTSQLLSMRPDFQMGDIRGNLNTRFKKFDESDFDAMMLAYAGVHRLNFG 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  E   P+ GQGA+ IET V++   +E+V V+N+ +T      ERA L  L G
Sbjct: 180 DRISEILPHEVMLPAVGQGALGIETRVDDEATKEIVSVMNNVNTEFCTKAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSR 278
            C+  I  +A  K   L+    V + DGK  I +E+++
Sbjct: 240 GCQIPIGSYASLKNGNLHLLAYVGSVDGKRTIRNEITK 277


>gi|325291200|ref|YP_004267381.1| hydroxymethylbilane synthase [Syntrophobotulus glycolicus DSM 8271]
 gi|324966601|gb|ADY57380.1| hydroxymethylbilane synthase [Syntrophobotulus glycolicus DSM 8271]
          Length = 305

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 121/303 (39%), Positives = 175/303 (57%), Gaps = 5/303 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  RIGTR S LA+  A   + SL  ++  P  + V++P  TKGD+I +  L +IG KG 
Sbjct: 2   KTIRIGTRESKLAIWQAEWVKDSLTSIY--PGIDCVLVPKKTKGDKIPDIPLPKIGDKGF 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FTEE+E+ L++GEID AVHS KD+P +L +GL I+AY  R D RDVF       L +L  
Sbjct: 60  FTEELEQALLTGEIDLAVHSLKDLPVELPQGLSIAAYGERHDPRDVFFGKEGLPLAELPA 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHA-ILLAYAGIKRLKKE 182
            S+IGTSSLRR+  L   R+D++  D RG ++TR +KL N++  A I+LA AG  RL  +
Sbjct: 120 GSMIGTSSLRRQCQLKYQRADLNFCDLRGNLDTRWDKLQNSRDMAGIVLAAAGALRLGWQ 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I E L  +   P+ GQG I IET  +  + +++++ +NH  +  +   ER+FL  L G
Sbjct: 180 DRITEFLAEDVVLPAVGQGIIAIETASHRTEIRQILQPLNHRPSELAGRAERSFLRSLGG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C++ IA  A  +   +   G+V   DGK   +V+  G   D    G DAA  I+ +   
Sbjct: 240 GCQTPIAALAKVQEDRIQVTGMVAGMDGKNILKVTAEG--FDPEQTGADAAAQIKCLGAN 297

Query: 303 NVF 305
           N+ 
Sbjct: 298 NLL 300


>gi|118581775|ref|YP_903025.1| porphobilinogen deaminase [Pelobacter propionicus DSM 2379]
 gi|158512569|sp|A1AUE7|HEM3_PELPD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|118504485|gb|ABL00968.1| porphobilinogen deaminase [Pelobacter propionicus DSM 2379]
          Length = 310

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/286 (39%), Positives = 164/286 (57%), Gaps = 5/286 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RIGTR S LAL  A   +S L    + P   + +  + T GDRI +  L ++GG
Sbjct: 1   MPPRQLRIGTRASQLALWQANWVKSELE--KRYPAMEVTLTKIKTMGDRILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  +S  A+    
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVVSRAAR-FSH 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTS+LRR+A LL  R D+ ++  RG +ETR+ KL+     A++LA AG+KRL 
Sbjct: 118 LPPGARVGTSALRRQAQLLHARPDLEMVTIRGNVETRIRKLDEENLDAVILAAAGLKRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + + E L++E   P+ GQGA+ IE  +++P   E +   NH DT  +V  ERA L   
Sbjct: 178 LTQRVAEYLDVEFSIPAIGQGALGIECRLSDPVVTEAIAFFNHPDTSHAVRAERALLRRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIF--HEVSRNGNRCD 284
            G C+  IA     +G  L   G++ A DG+ F   E+S   ++C+
Sbjct: 238 QGGCQVPIAAHGTIRGGELRLVGLIAAVDGREFVRDEISGPVDQCE 283


>gi|77920653|ref|YP_358468.1| porphobilinogen deaminase [Pelobacter carbinolicus DSM 2380]
 gi|123756552|sp|Q3A009|HEM3_PELCD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|77546736|gb|ABA90298.1| hydroxymethylbilane synthase [Pelobacter carbinolicus DSM 2380]
          Length = 315

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 110/270 (40%), Positives = 158/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RIGTR S LAL  A   +  L  +H  P  ++V++P++TKGD+I +  L ++GG
Sbjct: 1   MSSSALRIGTRASRLALWQAEWVQQQLETLH--PGLSVVLVPITTKGDKILDVPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ L  G ID AVHS KD+P+ L  GL +    PRED RD  ++   +S   
Sbjct: 59  KGLFVKEIEEALYDGSIDLAVHSMKDVPSVLPPGLILPCIPPREDPRDALVTPDGRSFAQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL  R D+ ++  RG +ETRL K+       I+LA AG+KRL+
Sbjct: 119 LPQGARIGTSALRRQAQLLHRRPDLDIVSLRGNVETRLRKMEEEDMDGIVLAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I E L+++   P+ GQGA+ +E    + +  EL+  ++  DT  +V  ERAFL  L
Sbjct: 179 LAERIAEYLSVDVSLPAIGQGALGLECREGDDRTLELIAPLHDADTAVAVRAERAFLRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           +G C+  +A  A     TL   G+V   DG
Sbjct: 239 NGGCQVPLAAHATVAEQTLTMVGLVAEVDG 268


>gi|317494824|ref|ZP_07953235.1| porphobilinogen deaminase [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917149|gb|EFV38497.1| porphobilinogen deaminase [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 323

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A+  R  L      P   + ++P+ T+GD + +  L ++GGKGLF 
Sbjct: 16  LRIATRQSPLALWQAYYVRDHLQ--AHWPDLTVELVPMVTRGDVLLDTPLAKVGGKGLFV 73

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L+DL   S
Sbjct: 74  KELELALLDGRADIAVHSMKDVPVAFPEGLGLVTICEREDPRDAFVSPKYARLEDLPEGS 133

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ V D RG + TRL KL+N    AI+LA AG+KRL+ E+ I
Sbjct: 134 IVGTSSLRRQCQLREIRPDLIVRDLRGNVGTRLAKLDNGDYDAIILAAAGLKRLELEERI 193

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +N+ + Q L+  +N  DT   V+ ERA    L+G C+
Sbjct: 194 RYALPPEQSLPAVGQGAVGIECRLNDTRTQALLAPLNDIDTATRVSAERAMNTRLEGGCQ 253

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  ++   G  ++   +V   DG +     R G R  A  +G   A+ +
Sbjct: 254 VPIGSYSELNGDEIWLRALVGKPDGTLIIRGERRGPRAKAAELGVSLAEEL 304


>gi|227357162|ref|ZP_03841531.1| porphobilinogen deaminase (hydroxymethylbilane synthase) [Proteus
           mirabilis ATCC 29906]
 gi|227162694|gb|EEI47661.1| porphobilinogen deaminase (hydroxymethylbilane synthase) [Proteus
           mirabilis ATCC 29906]
          Length = 313

 Score =  202 bits (514), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 111/273 (40%), Positives = 156/273 (57%), Gaps = 2/273 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K   RI TR SPLA+  A   +  L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MPKSTIRIATRQSPLAMWQALYVKEQLQIAH--PSLVVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+S   D AVHS KD+P    +GL +     RED RD F+S+   SL+ 
Sbjct: 59  KGLFVKELELALLSSRADIAVHSMKDVPIDFPEGLGLVTICEREDPRDAFVSNHYDSLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL+KL+N    AI+LA AG+KRLK
Sbjct: 119 LPAGSVVGTSSLRRQCQLKALRPDLIIRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ IE  +++   Q L+  +NH DT   V  ERA    L
Sbjct: 179 LTERIRSSLSAEQSLPAVGQGAVGIECRLDDHDTQALLAALNHADTATCVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIF 273
           +G C+  I  +A  +   ++   +V + DGK  
Sbjct: 239 EGGCQVPIGSYAIWQNDKIWLRALVGSPDGKTI 271


>gi|149191476|ref|ZP_01869725.1| porphobilinogen deaminase [Vibrio shilonii AK1]
 gi|148834664|gb|EDL51652.1| porphobilinogen deaminase [Vibrio shilonii AK1]
          Length = 329

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 109/295 (36%), Positives = 168/295 (56%), Gaps = 2/295 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           + +P RI TR SPLAL  A   + +L+  H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 20  QTQPIRIATRKSPLALWQAHYVKDALIAAH--PGLEVELVTMVTKGDIILDTPLAKVGGK 77

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  ++ +L
Sbjct: 78  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYTNISEL 137

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L   R D+ + + RG + TRL KL+N +  AI+LA AG+KRL+ 
Sbjct: 138 PQGAVVGTCSLRRQCQLKEQRPDLVIKELRGNVGTRLGKLDNGEYDAIILAAAGLKRLEL 197

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  I+  +  E+  P+ GQGA+ IE  +++ +  +L++ +NH +T D V CERA    L+
Sbjct: 198 ESRIRSFIEPEESLPAVGQGAVGIECRLDDERLIKLLEPLNHTNTADRVLCERAMNLTLE 257

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           G C+  I  ++   G  ++   +V   DG         G R DA  +G   A  +
Sbjct: 258 GGCQVPIGSYSLIDGDEIWLRALVGEPDGSKIVRGEIRGKRADAEALGVQLANQL 312


>gi|294010302|ref|YP_003543762.1| hydroxymethylbilane synthase [Sphingobium japonicum UT26S]
 gi|292673632|dbj|BAI95150.1| hydroxymethylbilane synthase [Sphingobium japonicum UT26S]
          Length = 308

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 170/295 (57%), Gaps = 8/295 (2%)

Query: 1   MEK--KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEI 58
           M+K  +P R+GTR SPLALA A  T ++L   H      + I+ + T GDRI +R L +I
Sbjct: 1   MQKPSRPLRLGTRGSPLALAQAHMTVAALRARHGWDEGAVEIVVVQTSGDRIQDRALADI 60

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGK L+T+E+++ L SGEID AVHS KD+ T     ++I+A LPR D+RD  +   A   
Sbjct: 61  GGKALWTKELDRALASGEIDFAVHSMKDVETIRPAEIRIAAMLPRADVRDRLVG--ADDF 118

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L    V+GTSS RR A + R R D  V+ FRG + TRL +L+  +AHA LLA AG+ R
Sbjct: 119 AALPERPVVGTSSPRRAAQVRRLRPDAQVVLFRGNVATRLARLDRGEAHATLLAAAGLDR 178

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L +  V   I  ++   P+P QGA+ IET   +    +L+  I+  DT+D V  ERA LA
Sbjct: 179 LGQGDVGVAI-PVDVMLPAPSQGAVGIETLSGDEAMLDLLAAISDADTFDCVMAERAVLA 237

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGK-IFHEVSR--NGNRCDAINIGR 290
            L G+C S IA FA  +   +     +++ DG+    E +R   G+   A  +GR
Sbjct: 238 GLGGTCHSPIAAFARLEDGQVRLRAEIISPDGRETVGETARIERGDAAAAEAMGR 292


>gi|56964395|ref|YP_176126.1| porphobilinogen deaminase [Bacillus clausii KSM-K16]
 gi|61213279|sp|Q5WEP5|HEM3_BACSK RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|56910638|dbj|BAD65165.1| porphobilinogen deaminase [Bacillus clausii KSM-K16]
          Length = 311

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 117/282 (41%), Positives = 168/282 (59%), Gaps = 4/282 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           IGTR S LAL         L  +    P+   +  + TKGDRI + TL+++GGKGLF +E
Sbjct: 6   IGTRRSKLALTQTNWVIDQLKQLG--VPYEFEVKEIVTKGDRILDVTLSKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE  L SGEID AVHS KD+P++LL+   ++A   RED RDV +S    +L +L   +++
Sbjct: 64  IEAALRSGEIDVAVHSMKDVPSELLEEFTLAAITEREDPRDVLVSENGHTLDELPAGAIV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVIK 186
           GTSSLRR A +L  R D+ V   RG +ETRL KL      AI+LA AG+KRL   E VI 
Sbjct: 124 GTSSLRRSAQILHRRPDVQVKWIRGNVETRLRKLKEEDFSAIVLAAAGLKRLGYGEDVIT 183

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E L+ +   P+ GQGA+ +E  V++ +  EL+  ++HE+T  +V  ERAFL E++G C+ 
Sbjct: 184 EYLDKDVCLPAIGQGALGLECRVDDVETTELLAKLHHEETGKAVLAERAFLKEMNGGCQV 243

Query: 247 AIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAIN 287
            I G+A   +   ++  G+V + DGK   +  + G   D + 
Sbjct: 244 PIGGYATVLEDGAVFLTGLVGSPDGKTILKEGKCGMVADELG 285


>gi|271502386|ref|YP_003335412.1| porphobilinogen deaminase [Dickeya dadantii Ech586]
 gi|270345941|gb|ACZ78706.1| porphobilinogen deaminase [Dickeya dadantii Ech586]
          Length = 312

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 161/284 (56%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD + +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHFVQQRLEACH--PGLRVELVPMVTRGDVLLDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     R+D RD F+S+   +L DL   +
Sbjct: 64  KELELALLENRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNNYATLDDLPEGA 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L   R D+ V D RG + TRL+KL+N    AI+LA AG+KRL  E  I
Sbjct: 124 CVGTSSLRRQCQLRAHRPDLVVRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLGLENRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E   P+ GQGA+ +E  +++ + + L+  +NH+DT   V  ERA    L+G C+
Sbjct: 184 RTALSPEQSLPAVGQGAVGVECRLDDARTRALLAPLNHDDTATRVLAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  +  TLY   +V A DG       R G R DA  +G
Sbjct: 244 VPIGSYAELQDDTLYLRALVGAPDGSRIIYAERRGPRQDAEALG 287


>gi|58583630|ref|YP_202646.1| porphobilinogen deaminase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|75433978|sp|Q5GVL2|HEM3_XANOR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|58428224|gb|AAW77261.1| porphobilinogen deaminase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 304

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 171/292 (58%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +    ++L   H  P   +V++P+ST+GD + +R+L  IG KGLF 
Sbjct: 4   LRIATRKSPLALWQSEHVAAALRQHH--PGLEVVLVPMSTRGDEVLDRSLAAIGDKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ G+ DCAVHS KD+P +L     + A L R D  D  +S+   SL+ L L +
Sbjct: 62  KELELAMLRGDADCAVHSFKDVPMELDDPFVLPAILERGDPADALVSNLYASLQALPLGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ +ID RG + TRL KL+N    AI+LA AG++RL  ++ I
Sbjct: 122 RVGTSSLRRQAQLRAARPDLELIDLRGNVNTRLAKLDNGGYDAIVLACAGLQRLGLDERI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+  ++ P+P QGA+ +E   ++ +   L+ V++   T   V  ERA    L GSC 
Sbjct: 182 SARLDAPEWLPAPAQGAVAVECRGDDARIHSLLAVLDAGRTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             +A  A  +G  L+  G+V  ASDG++ H    +G+  D  ++GR  AQ +
Sbjct: 242 VPVAALARWEGEGLFLQGMVGSASDGRLIH-ADAHGSADDTQDLGRRVAQGL 292


>gi|51594540|ref|YP_068731.1| porphobilinogen deaminase [Yersinia pseudotuberculosis IP 32953]
 gi|186893538|ref|YP_001870650.1| porphobilinogen deaminase [Yersinia pseudotuberculosis PB1/+]
 gi|61213379|sp|Q66G00|HEM3_YERPS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238059007|sp|B2K065|HEM3_YERPB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|51587822|emb|CAH19424.1| porphobilinogen deaminase [Yersinia pseudotuberculosis IP 32953]
 gi|186696564|gb|ACC87193.1| porphobilinogen deaminase [Yersinia pseudotuberculosis PB1/+]
          Length = 313

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 117/289 (40%), Positives = 161/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL + A   RED RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVAICEREDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LETRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMG 287


>gi|312963804|ref|ZP_07778275.1| Porphobilinogen deaminase [Pseudomonas fluorescens WH6]
 gi|311281839|gb|EFQ60449.1| Porphobilinogen deaminase [Pseudomonas fluorescens WH6]
          Length = 313

 Score =  201 bits (512), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 167/296 (56%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLELAH--PGLKVSLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLENEADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTYTSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPPGSIVGTSSLRRQAQLLTRRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +++ED  P+ GQGA+ IE    + +   L+K ++H DT   V  ERA    L
Sbjct: 179 FEDRITSAISVEDSLPAGGQGAVGIECRTADSEIHALLKPLDHHDTEVRVTAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V   DG         G + DA  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDNIWLRGLVGDPDGGTLLTAQARGPQADATALGIQVAEEL 294


>gi|170769870|ref|ZP_02904323.1| porphobilinogen deaminase [Escherichia albertii TW07627]
 gi|170121308|gb|EDS90239.1| porphobilinogen deaminase [Escherichia albertii TW07627]
          Length = 313

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 163/291 (56%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMTSH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +N+ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RTALPPEVSLPAVGQGAVGIECRLNDTRTRELLAALNHNETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G+  DA  +G   A+ +
Sbjct: 244 VPIGSYAELVDGEIWLRALVGAPDGSQIIRGERRGSPQDAEQMGISLAEEL 294


>gi|149908497|ref|ZP_01897159.1| porphobilinogen deaminase [Moritella sp. PE36]
 gi|149808331|gb|EDM68268.1| porphobilinogen deaminase [Moritella sp. PE36]
          Length = 312

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR SPLA+  A   ++ L  +H+     + +IP+ TKGD I +  L ++GG
Sbjct: 1   MATETLRIATRKSPLAMWQAEYVKARLEAIHQ--NLTVELIPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P +  +GL +     RED RD F+S+T + +++
Sbjct: 59  KGLFVKELEVAILENRADIAVHSMKDVPVEFPEGLDLEVICEREDPRDAFVSNTYRQIEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GT SLRR+  L   R D+ ++D RG + TRLNKL+N    AI+LA AG+KRL 
Sbjct: 119 LPPGAIVGTCSLRRQCQLSEARPDLKIMDLRGNVNTRLNKLDNKDYDAIILAAAGLKRLD 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +  E   P+ GQGA+ IE  +++ + + L+  +NH  T D V  ERA    L
Sbjct: 179 MEYRIASYIEPEQSLPAVGQGAVGIECRIDDERVKALLAPLNHALTSDRVLAERAMNLAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G  L+  G+V   DG         G+R +A  +G + A  +    
Sbjct: 239 EGGCQVPIGSYAIIDGDELWLRGLVGKPDGTEVIRAEIRGDRKNARQLGLELADKLLAQG 298

Query: 301 NKNVF 305
            K + 
Sbjct: 299 AKEIL 303


>gi|307132975|ref|YP_003884991.1| hydroxymethylbilane synthase [Dickeya dadantii 3937]
 gi|306530504|gb|ADN00435.1| hydroxymethylbilane synthase [Dickeya dadantii 3937]
          Length = 313

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 113/285 (39%), Positives = 164/285 (57%), Gaps = 3/285 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD + +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHFVQQRLKACH--PGLRVELVPMVTRGDVLLDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     R+D RD F+S+   SL DL + +
Sbjct: 64  KELELALLENRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNHYDSLDDLPVGA 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L   R D++V D RG + TRL+KL+N    AI+LA AG+KRL  E  I
Sbjct: 124 CVGTSSLRRQCQLRAHRPDLTVRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLGLEDRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E   P+ GQGA+ +E  +++ + + L+  +NH+DT   V  ERA    L+G C+
Sbjct: 184 RTALSPEQSLPAVGQGAVGVECRLDDARTRALLAPLNHDDTATRVLAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCK-GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  + G TL+   +V A DG       R G R DA  +G
Sbjct: 244 VPIGSYAELQDGDTLWLRALVGAPDGSRIIYAERRGLRQDAEQLG 288


>gi|197287145|ref|YP_002153017.1| porphobilinogen deaminase [Proteus mirabilis HI4320]
 gi|238058999|sp|B4F1X3|HEM3_PROMH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|194684632|emb|CAR46538.1| porphobilinogen deaminase [Proteus mirabilis HI4320]
          Length = 313

 Score =  201 bits (512), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 156/273 (57%), Gaps = 2/273 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K   RI TR SPLA+  A   +  L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MSKSTIRIATRQSPLAMWQALYVKEQLQIAH--PSLVVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+S   D AVHS KD+P    +GL +     RED RD F+S+   SL+ 
Sbjct: 59  KGLFVKELELALLSSRADIAVHSMKDVPIDFPEGLGLVTICEREDPRDAFVSNHYDSLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL+KL+N    AI+LA AG+KRLK
Sbjct: 119 LPAGSVVGTSSLRRQCQLKALRPDLIIRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ IE  +++   Q L+  +NH DT   V  ERA    L
Sbjct: 179 LTERIRSSLSAEQSLPAVGQGAVGIECRLDDHDTQALLAALNHADTATCVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIF 273
           +G C+  I  +A  +   ++   +V + DG+  
Sbjct: 239 EGGCQVPIGSYAIWQNGKIWLRALVGSPDGETI 271


>gi|162419364|ref|YP_001605129.1| porphobilinogen deaminase [Yersinia pestis Angola]
 gi|238059008|sp|A9R8K0|HEM3_YERPG RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|162352179|gb|ABX86127.1| porphobilinogen deaminase [Yersinia pestis Angola]
          Length = 313

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/305 (38%), Positives = 166/305 (54%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LENRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G + A  +  + 
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMGIELADELLSLG 298

Query: 301 NKNVF 305
            + + 
Sbjct: 299 AREIL 303


>gi|157368427|ref|YP_001476416.1| porphobilinogen deaminase [Serratia proteamaculans 568]
 gi|167008819|sp|A8G848|HEM3_SERP5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|157320191|gb|ABV39288.1| porphobilinogen deaminase [Serratia proteamaculans 568]
          Length = 313

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 164/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQQRLMANH--PGLQVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P     GL +     R+D RD F+S+   SL  
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPVDFPAGLGLVTICERDDPRDAFVSNRFTSLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ V D RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 119 LPQGSVVGTSSLRRQCQLRERRPDLIVRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L+ E+  P+ GQGA+ IE  +++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LEQRIRSPLSPEECLPAVGQGAVGIECRLDDETTRALLAPLNHAVTETRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  I  +A   G +L+   +V + DG       R G    A  +G + A+ +
Sbjct: 239 EGGCQVPIGSYAELDGDSLWLRALVGSPDGSQMVRGERRGPAALAEQMGIELAEEL 294


>gi|195953610|ref|YP_002121900.1| porphobilinogen deaminase [Hydrogenobaculum sp. Y04AAS1]
 gi|195933222|gb|ACG57922.1| porphobilinogen deaminase [Hydrogenobaculum sp. Y04AAS1]
          Length = 285

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 171/289 (59%), Gaps = 9/289 (3%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            R+GTR S LAL  A   +S L  +       I ++ ++T GD+I +  L++IGGKGLF 
Sbjct: 3   LRLGTRKSKLALWQANFVKSKLEALG----LEIELVLITTTGDKILDTPLSKIGGKGLFV 58

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L+  EID AVHS KD+P  + +GL +  +L RED +D F+S + ++L +L  ++
Sbjct: 59  KEIENALMEDEIDFAVHSLKDVPAFIPQGLVVDVFLEREDPKDAFVSKSYKTLNELPPNA 118

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTSS+RRK  LL+ R D+++ D RG ++TRL KL +    AI+LA AG+KRL  E VI
Sbjct: 119 KIGTSSIRRKVQLLQRRKDLTIEDLRGNVDTRLKKLEDGLYDAIILASAGLKRLGFEGVI 178

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L   DF P+ GQG + IE   +N +   ++K INHE T+     ER+FL  ++GSC+
Sbjct: 179 SSYL---DFIPAVGQGIVAIEYKASNKELSNILKQINHEPTYICALAERSFLETVEGSCQ 235

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
             +   A      +   G +   DG  + E++  G   D I +G+D A+
Sbjct: 236 IPMGAHATLAQDLIKIRGFIANEDGTNYRELTLEGK--DPIGLGKDLAK 282


>gi|145220050|ref|YP_001130759.1| porphobilinogen deaminase [Prosthecochloris vibrioformis DSM 265]
 gi|189028096|sp|A4SFJ8|HEM3_PROVI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|145206214|gb|ABP37257.1| porphobilinogen deaminase [Chlorobium phaeovibrioides DSM 265]
          Length = 313

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 118/280 (42%), Positives = 163/280 (58%), Gaps = 4/280 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L      P  +I +  + T GD + +  L++IG  G
Sbjct: 2   KKQLIIGTRSSPLALWQAEYTKAEL--SRHFPDLDITLKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK LI+ EID AVHS KD+PT   +GL ISA+  RED RDV IS     + DL 
Sbjct: 60  LFTKDIEKFLIAKEIDLAVHSLKDVPTATPEGLIISAFTEREDTRDVIISKNGVKMLDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            ++ + TSSLRR + L   R D  + D RG + TR  K +  +  A++LAYAG+ RL   
Sbjct: 120 KNAKVATSSLRRMSQLKSLRPDFDIKDIRGNLNTRFQKFDEGEFDAMMLAYAGVYRLNFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  E   P+ GQGA+ IET V++ + +E+VKV+NH +T      ER+ L  L G
Sbjct: 180 DRISEILPHEIMLPAVGQGALGIETRVDDEQTREIVKVMNHSNTEYCCKAERSLLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSRNG 280
            C+  I  +A  K  TL+    V + DG   I +E+++ G
Sbjct: 240 GCQIPIGSYASFKNGTLHLLAFVGSVDGTKGIRNEITKTG 279


>gi|225850000|ref|YP_002730234.1| porphobilinogen deaminase [Persephonella marina EX-H1]
 gi|225645034|gb|ACO03220.1| porphobilinogen deaminase [Persephonella marina EX-H1]
          Length = 308

 Score =  201 bits (510), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 115/301 (38%), Positives = 169/301 (56%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A      L      P   + ++ + TKGD+I +  L ++GGKGLF 
Sbjct: 3   IRIGTRKSKLALWQANYIADQLK--KHFPDLEVELVKIVTKGDKILDVPLAKVGGKGLFV 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ ++  EID AVHS KD+PT   +GL + A   RED RD F+S    S++D+   +
Sbjct: 61  KEIEEAMLRNEIDIAVHSLKDVPTYFPEGLGLVAITEREDPRDAFLSVKYNSIEDMPEGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRRKA ++  R DI + D RG ++TR+ KL   +   I+LAYAG+KRL  E  +
Sbjct: 121 VLGTSSLRRKAQIMMKRKDIRIEDLRGNVDTRIRKLEEGQYDGIILAYAGLKRLGLEGKV 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           ++IL  +   P+  QG + IE  +++ K +E+V V+NH ++      ERAFL  L+G C+
Sbjct: 181 RQILQPDYMIPAVAQGFLGIEARLDDEKTREIVSVLNHRESEIRAKAERAFLKTLEGGCQ 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +AG++      L   G V    G      S  G+  DA ++G   A+ +     K V 
Sbjct: 241 VPLAGYSEIVNGKLKITGFVSDLTGDRVFRDSMEGSLEDAESLGVKLAEKLLSDGAKEVL 300

Query: 306 N 306
            
Sbjct: 301 E 301


>gi|312884198|ref|ZP_07743909.1| porphobilinogen deaminase [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368126|gb|EFP95667.1| porphobilinogen deaminase [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 312

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 164/292 (56%), Gaps = 2/292 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A   + +L+  H  P   + +I + TKGD I +  L ++GGKGLF
Sbjct: 6   PIRIATRKSPLALWQANYVKEALIKAH--PGLQVELITMVTKGDIILDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    KGL +     RED RD F+S+  Q++  L  +
Sbjct: 64  VKELENAMLEGRADLAVHSMKDVPVDFPKGLGLVTICEREDPRDAFVSNHYQNIDALPNN 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +++GT SLRR+  +  +R D+ V + RG + TRLNKL+  +  AI+LA AG+KRL  E  
Sbjct: 124 AIVGTCSLRRQCQIKEYRPDLIVKELRGNVGTRLNKLDAGEYDAIILAAAGLKRLGLESR 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I   L  E   P+ GQGA+ IE  +++ +  +L+  +N  DT D V CERA    L+G C
Sbjct: 184 IASFLEPEQSLPAVGQGAVGIECRLDDQRLIDLLAPLNDRDTNDRVKCERAMNLTLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +  I  ++  +G  ++   +V   DG         G R DA  +G + A  +
Sbjct: 244 QVPIGSYSVLEGEQIWLRALVGEPDGSQMVRGEIRGKRDDAEQLGIELANQL 295


>gi|78484457|ref|YP_390382.1| porphobilinogen deaminase [Thiomicrospira crunogena XCL-2]
 gi|123728099|sp|Q31JG5|HEM3_THICR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78362743|gb|ABB40708.1| hydroxymethylbilane synthase [Thiomicrospira crunogena XCL-2]
          Length = 309

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 171/294 (58%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK  RI TR SPLA+  A   ++ L   H+     + ++P+STKGD+I +  L +IGGKG
Sbjct: 2   KKTLRIATRKSPLAMWQAEFVKAELEKHHE--GLTVELLPMSTKGDKILDVPLAKIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+E+E ++++GE D AVHS KD+P  L +G  + A L R +  D F+S+     ++L 
Sbjct: 60  LFTKELEDRMLAGEADIAVHSMKDVPMVLPEGFALGAILERHEPTDAFVSNDYAHFEELP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRRKA L+  R D+ V D RG + TRL KL+     AI+LA +G+KRL+ +
Sbjct: 120 QGAVLGTSSLRRKAQLMAARPDLVVKDLRGNVGTRLGKLDAGDYDAIVLATSGLKRLELD 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  L+ E   P+  QG + IE    +P+  EL++V+NH DT      ERA    L+G
Sbjct: 180 ERIRHELSPETCLPAVSQGTLGIEYFEKDPEVLELIQVLNHRDTEIRTLAERAMNHRLEG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  I  +A  +   +Y  G+V A DG         G++ D   +G   A+ +
Sbjct: 240 GCQVPIGVYAELEDDQIYLRGLVGALDGSEILRSEARGSQKDPETLGVYVAEQL 293


>gi|227114730|ref|ZP_03828386.1| porphobilinogen deaminase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 313

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 162/284 (57%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   IRIATRQSPLALWQARYVQQCLN--HLYPDLHVELVPMVTRGDIILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL  L   S
Sbjct: 64  KELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNHYDSLDQLPQGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 CVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLEARI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E+  P+ GQGAI IE  +++   + L+  +NH  T   V  ERA    L+G C+
Sbjct: 184 RCALSPEESLPAVGQGAIGIECRLDDEHVRHLLAPLNHPATAARVLAERAMNVRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  +G TL+   +V A DG       R GN  DA  +G
Sbjct: 244 VPIGSYAELEGDTLWLRALVGAPDGSQMIVGERKGNVSDAEQLG 287


>gi|227325802|ref|ZP_03829826.1| porphobilinogen deaminase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 313

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 114/284 (40%), Positives = 164/284 (57%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   IRIATRQSPLALWQARYVQQCLN--HLYPDLHVELVPMVTRGDIILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +   GL ++    R+D RD F+S+   SL+ L   S
Sbjct: 64  KELELALLEGRADIAVHSMKDVPVEFPDGLGLTTICERDDPRDAFVSNHYDSLEQLPEGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL  E+ I
Sbjct: 124 CVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLEERI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E+  P+ GQGAI IE  +++   ++L+  +NH  T   V  ERA    L+G C+
Sbjct: 184 RCALSPEESLPAVGQGAIGIECRLDDEHVRQLLAPLNHPATAARVLAERAMNVRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  +G TL+   +V A DG       R G   DA  +G
Sbjct: 244 VPIGSYAELEGDTLWLRALVGAPDGSQMIVGERKGRVSDAEQLG 287


>gi|49388603|dbj|BAD25718.1| putative porphobilinogen deaminase [Oryza sativa Japonica Group]
 gi|215686353|dbj|BAG87614.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215717107|dbj|BAG95470.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 264

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 157/260 (60%), Gaps = 3/260 (1%)

Query: 50  ITNRTLTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDV 109
           I ++ L +IGGKGLFT+EI+  L+ G ID AVHS KD+PT L +G  +   LPRED+RD 
Sbjct: 2   ILDKPLADIGGKGLFTKEIDDALLQGRIDIAVHSMKDVPTYLPEGTILPCNLPREDVRDA 61

Query: 110 FISHTAQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAI 169
           FI  TA SL +L   SV+G++SLRR++ +L     + V++FRG ++TRL KL     HA 
Sbjct: 62  FICLTASSLAELPAGSVVGSASLRRQSQILYKYPSLKVVNFRGNVQTRLRKLKEGDVHAT 121

Query: 170 LLAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDS 229
           LLA AG+KRL   +    +L++++  P+  QGAI I    ++      +  +NHEDT  +
Sbjct: 122 LLALAGLKRLNMAETATSVLSVDEMLPAVAQGAIGIACRSSDDTMMNYLSSLNHEDTRLA 181

Query: 230 VNCERAFLAELDGSCKSAIAGFAY-CKGSTLYFYGIVLASDGKIFHEVSRNG--NRCDAI 286
           V CER FL+ LDG+C++ IA +A   K     F G++ + DG   +E SR G  +    +
Sbjct: 182 VACEREFLSVLDGNCRTPIAAYASRDKDGNCSFRGLLASPDGSTVYETSRTGPYDFDIMV 241

Query: 287 NIGRDAAQYIRFISNKNVFN 306
            +G+DA   ++  +    F+
Sbjct: 242 EMGKDAGHELKAKAGPGFFD 261


>gi|311281516|ref|YP_003943747.1| porphobilinogen deaminase [Enterobacter cloacae SCF1]
 gi|308750711|gb|ADO50463.1| porphobilinogen deaminase [Enterobacter cloacae SCF1]
          Length = 318

 Score =  200 bits (508), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/296 (38%), Positives = 164/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDKVLRIATRQSPLALWQAHYVKDRLTACH--PGLQVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +  +GL ++    RED RD F+S+   SL  
Sbjct: 64  KGLFVKELELALLEHRADIAVHSMKDVPVEFPQGLGLTTICEREDPRDAFVSNQYASLDA 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 124 LPAGSIVGTSSLRRQCQLAAQRPDLVIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   + L+  +NH +T   V  ERA    L
Sbjct: 184 LESRIRQALSPEQSLPAVGQGAVGIECRLDDDATRALLAPLNHPETAVRVGAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  I  +A  +G  L+   +V A DG       R G   +A  +G   A+ +
Sbjct: 244 EGGCQVPIGSYAELQGGELWLRALVGAPDGSRMVRGERRGTPEEAERLGVSLAEEL 299


>gi|11467957|sp|O66621|HEM3_AQUAE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
          Length = 304

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 169/289 (58%), Gaps = 5/289 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A   +  L    K     + ++ ++T GD+IT+  L +IGGKGLF 
Sbjct: 3   IRIGTRKSKLALWQANYVKDFL---EKHWGVEVELVKITTTGDKITDVPLAKIGGKGLFV 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIEK L+ G ID AVHS KD+P  + KGL++ A   RE+  DV IS + + L +L   S
Sbjct: 60  KEIEKALLEGSIDLAVHSLKDVPMVIPKGLKLGAITKRENPYDVLISRSGKKLYELPSGS 119

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           VIGTSSLRR+  + + R D+ V   RG ++TR+ KL      A++LAYAG+KR+  E  I
Sbjct: 120 VIGTSSLRRQVQIKKRRRDLKVEVLRGNVDTRMRKLKEGLYDAVILAYAGVKRMGYESEI 179

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E+L  EDF P+ GQG++ IE    + + +EL+K +N+E+++     ER FL  L+G C+
Sbjct: 180 TEVL--EDFIPAVGQGSLAIEIREGDKRIEELIKPLNNEESFLCAIAERTFLRRLEGGCQ 237

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
             +  FA  +  TL     +   + + + E  R GN  +A  +G   A+
Sbjct: 238 VPVGAFAKIENGTLKMKAFISDIEAERYIEGYREGNPEEAEKLGLSLAE 286


>gi|153875202|ref|ZP_02003104.1| porphobilinogen deaminase [Beggiatoa sp. PS]
 gi|152068334|gb|EDN66896.1| porphobilinogen deaminase [Beggiatoa sp. PS]
          Length = 309

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/277 (39%), Positives = 161/277 (58%), Gaps = 4/277 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR SPLAL      R  L   H  P   I ++ ++T+GD+I +  L +IGGKG
Sbjct: 4   KNIIRIATRKSPLALWQTHHVRDILCHAH--PQLQIELVEMTTQGDKILDVPLAKIGGKG 61

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L  G++D AVHS KD+P +   GL +   + RE+  D F+S+       L 
Sbjct: 62  LFVKELENGLFEGKVDIAVHSMKDVPVEFPPGLILPVIMEREEPYDAFVSNHYSGFTALP 121

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +++GTSSLRR+  LL  R D+ +   RG + TRL KL+N    AI+LA AG+KRL   
Sbjct: 122 QGAIVGTSSLRRQCQLLVLRPDLQIRTLRGNVGTRLKKLDNGDYDAIILAAAGLKRLGMA 181

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+E+L  E   P+ GQGAI IE   ++ + Q+L+ V+NH+ T + +  ERA   +L+G
Sbjct: 182 ERIREVLKPEVMLPAIGQGAIGIECRADDTETQQLIAVLNHKPTQERLKAERALNEQLNG 241

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVS 277
            C+  IAG+A  +   +   G+V   DGK  + H+V 
Sbjct: 242 GCQVPIAGYAEIEAEMMTVRGLVGDIDGKEVLHHKVQ 278


>gi|108806170|ref|YP_650086.1| porphobilinogen deaminase [Yersinia pestis Antiqua]
 gi|108810280|ref|YP_646047.1| porphobilinogen deaminase [Yersinia pestis Nepal516]
 gi|145600717|ref|YP_001164793.1| porphobilinogen deaminase [Yersinia pestis Pestoides F]
 gi|153949991|ref|YP_001399195.1| porphobilinogen deaminase [Yersinia pseudotuberculosis IP 31758]
 gi|153997095|ref|ZP_02022228.1| porphobilinogen deaminase [Yersinia pestis CA88-4125]
 gi|161484901|ref|NP_667719.2| porphobilinogen deaminase [Yersinia pestis KIM 10]
 gi|161511325|ref|NP_994488.2| porphobilinogen deaminase [Yersinia pestis biovar Microtus str.
           91001]
 gi|165926233|ref|ZP_02222065.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165939151|ref|ZP_02227702.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166011678|ref|ZP_02232576.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213633|ref|ZP_02239668.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401822|ref|ZP_02307310.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167421084|ref|ZP_02312837.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426299|ref|ZP_02318052.1| porphobilinogen deaminase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470637|ref|ZP_02335341.1| porphobilinogen deaminase [Yersinia pestis FV-1]
 gi|218930852|ref|YP_002348727.1| porphobilinogen deaminase [Yersinia pestis CO92]
 gi|229837182|ref|ZP_04457347.1| hydroxymethylbilane synthase [Yersinia pestis Pestoides A]
 gi|229839542|ref|ZP_04459701.1| hydroxymethylbilane synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229900105|ref|ZP_04515242.1| hydroxymethylbilane synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229900449|ref|ZP_04515578.1| hydroxymethylbilane synthase [Yersinia pestis Nepal516]
 gi|270488804|ref|ZP_06205878.1| hydroxymethylbilane synthase [Yersinia pestis KIM D27]
 gi|294505512|ref|YP_003569574.1| porphobilinogen deaminase [Yersinia pestis Z176003]
 gi|17380441|sp|P46355|HEM3_YERPE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|122979815|sp|Q1CBN1|HEM3_YERPA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123373560|sp|Q1CNI3|HEM3_YERPN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|158514109|sp|A4TRA8|HEM3_YERPP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|167008820|sp|A7FD67|HEM3_YERP3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|108773928|gb|ABG16447.1| hydroxymethylbilane synthase [Yersinia pestis Nepal516]
 gi|108778083|gb|ABG12141.1| hydroxymethylbilane synthase [Yersinia pestis Antiqua]
 gi|115349463|emb|CAL22436.1| porphobilinogen deaminase [Yersinia pestis CO92]
 gi|145212413|gb|ABP41820.1| hydroxymethylbilane synthase [Yersinia pestis Pestoides F]
 gi|149289401|gb|EDM39479.1| porphobilinogen deaminase [Yersinia pestis CA88-4125]
 gi|152961486|gb|ABS48947.1| porphobilinogen deaminase [Yersinia pseudotuberculosis IP 31758]
 gi|165912924|gb|EDR31550.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165921757|gb|EDR38954.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989447|gb|EDR41748.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205306|gb|EDR49786.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961213|gb|EDR57234.1| porphobilinogen deaminase [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048715|gb|EDR60123.1| porphobilinogen deaminase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054818|gb|EDR64622.1| porphobilinogen deaminase [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229682468|gb|EEO78555.1| hydroxymethylbilane synthase [Yersinia pestis Nepal516]
 gi|229686885|gb|EEO78964.1| hydroxymethylbilane synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695908|gb|EEO85955.1| hydroxymethylbilane synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706125|gb|EEO92134.1| hydroxymethylbilane synthase [Yersinia pestis Pestoides A]
 gi|262363578|gb|ACY60299.1| porphobilinogen deaminase [Yersinia pestis D106004]
 gi|262367506|gb|ACY64063.1| porphobilinogen deaminase [Yersinia pestis D182038]
 gi|270337308|gb|EFA48085.1| hydroxymethylbilane synthase [Yersinia pestis KIM D27]
 gi|294355971|gb|ADE66312.1| porphobilinogen deaminase [Yersinia pestis Z176003]
 gi|320013550|gb|ADV97121.1| hydroxymethylbilane synthase [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 313

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 160/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LENRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMG 287


>gi|304309752|ref|YP_003809350.1| Porphobilinogen deaminase [gamma proteobacterium HdN1]
 gi|301795485|emb|CBL43683.1| Porphobilinogen deaminase [gamma proteobacterium HdN1]
          Length = 311

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 113/270 (41%), Positives = 156/270 (57%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR S LAL  A   R+ L+  H  P  ++ II ++TKGD+I +  L +IGG
Sbjct: 1   MSNHRIRIATRESALALWQAEHVRACLLAAH--PGLDVEIIGMTTKGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +S  L RED RD F+S+   +L  
Sbjct: 59  KGLFVKELEVAMLEGIADIAVHSMKDVPVDFPEGLGLSVILEREDPRDAFVSNQYDTLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GT SLRR+  L   R DI +++ RG + +RL KL+  +  AILLA AG+KRL 
Sbjct: 119 LPLGARVGTCSLRRQTQLRARRPDIEILELRGNVNSRLAKLDAGQFDAILLAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+     P+ GQGAI IE   ++ +   L+  +NH DT   V+ ERA    L
Sbjct: 179 FHERIRATLDPAASLPAVGQGAIGIECRTDDARTLALLAPLNHPDTHTCVSAERAMNHRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            G C+  IAG+A   G  LY  G+V   DG
Sbjct: 239 QGGCQVPIAGYAELHGDQLYMRGLVGEPDG 268


>gi|170026227|ref|YP_001722732.1| porphobilinogen deaminase [Yersinia pseudotuberculosis YPIII]
 gi|238059009|sp|B1JPE6|HEM3_YERPY RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|169752761|gb|ACA70279.1| porphobilinogen deaminase [Yersinia pseudotuberculosis YPIII]
          Length = 313

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 160/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDAFVSSHYTHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LENRIRYAMSAEESLPAVGQGAVGIECRLDDGHTRQLLAPLNHRHTELRVCAERAMNIRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMG 287


>gi|262280694|ref|ZP_06058477.1| porphobilinogen deaminase [Acinetobacter calcoaceticus RUH2202]
 gi|262257594|gb|EEY76329.1| porphobilinogen deaminase [Acinetobacter calcoaceticus RUH2202]
          Length = 314

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 111/293 (37%), Positives = 170/293 (58%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 11  KTLKIATRQSPLALWQAEYIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 68

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 69  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 128

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ VID RG + TRL KL++ +  AI+LA AG+KRL   +
Sbjct: 129 GAKVGTSSLRRKSQILKQRPDLQVIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLSE 188

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L  +   P+ GQGA+ +E    + +   L++ + HE+T   V  ERAF A L+G 
Sbjct: 189 RIRHCLTPDISLPAVGQGALGLECRAADNEVLSLIQPLLHEETDVCVRAERAFNAYLEGG 248

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V ++DG+            +A  +G + A+ +
Sbjct: 249 CQVPIAGYATLQNGQIHIEGRVGSADGQTLLRAELTDEASNAHQLGENLARNL 301


>gi|188532369|ref|YP_001906166.1| Porphobilinogen deaminase [Erwinia tasmaniensis Et1/99]
 gi|238058922|sp|B2VG55|HEM3_ERWT9 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|188027411|emb|CAO95258.1| Porphobilinogen deaminase [Erwinia tasmaniensis Et1/99]
          Length = 313

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 163/289 (56%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L+  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSDKILRIATRRSPLALWQAEYVQRRLIACH--PGLRVELLPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++SG  D AVHS KD+P     GL + A   RED  D F+SH   S+  
Sbjct: 59  KGLFVKELEQAMLSGSADIAVHSMKDVPVAFPPGLGLVAICEREDPHDAFVSHHYTSVDS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLSARRPDLVIRSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++++  E+  P+ GQGA+ IE  +++ +   L+  +NH +T   V+ ERA    L
Sbjct: 179 LGDRIRQVMPAEESLPAVGQGAVGIECRLDDIQTIALLAALNHSETACRVSAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +   L+  G+V + DG       R G R DA  +G
Sbjct: 239 EGGCQVPIGSYALLEDDQLWLRGLVGSPDGNEMVRGERRGPRADAEKMG 287


>gi|78189475|ref|YP_379813.1| porphobilinogen deaminase [Chlorobium chlorochromatii CaD3]
 gi|123757008|sp|Q3AQF5|HEM3_CHLCH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78171674|gb|ABB28770.1| Porphobilinogen deaminase [Chlorobium chlorochromatii CaD3]
          Length = 313

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 115/280 (41%), Positives = 165/280 (58%), Gaps = 4/280 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L   +  P   I +  + T GD + +  L++IG  G
Sbjct: 2   KKQLIIGTRSSPLALWQAEFTKAELSKHY--PDMEITLKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK L++ EID AVHS KD+PT   +GL I+++  RED RDV IS     LKDL 
Sbjct: 60  LFTKDIEKHLLAREIDLAVHSLKDVPTSTPEGLIITSFTEREDTRDVIISKGGVKLKDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            ++ + TSSLRR + LL  R D+ + D RG + TR  K ++ +  A++LAYAG+ RL   
Sbjct: 120 PNARMATSSLRRMSQLLSVRPDLDIRDIRGNLNTRFQKFDDGEFDAMMLAYAGVYRLNFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  +   P+ GQGA+ IET V++ + +E+V+++NH  T      ERA L  L G
Sbjct: 180 DRISEILPHDMMLPAVGQGALGIETRVDDEQTREIVRILNHSTTEYCCRAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSRNG 280
            C+  I  +A     TL     V + DGK  + +E+++ G
Sbjct: 240 GCQIPIGAYATFSNGTLKLLAFVGSVDGKTALRNEITKTG 279


>gi|21957067|gb|AAM83970.1|AE013638_8 porphobilinogen deaminase; hydroxymethylbilane synthase [Yersinia
           pestis KIM 10]
 gi|45437816|gb|AAS63365.1| porphobilinogen deaminase [Yersinia pestis biovar Microtus str.
           91001]
          Length = 369

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 117/293 (39%), Positives = 162/293 (55%), Gaps = 2/293 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   I ++P+ T+GD I +  L ++GG
Sbjct: 57  MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQIELVPMVTRGDIILDTPLAKVGG 114

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S     L D
Sbjct: 115 KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDAFVSSHYAHLDD 174

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 175 LPAGSVVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLG 234

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++ E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 235 LENRIRYAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRL 294

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
           +G C+  I  +A  +G TL+   +V A DG       R G   +A  +G + A
Sbjct: 295 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMGIELA 347


>gi|15605804|ref|NP_213181.1| porphobilinogen deaminase [Aquifex aeolicus VF5]
 gi|2982966|gb|AAC06580.1| porphobilinogen deaminase [Aquifex aeolicus VF5]
          Length = 323

 Score =  199 bits (507), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 169/289 (58%), Gaps = 5/289 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A   +  L     +    + ++ ++T GD+IT+  L +IGGKGLF 
Sbjct: 22  IRIGTRKSKLALWQANYVKDFLEKHWGV---EVELVKITTTGDKITDVPLAKIGGKGLFV 78

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIEK L+ G ID AVHS KD+P  + KGL++ A   RE+  DV IS + + L +L   S
Sbjct: 79  KEIEKALLEGSIDLAVHSLKDVPMVIPKGLKLGAITKRENPYDVLISRSGKKLYELPSGS 138

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           VIGTSSLRR+  + + R D+ V   RG ++TR+ KL      A++LAYAG+KR+  E  I
Sbjct: 139 VIGTSSLRRQVQIKKRRRDLKVEVLRGNVDTRMRKLKEGLYDAVILAYAGVKRMGYESEI 198

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E+L  EDF P+ GQG++ IE    + + +EL+K +N+E+++     ER FL  L+G C+
Sbjct: 199 TEVL--EDFIPAVGQGSLAIEIREGDKRIEELIKPLNNEESFLCAIAERTFLRRLEGGCQ 256

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
             +  FA  +  TL     +   + + + E  R GN  +A  +G   A+
Sbjct: 257 VPVGAFAKIENGTLKMKAFISDIEAERYIEGYREGNPEEAEKLGLSLAE 305


>gi|323495298|ref|ZP_08100379.1| porphobilinogen deaminase [Vibrio brasiliensis LMG 20546]
 gi|323310475|gb|EGA63658.1| porphobilinogen deaminase [Vibrio brasiliensis LMG 20546]
          Length = 312

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 169/305 (55%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           +  P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QTTPIRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  S+ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYNSIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  +   R D+ + + RG + TRL KL+     AI+LA AG+KRL+ 
Sbjct: 121 PQGAVVGTCSLRRQCQIKEARPDLIIKELRGNVGTRLGKLDAGDYDAIILAAAGLKRLEL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ IK  +  E   P+ GQGA+ IE  +++ +  +L++ +NH++T D V CERA    L+
Sbjct: 181 EERIKSFIEPEQSLPAVGQGAVGIECRLDDDRLIKLLEPLNHKETADRVLCERAMNLTLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  ++   G  ++   +V   DG         G+R DA  +G + A  +     
Sbjct: 241 GGCQVPIGSYSLIDGDNIWLRALVGEPDGSKIVRGEIRGSRTDAEALGVELANQLLADGA 300

Query: 302 KNVFN 306
           K +  
Sbjct: 301 KEILT 305


>gi|254427203|ref|ZP_05040910.1| porphobilinogen deaminase [Alcanivorax sp. DG881]
 gi|196193372|gb|EDX88331.1| porphobilinogen deaminase [Alcanivorax sp. DG881]
          Length = 310

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 111/296 (37%), Positives = 167/296 (56%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M ++  RI TR SPLA+  A   +  L  +H+     + ++ + T+GD+I +  L +IGG
Sbjct: 1   MSREILRIATRSSPLAIWQAEYVQQRLESLHE--GLAVELVRIKTQGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +L +G  +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELEEAMMDGRADIAVHSMKDVPMELPEGFALPVICEREDPRDAFVSNTFDSLSS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+A +   R D+ V   RG ++TRL KL+  +  AI+LA AG+KRL+
Sbjct: 119 LPHGACVGTSSLRRQAQVKANRPDLVVKSLRGNVQTRLGKLDAGEFDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE    + +  +L+  ++  DTWD V  ERA    L
Sbjct: 179 MHDRIRYEMPPEESLPAVGQGAVGIECREADTRTIDLLSPLSDVDTWDRVVAERAMNRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           DG C+  IAGFA  +   L+  G+V   DG        +  R     +G D A+ +
Sbjct: 239 DGGCQVPIAGFALLEDGQLWLRGLVAEEDGSRVLRAEGSAPRAKGAELGIDIAEQL 294


>gi|270264251|ref|ZP_06192518.1| porphobilinogen deaminase [Serratia odorifera 4Rx13]
 gi|270041900|gb|EFA14997.1| porphobilinogen deaminase [Serratia odorifera 4Rx13]
          Length = 313

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 164/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQQRLMASH--PGLQVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P     GL +     R+D RD F+S+   S   
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIDFPAGLGLVTICERDDPRDAFVSNRFASFDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR++ L   R D+ V D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPQGSVVGTSSLRRQSQLRERRPDLIVRDLRGNVGTRLAKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L+ E+  P+ GQGA+ IE  +++   + L+  +NH  T   V  ERA    L
Sbjct: 179 LEQRIRSPLSPEECLPAVGQGAVGIECRLDDDATRALLAPLNHAATDIRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  I  +A  +G +L+   +V + DG       R G    A  +G + A+ +
Sbjct: 239 EGGCQVPIGSYAELEGDSLWLRALVGSPDGSQMVRGERRGPAALAEQMGVELAEEL 294


>gi|56421180|ref|YP_148498.1| porphobilinogen deaminase [Geobacillus kaustophilus HTA426]
 gi|61213219|sp|Q5KWK6|HEM3_GEOKA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|56381022|dbj|BAD76930.1| porphobilinogen deaminase (hydroxymethylbilane synthase)
           [Geobacillus kaustophilus HTA426]
          Length = 309

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 117/288 (40%), Positives = 175/288 (60%), Gaps = 7/288 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKI-PPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +G+R S LAL    +T+  + ++ ++  P    +  + TKGDR+ + TL+++GGKGLF +
Sbjct: 6   VGSRRSKLALT---QTKWVINELKQLGAPFTFEVKEIVTKGDRVLDVTLSKVGGKGLFVK 62

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE +L++G ID AVHS KDMP  L +GL I A   RED RDV +S   + L DL   SV
Sbjct: 63  EIEHELLAGGIDMAVHSMKDMPAVLPEGLVIGAVSRREDARDVLVSKGNRMLSDLPPGSV 122

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVI 185
           IGTSSLRR A LL +R D+++   RG I+TRL KL + +  AI+LA AG+ R+   + VI
Sbjct: 123 IGTSSLRRSAQLLAYRPDLTIKWIRGNIDTRLAKLESEEYDAIVLAAAGLARMGWGDDVI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L  +   P+ GQGA+ +E   ++ + ++ +  +N E T  +V  ERAFL +++G C+
Sbjct: 183 SDYLPFDVCVPAVGQGALAVECREDDDELRQWLSRLNDEQTERAVRAERAFLQQMEGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
             IAG+A  K  T+    +V + DGK  ++    G   D   +GR AA
Sbjct: 243 VPIAGYAEVKEGTVRLTALVASPDGKEMYKEIVTG--ADPEAVGRQAA 288


>gi|258591837|emb|CBE68140.1| Porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [NC10 bacterium
           'Dutch sediment']
          Length = 315

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 152/271 (56%), Gaps = 2/271 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     ++GTR SPLAL  A      L    + P  ++ I+P+ T GD+  +  L+++GG
Sbjct: 1   MRSHTVKLGTRGSPLALCQAGLVTEELR--RRWPDLDVTIVPIKTSGDKFLDVVLSQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ L+ G ID AVHS KD+P +L  GL   A + RED  D  ++       D
Sbjct: 59  KGLFVKEIEEALLDGRIDLAVHSLKDLPAELAPGLCEGAVMRREDPLDALVARNGLRFTD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTSSLRR+   L  R D+ +   RG ++TRLNKL      A++LA AG+ RL 
Sbjct: 119 LPRGARIGTSSLRRQVQFLHCRPDLQIESLRGNVQTRLNKLETLGLEAVVLAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I E L  +   P+ GQGA+ IE   ++ +  E V+ +NH +T  +   ERAFL  L
Sbjct: 179 LQDRITERLQPDLCLPAIGQGALVIEIREDDRQTAERVETLNHRETRQATTAERAFLRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGK 271
            GSC + IA F   +G TL   G+V   DGK
Sbjct: 239 GGSCVTPIAAFGRLEGETLELTGMVAGLDGK 269


>gi|52081298|ref|YP_080089.1| porphobilinogen deaminase [Bacillus licheniformis ATCC 14580]
 gi|52786677|ref|YP_092506.1| porphobilinogen deaminase [Bacillus licheniformis ATCC 14580]
 gi|319647211|ref|ZP_08001433.1| porphobilinogen deaminase [Bacillus sp. BT1B_CT2]
 gi|81609014|sp|Q65GK1|HEM3_BACLD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|52004509|gb|AAU24451.1| porphobilinogen deaminase (hydroxymethylbilane synthase) [Bacillus
           licheniformis ATCC 14580]
 gi|52349179|gb|AAU41813.1| HemC [Bacillus licheniformis ATCC 14580]
 gi|317390558|gb|EFV71363.1| porphobilinogen deaminase [Bacillus sp. BT1B_CT2]
          Length = 313

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 119/291 (40%), Positives = 169/291 (58%), Gaps = 6/291 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           +G+R S LA+         L +++  P     I  + TKGDRI + TL+++GGKGLF +E
Sbjct: 6   VGSRRSKLAMTQTKWVIKKLEELN--PDFTFEIKEIVTKGDRILDVTLSKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ ++SGEID AVHS KDMP+ L +GL +     RED RDV IS   Q L DL   +V+
Sbjct: 64  IEQAMLSGEIDMAVHSMKDMPSVLPEGLMVGCIPKREDARDVLISKGRQKLADLKQGAVV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVIK 186
           GTSSLRR A LL+ R D+ +   RG I+TRL KL      AI+LA AG+ R+  K+ V+ 
Sbjct: 124 GTSSLRRSAQLLQMRPDLEIKWIRGNIDTRLKKLETEDYDAIILAAAGLSRMGWKDDVVT 183

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E L+ E   P+ GQGA+ IE   ++ +   L   +N   T  +V  ERAFL  ++G C+ 
Sbjct: 184 EFLDPESCLPAVGQGALAIECRGSDEELLSLFSRLNDRYTQLTVTAERAFLHAMEGGCQV 243

Query: 247 AIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            IAGFA   +   +   G+V + DGK  +  +  G   +A  +GR+ A  +
Sbjct: 244 PIAGFAKMDEDGVIELTGLVASPDGKTVYRETVKGKDPEA--VGRECAAVM 292


>gi|110598700|ref|ZP_01386964.1| porphobilinogen deaminase [Chlorobium ferrooxidans DSM 13031]
 gi|110339694|gb|EAT58205.1| porphobilinogen deaminase [Chlorobium ferrooxidans DSM 13031]
          Length = 313

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 116/280 (41%), Positives = 165/280 (58%), Gaps = 4/280 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L      P  +I +  + T GD + +  L++IG  G
Sbjct: 2   KKQLIIGTRSSPLALWQAEFTKTEL--SRHFPELDIKLKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK LI+ EID AVHS KD+PT   +GL I+++  RED RDV IS     LK+L 
Sbjct: 60  LFTKDIEKHLIAKEIDLAVHSLKDVPTGTPEGLIITSFTEREDTRDVIISKGGVKLKELP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            ++ + TSSLRR + LL  R D+ + D RG + TR  K +  +  A++LAYAG+ RL   
Sbjct: 120 ANAKMATSSLRRMSQLLSLRPDLDIRDIRGNLNTRFQKFDAGEFDAMMLAYAGVYRLNFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  E   P+ GQGA+ IET V++ + +E+V+++NH +T      ERA L  L G
Sbjct: 180 DRISEILPHEVMLPAVGQGALGIETRVDDEQTREIVRILNHSNTEYCCRAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKI-FH-EVSRNG 280
            C+  I  +   +  TL     V + DGK+  H E+++ G
Sbjct: 240 GCQIPIGAYGSFQNGTLKLLAYVGSVDGKVGLHDEITKTG 279


>gi|225848376|ref|YP_002728539.1| porphobilinogen deaminase [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644642|gb|ACN99692.1| porphobilinogen deaminase [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 308

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 166/267 (62%), Gaps = 3/267 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           RIGTR S LAL  A    + +  +H +    + ++ ++T GD+I +  L +IGGKGLF +
Sbjct: 4   RIGTRKSQLALWQANYIANLINQIHGV---EVELVKITTSGDKILDVPLAKIGGKGLFVK 60

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE  ++ GEID AVHS KD+PT+L +GL I A   RED RD F+S   +SLKDL   +V
Sbjct: 61  EIEDAMLKGEIDIAVHSLKDVPTQLPEGLDIIAITEREDPRDAFLSTKYKSLKDLPAGAV 120

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           +GTSSLRRK+ +++ R D+ + D RG ++TR+ KL   +  AI+LAYAG+KRL  +    
Sbjct: 121 VGTSSLRRKSQIMKMRDDLIINDLRGNVDTRIRKLEEGQYDAIILAYAGLKRLGLDSKAS 180

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
            I + ++  P+  QG + IE  V++ + +++++ IN+++++     ER+FL  L+G C+ 
Sbjct: 181 YIFSPQEMIPAVCQGFLGIEARVDDERIKKILEPINNQESFIRATAERSFLKTLEGGCQV 240

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIF 273
            +  +   K   ++  G +   +GK F
Sbjct: 241 PLGAYCEIKDDFIHITGFIADLEGKTF 267


>gi|295687518|ref|YP_003591211.1| porphobilinogen deaminase [Caulobacter segnis ATCC 21756]
 gi|295429421|gb|ADG08593.1| porphobilinogen deaminase [Caulobacter segnis ATCC 21756]
          Length = 333

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 117/280 (41%), Positives = 161/280 (57%), Gaps = 17/280 (6%)

Query: 3   KKPFRIGTRCSPLALAHA--FETR----------SSLMDVHKIPPHNIVIIPLSTKGDRI 50
           + P RIG R S L+LA +   + R          +S  ++    P    +IP+ T GDRI
Sbjct: 15  QPPIRIGARGSKLSLAQSGLMQARIAAALGAPAGASKEEIEAFAP----LIPIVTSGDRI 70

Query: 51  TNRTLTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVF 110
            +R L EIGGKGLFT+EIE+ L+ G IDCAVHS KDMP +L  GL ++A   RED RD F
Sbjct: 71  QDRRLMEIGGKGLFTKEIEEALLDGRIDCAVHSLKDMPAELPPGLVLAATPEREDPRDAF 130

Query: 111 ISHTAQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAIL 170
           ISH  + L+DL   + +GT+SLRR+A  L  R D+ ++  RG ++TRL KL   +A AIL
Sbjct: 131 ISHVCERLEDLPKGARLGTASLRRQAQALHVRPDLEIVMLRGNVDTRLAKLERGEADAIL 190

Query: 171 LAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSV 230
           LA +G+ RL    + K  ++ +  PP+PGQGA+ IET   +  A  L   +    T  +V
Sbjct: 191 LAQSGLNRLGLGHLTKSWIDPDACPPAPGQGALVIETRAEDIGAAWL-DAVRCRPTTIAV 249

Query: 231 NCERAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
             ER  L  L+GSC++AI   A   G+ L      L  +G
Sbjct: 250 AAERGALLALEGSCRTAIGARATLDGARLSMIVEALTPNG 289


>gi|323141796|ref|ZP_08076663.1| hydroxymethylbilane synthase [Phascolarctobacterium sp. YIT 12067]
 gi|322413719|gb|EFY04571.1| hydroxymethylbilane synthase [Phascolarctobacterium sp. YIT 12067]
          Length = 306

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 173/303 (57%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K    IGTR S LAL  +    + L    + P   +V+  + TKGDRI +  L +IGGKG
Sbjct: 2   KAKLTIGTRQSLLALWQSNHIAALLR--KEYPECEVVLKKIVTKGDRILDVPLAQIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+EIE+ L+ G +D AVHS KDMPT L +GL ++A   R ++ D F+S+   + ++L 
Sbjct: 60  LFTKEIEEDLLDGTVDLAVHSLKDMPTVLPEGLCLTAITERANVGDAFVSNKYATFEELP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
           L SV+GTSSLRRKA LL  R D+ + D RG ++TRL KL+     AI+LA AG++RL   
Sbjct: 120 LGSVVGTSSLRRKAQLLAKRPDLEIRDLRGNVDTRLRKLDEGLYDAIILAAAGLERLGHG 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I  ++  +   P+ GQGA+ IE    + + ++++  +N  +T  + + ERAFL  L+G
Sbjct: 180 DRISSLIPADVCLPAVGQGALAIEARTADKEVRDMLSFLNDLNTKQATDAERAFLGLLEG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  I   A  +G  +    I+ A DG      + NG   DA+++G+   + +     +
Sbjct: 240 GCQVPIGVHADVEGENIRIEAIIAALDGSTILRDTINGKADDAVSLGQQLGKKMLAAGGQ 299

Query: 303 NVF 305
            + 
Sbjct: 300 EIL 302


>gi|315178740|gb|ADT85654.1| porphobilinogen deaminase [Vibrio furnissii NCTC 11218]
          Length = 312

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 110/302 (36%), Positives = 167/302 (55%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A   + +L   H  P   + ++ + T+GD I +  L ++GGKGLF
Sbjct: 6   PIRIATRQSPLALWQAHFVKDALQAAH--PGLEVELVTMVTRGDVILDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL +L   
Sbjct: 64  VKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYASLDELPHG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +++GT SLRR+  L   R D+ + + RG + TRL KL+  +  AI+LA AG+KRLK E+ 
Sbjct: 124 AIVGTCSLRRQCQLKEARPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLKLEQR 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+ ++  E   P+ GQGA+ IE  +++ + + L+  ++  DT D V CERA    L+G C
Sbjct: 184 IRSLIEPEQSLPAVGQGAVGIECRLDDARLRALLAPLSDADTTDRVLCERAMNLTLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  I  +A   G  L+   +V   DG         G R DA  +G + A  +     +++
Sbjct: 244 QVPIGSYALLDGDDLWLRALVGEPDGSHIVRGEIRGPRQDAERLGVELANQLLADGARDI 303

Query: 305 FN 306
             
Sbjct: 304 LT 305


>gi|157833452|pdb|1PDA|A Chain A, Structure Of Porphobilinogen Deaminase Reveals A Flexible
           Multidomain Polymerase With A Single Catalytic Site
 gi|41664|emb|CAA27813.1| unnamed protein product [Escherichia coli]
          Length = 313

 Score =  199 bits (506), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 163/291 (56%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G+C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGACQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++  G+V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRGLVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|327439433|dbj|BAK15798.1| porphobilinogen deaminase [Solibacillus silvestris StLB046]
          Length = 310

 Score =  199 bits (505), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 111/281 (39%), Positives = 163/281 (58%), Gaps = 3/281 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           +G+R S LAL       + L +     P +  +  + TKGDRI +  L+++GGKGLF +E
Sbjct: 6   VGSRKSKLALTQTNWFINELKEAG--VPFDFEVKEIVTKGDRILDVQLSKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L   EID AVHS KDMP  L +GL I    PRED RD FIS+      DL   +++
Sbjct: 64  IEQALYDKEIDFAVHSMKDMPAVLPEGLIIGCIPPREDARDAFISNGHVKFADLPKGAIV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVIK 186
           GTSSLRR A LL+ R D+ +   RG ++TRL KL      AI+LA AG+KRL   ++V+ 
Sbjct: 124 GTSSLRRSAQLLQARPDLEIKWIRGNVDTRLKKLETEDFDAIILAAAGLKRLGWSDEVVT 183

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E L+ +   P+  QG++ IE   ++ +  E +  +    TW + + ER+FLA +DG C+ 
Sbjct: 184 EYLDTDICLPAVAQGSLGIECRADDTELLEQLTKLTDATTWATAHAERSFLAAMDGGCQV 243

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAIN 287
            IAG+A  +G T+   G+V A D  + ++ +  G   DA+ 
Sbjct: 244 PIAGYATVEGDTITLTGLVAAPDASVTYKETLTGTDADAVG 284


>gi|191174267|ref|ZP_03035776.1| porphobilinogen deaminase [Escherichia coli F11]
 gi|190905450|gb|EDV65080.1| porphobilinogen deaminase [Escherichia coli F11]
          Length = 318

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 299


>gi|260596029|ref|YP_003208600.1| porphobilinogen deaminase [Cronobacter turicensis z3032]
 gi|260215206|emb|CBA27057.1| Porphobilinogen deaminase [Cronobacter turicensis z3032]
          Length = 313

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 164/291 (56%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAQYVKQRLEACH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+  +SL ++   S
Sbjct: 64  KELELAMLDGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNRYKSLDEMPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  +   R D+ +   RG + TRL+KL+N    AI+LA AG+KRL+ +  I
Sbjct: 124 IVGTSSLRRQCQIAARRPDLIIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLQLDARI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L  E   P+ GQGA+ IE  +++ + +EL+  +NHE+T   V  ERA    L+G C+
Sbjct: 184 TSPLAPEISLPAVGQGAVGIECRLDDTRTRELLAPLNHEETAVRVRAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A  K   L+   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELKDGELWLRALVGAPDGSRIVRGERRGAPQDASQLGVSLAEEL 294


>gi|206580079|ref|YP_002241132.1| porphobilinogen deaminase [Klebsiella pneumoniae 342]
 gi|290513167|ref|ZP_06552529.1| porphobilinogen deaminase [Klebsiella sp. 1_1_55]
 gi|226706289|sp|B5XYL1|HEM3_KLEP3 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|206569137|gb|ACI10913.1| porphobilinogen deaminase [Klebsiella pneumoniae 342]
 gi|289774378|gb|EFD82384.1| porphobilinogen deaminase [Klebsiella sp. 1_1_55]
          Length = 313

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 163/289 (56%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P  N+ ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLNVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     R+D RD F+S+   S+ +
Sbjct: 59  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNHYASIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRLK
Sbjct: 119 LPAGSVVGTSSLRRQCQLAATRPDLVIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   Q L+  +NH +T   V  ERA    L
Sbjct: 179 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTQALLAPLNHAETAVRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A      L+   +V A DG       R G    A  +G
Sbjct: 239 EGGCQVPIGSYAELVNGELWLRALVGAPDGSQMVRGERRGPAEQAEALG 287


>gi|192360982|ref|YP_001983840.1| porphobilinogen deaminase [Cellvibrio japonicus Ueda107]
 gi|190687147|gb|ACE84825.1| porphobilinogen deaminase [Cellvibrio japonicus Ueda107]
          Length = 315

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 165/273 (60%), Gaps = 4/273 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR S LAL  A   ++ L   H  P   + ++PL+++GD+I +  L ++GGKGLF 
Sbjct: 8   LRIATRKSLLALWQADYVKTELERHH--PGLRVELVPLTSRGDKILDVPLAKVGGKGLFV 65

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E+ L++G  D AVHS KD+P +   GL ++   PRED RD F+S+   SL DL   +
Sbjct: 66  KELEQALLAGAADIAVHSMKDVPMEFPDGLGLAVICPREDARDAFVSNRFASLDDLPAGA 125

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  LL  R D+ V   RG ++TRL KL++ +  AI+LA AG+ RL+ +  I
Sbjct: 126 VVGTSSLRRQCQLLARRPDLQVKFLRGNVQTRLQKLDDGEYDAIILAAAGLIRLELQARI 185

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           + ++  E   P+ GQGA+ IE  + +     L++ ++H+ T + V  ERA    L G C+
Sbjct: 186 RSLIAPEVSLPAGGQGAVGIECRMQDQATLALLQPLHHQPTAEQVLAERAMNRRLQGGCQ 245

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGK--IFHEV 276
             IA +A  +G  L+  G+V A DG   +F E+
Sbjct: 246 VPIACYALQQGGELWLRGLVGAPDGSQMLFDEI 278


>gi|212710180|ref|ZP_03318308.1| hypothetical protein PROVALCAL_01234 [Providencia alcalifaciens DSM
           30120]
 gi|212687179|gb|EEB46707.1| hypothetical protein PROVALCAL_01234 [Providencia alcalifaciens DSM
           30120]
          Length = 314

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 167/291 (57%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A+  ++ L  +H      + ++P+ TKGD I +  L ++GGKGLF 
Sbjct: 7   VRIATRKSPLALWQAYFVKAKLEQLHS--GLQVELVPMVTKGDIILDTPLAKVGGKGLFV 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++  L   S
Sbjct: 65  KELELALLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYANIDALPAGS 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL+ ++ I
Sbjct: 125 IVGTSSLRRQCQLRELRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLELDERI 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           K  L  E   P+ GQGA+ IE  +N+ + ++L+  +NH+ T   V  ERA    L+G C+
Sbjct: 185 KTALEPEQSLPAVGQGAVGIECRLNDQRTRDLLAKLNHDATSICVLAERAMNMRLEGGCQ 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A  +G  ++   +V A DG       R     DAI  G   A+ +
Sbjct: 245 VPIGSYAIWQGDKIWLRALVGAPDGSQVIRGERLIAPVDAIQAGISLAEEL 295


>gi|299771850|ref|YP_003733876.1| porphobilinogen deaminase [Acinetobacter sp. DR1]
 gi|298701938|gb|ADI92503.1| porphobilinogen deaminase [Acinetobacter sp. DR1]
          Length = 309

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 110/293 (37%), Positives = 168/293 (57%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 6   KTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 63

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 64  FVKELEAALLDGRADLAVHSMKDVPMALPEGLSLAVICEREDPLDAFVSNQFEKFADLPQ 123

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   +
Sbjct: 124 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLSE 183

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L  +   P+ GQGA+ +E    +     L++ + HE+T   V  ERAF A L+G 
Sbjct: 184 RIRHCLTPDISLPAVGQGALGLECRAADQDVLALIQPLLHEETDVCVRAERAFNAYLEGG 243

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 244 CQVPIAGYATLQNGQIHIEGRVGSPDGQTLLRAELTDEASNAHQLGENLARNL 296


>gi|288937772|ref|YP_003441831.1| porphobilinogen deaminase [Klebsiella variicola At-22]
 gi|288892481|gb|ADC60799.1| porphobilinogen deaminase [Klebsiella variicola At-22]
          Length = 318

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 163/289 (56%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P  N+ ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLNVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     R+D RD F+S+   S+ +
Sbjct: 64  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNHYASIDE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRLK
Sbjct: 124 LPAGSVVGTSSLRRQCQLAATRPDLVIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLK 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   Q L+  +NH +T   V  ERA    L
Sbjct: 184 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTQALLAPLNHAETAVRVRAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A      L+   +V A DG       R G    A  +G
Sbjct: 244 EGGCQVPIGSYAELVNGELWLRALVGAPDGSQMVRGERRGPAEQAEALG 292


>gi|327395980|dbj|BAK13402.1| porphobilinogen deaminase HemC [Pantoea ananatis AJ13355]
          Length = 317

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 163/289 (56%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  L+  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 5   MLNKIFRIATRQSPLALWQAQYVQQRLISAH--PGLRVELVPMVTKGDIILDTPLAKVGG 62

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++    D AVHS KD+P    +GL +     R+D RD F+S+   S+ +
Sbjct: 63  KGLFVKELEQAMLENRADLAVHSMKDVPVAFPEGLGLVTICQRDDPRDAFVSNHYASIDE 122

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +VIGTSSLRR+  +   R D+ +   RG + TRL+KL+  +  AI+LA AG+ RL 
Sbjct: 123 LPQGAVIGTSSLRRQCQISARRPDLVIRSLRGNVGTRLSKLDAGEYDAIILAAAGLNRLG 182

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I++ L  +   P+ GQGA+ IE  +++     L++ +NH+DT   V  ERA    L
Sbjct: 183 LADRIRQPLPADISLPAVGQGAVGIECRLDDSTLIALLQALNHDDTAVCVRAERAMNTRL 242

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  FA  +G  L+  G+V A DG +     R G R  A  +G
Sbjct: 243 EGGCQVPIGSFAVLEGDELWLRGLVGAPDGSVMVSGERRGPRDQAEQMG 291


>gi|240141705|ref|YP_002966185.1| Porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Methylobacterium
           extorquens AM1]
 gi|240011682|gb|ACS42908.1| Porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Methylobacterium
           extorquens AM1]
          Length = 294

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 113/292 (38%), Positives = 165/292 (56%), Gaps = 3/292 (1%)

Query: 15  LALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLIS 74
           +ALA     R  ++  +  P     I+ +ST  DR+ +R L+EIGGKGLFT+E+E+ L +
Sbjct: 1   MALAQTGMVRDRIVAAN--PGLETEIVVVSTVADRVLDRPLSEIGGKGLFTKELEQALFA 58

Query: 75  GEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFIS-HTAQSLKDLALHSVIGTSSLR 133
            EID AVHS KD+ T L  GL I+  L R+D RD F+S + A  L DL   + +GTSSLR
Sbjct: 59  DEIDVAVHSMKDVETWLPDGLAIACILERDDPRDAFLSANGANGLADLPPGARVGTSSLR 118

Query: 134 RKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIED 193
           R A +L  R D++++  RG   TR+ KL   +  A LLA AG++RL    V + +L++E+
Sbjct: 119 RGAQVLMHRPDLTIVPLRGNANTRMRKLEAGECDATLLALAGLQRLGMADVARSVLSVEE 178

Query: 194 FPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAY 253
             P+  QGA+ IE    +   + L+  +    T  +++ ER  LAELDGSC++ IA  A 
Sbjct: 179 MLPAVAQGALGIECRAGDDAIRALLAPVACATTTTALDAERGLLAELDGSCRTPIAALAQ 238

Query: 254 CKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
            KG  +   G++   DG     V R G   DA  IGR+A   ++  +    F
Sbjct: 239 VKGDRISLDGLLFLPDGSRHWAVHREGLAADADAIGREAGAELKRAAGDVYF 290


>gi|238784737|ref|ZP_04628740.1| Porphobilinogen deaminase [Yersinia bercovieri ATCC 43970]
 gi|238714333|gb|EEQ06342.1| Porphobilinogen deaminase [Yersinia bercovieri ATCC 43970]
          Length = 313

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 161/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P  ++ ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLHVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P     GL +     R+D RD F+S +   L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPDGLGLVTICERDDPRDAFVSSSYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLNRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  + +E+  P+ GQGA+ IE  +++   ++L+  +NH DT   V  ERA    L
Sbjct: 179 LETRIRYAMPVEESLPAVGQGAVGIECRLDDDFTRQLLAPLNHRDTELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G  L+   +V A DG       R G   +A  +G
Sbjct: 239 EGGCQVPIGSYAELEGDVLWLRALVGAPDGSEIIRGERRGPANNAEQMG 287


>gi|289207199|ref|YP_003459265.1| porphobilinogen deaminase [Thioalkalivibrio sp. K90mix]
 gi|288942830|gb|ADC70529.1| porphobilinogen deaminase [Thioalkalivibrio sp. K90mix]
          Length = 315

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 159/286 (55%), Gaps = 2/286 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           KP RI TR SPLA+  A    + L  +H  P   + ++ ++T+GDR+ +  L  IGGKGL
Sbjct: 2   KPLRIATRKSPLAMWQAEHVAARLRGLH--PDLPVELVGMTTQGDRVLDSPLARIGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  ++    D AVHS KD+P +L   L +   L RED  D F+S+T   + +L  
Sbjct: 60  FVKELEVAMLEDRADIAVHSVKDVPMELPADLVLPVILDREDPLDAFVSNTYAHVDELPQ 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +G+SSLRR+  L   R D+ + D RG + TRL KL+  +  AILLA AG+KRL  ++
Sbjct: 120 GARVGSSSLRRQCQLRARRPDLKITDLRGNVNTRLGKLDAGEYDAILLAAAGLKRLGFDE 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L      P+ GQGAI IE   N+P+   L+  +N  DT D V  ERAF   L+G 
Sbjct: 180 RIRARLEPAVSLPAVGQGAIAIECRENDPEIAALIAPLNDRDTSDRVRAERAFNRRLEGG 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           C+  +AG A   G  L   G+V A DG         G R DA  +G
Sbjct: 240 CQVPLAGHATLDGDRLRLDGLVGAVDGSQLLRRQVEGPRGDAEALG 285


>gi|293390862|ref|ZP_06635196.1| porphobilinogen deaminase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951396|gb|EFE01515.1| porphobilinogen deaminase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 308

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 160/270 (59%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  +I TR SPLAL  A   +  L  ++  P  N+ ++P+ TKGD I +  L +IGG
Sbjct: 1   MTQKSLKIATRQSPLALWQANYVKDRLQQLY--PDLNVELVPMVTKGDVILDSPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L++ E D AVHS KD+P +  +GL ++    RED RD F+S++ ++L +
Sbjct: 59  KGLFVKELENALLNKEADIAVHSMKDVPMQFPEGLGLAVICKREDPRDAFVSNSYRTLAE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL+KL+N    AI+LA AG+ RL 
Sbjct: 119 LPQGAVVGTSSLRRQCQLKKLRPDLEIRSLRGNVGTRLSKLDNGDYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   +++E   P+ GQGA+ IE   ++   Q+L+  +   +T   V  ERA    L
Sbjct: 179 LAERIASFIDVEQSLPAAGQGAVGIECRTDDVAVQQLLAPLADAETTSCVLAERAMNHHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            G C+  I G+A  + S LY   +V + DG
Sbjct: 239 QGGCQVPIGGYAVLRDSELYLRALVGSVDG 268


>gi|313110333|ref|ZP_07796223.1| porphobilinogen deaminase [Pseudomonas aeruginosa 39016]
 gi|310882725|gb|EFQ41319.1| porphobilinogen deaminase [Pseudomonas aeruginosa 39016]
          Length = 313

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 109/270 (40%), Positives = 158/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +N++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSINVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           +G C+  IA +A  +G  L+  G+V   DG
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDG 268


>gi|157377265|ref|YP_001475865.1| porphobilinogen deaminase [Shewanella sediminis HAW-EB3]
 gi|189028158|sp|A8G0W4|HEM3_SHESH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|157319639|gb|ABV38737.1| Hydroxymethylbilane synthase [Shewanella sediminis HAW-EB3]
          Length = 309

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 112/306 (36%), Positives = 172/306 (56%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   ++ L   H+     + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNVIRIATRKSPLALWQAEFVKAELEKFHE--GLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +++ +
Sbjct: 59  KGLFVKELEVAMLEDRADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNNYKNISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRASRPDLVIRDLRGNVGTRLGKLDAGNYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E+  P+ GQGA+ IE  +N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERITSFISAEESLPANGQGAVGIECRINDERVKALLAPLEHTETRHRVIAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A  +  TL   G+V   DG    E ++ G++ DA  IG   A+ +    
Sbjct: 239 EGGCQVPIGAYAEIQDDTLTLRGLVGNPDGSHIIEATKVGSKTDAQAIGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKAILD 304


>gi|138896211|ref|YP_001126664.1| porphobilinogen deaminase [Geobacillus thermodenitrificans NG80-2]
 gi|196250167|ref|ZP_03148861.1| porphobilinogen deaminase [Geobacillus sp. G11MC16]
 gi|158513835|sp|A4IRG5|HEM3_GEOTN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|134267724|gb|ABO67919.1| Porphobilinogen deaminase [Geobacillus thermodenitrificans NG80-2]
 gi|196210351|gb|EDY05116.1| porphobilinogen deaminase [Geobacillus sp. G11MC16]
          Length = 309

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKI-PPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +G+R S LAL    +T   + ++ ++  P    +  + TKGDR+ + TL+++GGKGLF +
Sbjct: 6   VGSRRSKLALT---QTNWVINELKRLGAPFTFEVKEIVTKGDRVLDVTLSKVGGKGLFVK 62

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE ++++G ID AVHS KDMP  L  GL I +   RED+RDV +S    SL DL   +V
Sbjct: 63  EIEHEMLTGGIDMAVHSMKDMPAVLPSGLVIGSVPRREDVRDVLVSKGNLSLSDLPSGAV 122

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVI 185
           IGTSSLRR A LL +R D+++   RG I+TRL KL N    AI+LA AG+ R+   + VI
Sbjct: 123 IGTSSLRRSAQLLAYRPDVTIKWIRGNIDTRLAKLKNEDYDAIVLAAAGLARMGWSDDVI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E L+ +   P+ GQGA+ +E   ++ + +E +  +N E T  +V  ERAFL +++G C+
Sbjct: 183 SEYLSPDVCVPAVGQGALAVECREDDVELREWLSRLNDEQTERAVRAERAFLQQMEGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             IAG+A  K   ++   +V + DGK  ++    G   D   +GR AA  +
Sbjct: 243 VPIAGYAEVKEGMVHLTALVASPDGKEKYKEIVIG--ADPEEVGRQAAALL 291


>gi|315497777|ref|YP_004086581.1| porphobilinogen deaminase [Asticcacaulis excentricus CB 48]
 gi|315415789|gb|ADU12430.1| porphobilinogen deaminase [Asticcacaulis excentricus CB 48]
          Length = 314

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 112/274 (40%), Positives = 166/274 (60%), Gaps = 13/274 (4%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDV--------HKIPPHNIVIIPLSTKGDRITNRTLTE 57
            +IGTR S LA       +  ++          H++ P  +VII  +T+GDRI +R L E
Sbjct: 5   LKIGTRGSRLATTQCGWVQRQIVTALGHDPALSHEVAP--LVII--TTQGDRIQDRRLIE 60

Query: 58  IGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQS 117
            GGK LFT+EIE  L+SGE+D AVHS KDMP + + GL + A+  RED RD F+S   +S
Sbjct: 61  AGGKQLFTKEIEDALLSGEVDVAVHSLKDMPAEDIPGLSLCAFPVREDPRDAFVSLKYRS 120

Query: 118 LKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIK 177
           L+DL   + +GT+SLRR+A  L  R D+ V+  RG ++TRL+KL      A+LLA AG+K
Sbjct: 121 LEDLPQGAKLGTASLRRQAQALAVRPDLEVVMLRGNVDTRLSKLEAGHCDAMLLAAAGLK 180

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           R+  E  IK  ++ + FP +PGQGA+ I+   N+   QE +K ++H +T   ++ ER  L
Sbjct: 181 RMGLEAHIKSYIDPDLFPCAPGQGALAIQCRTNDLD-QEWIKRLHHVETHLQISAERGAL 239

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGK 271
             L+ SC++A+  +A  +G  L  +   L +DG+
Sbjct: 240 VALEASCRTAVGAYAKIEGDALTLFVEALTADGR 273


>gi|306815158|ref|ZP_07449311.1| porphobilinogen deaminase [Escherichia coli NC101]
 gi|34222567|sp|Q8FBP1|HEM3_ECOL6 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|222035503|emb|CAP78248.1| Porphobilinogen deaminase [Escherichia coli LF82]
 gi|305851527|gb|EFM51981.1| porphobilinogen deaminase [Escherichia coli NC101]
 gi|312948358|gb|ADR29185.1| porphobilinogen deaminase [Escherichia coli O83:H1 str. NRG 857C]
          Length = 313

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|90414241|ref|ZP_01222221.1| porphobilinogen deaminase [Photobacterium profundum 3TCK]
 gi|90324688|gb|EAS41229.1| porphobilinogen deaminase [Photobacterium profundum 3TCK]
          Length = 341

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 167/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  KP RI TR SPLA+  A   ++ L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 32  MTDKPIRIATRKSPLAMWQAEFVQAELEKAH--PGLVVELVPMVTKGDIILDTPLAKVGG 89

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+T  S+ +
Sbjct: 90  KGLFVKELEVAMLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNTYNSIAE 149

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+ RL+
Sbjct: 150 LPAGSIVGTSSLRRQCQLRAQRPDLIINDLRGNVNTRLRKLDEGQYDAIILACAGLMRLE 209

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE  +++ + + L+  +NH +T   + CERA    L
Sbjct: 210 MHDRIRSAIEPEESLPAVGQGAVGIECRLDDHRVRALLATLNHPETATRIFCERAMNNHL 269

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  ++  +G  ++   +V   DG         G   D   +G   A+ +    
Sbjct: 270 QGGCQVPIGSYSELQGDQIWLRALVGEPDGSKMVRGEITGAAIDGEALGTQLAEQLLADG 329

Query: 301 NKNVFN 306
            K + +
Sbjct: 330 AKEILD 335


>gi|254564213|ref|YP_003071308.1| Porphobilinogen deaminase [Methylobacterium extorquens DM4]
 gi|254271491|emb|CAX27506.1| Porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Methylobacterium
           extorquens DM4]
          Length = 294

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 113/292 (38%), Positives = 164/292 (56%), Gaps = 3/292 (1%)

Query: 15  LALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLIS 74
           +ALA     R  ++  +  P     I+ +ST  DR+ +R L+EIGGKGLFT+E+E+ L +
Sbjct: 1   MALAQTGMVRDRIVAAN--PGLETEIVVVSTVADRVLDRPLSEIGGKGLFTKELEQALFA 58

Query: 75  GEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFIS-HTAQSLKDLALHSVIGTSSLR 133
            EID AVHS KD+ T L  GL I+  L R+D RD F+S + A  L DL   + +GTSSLR
Sbjct: 59  DEIDVAVHSMKDVETWLPDGLAIACILERDDPRDAFLSANGANGLADLPPGARVGTSSLR 118

Query: 134 RKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIED 193
           R A +L  R D++++  RG   TR+ KL   +  A LLA AG++RL    V + +L++E+
Sbjct: 119 RGAQVLMHRPDLTIVPLRGNANTRMRKLEAGECDATLLALAGLQRLGMANVARSVLSVEE 178

Query: 194 FPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAY 253
             P+  QGA+ IE    +   + L+  +    T  +++ ER  LAELDGSC++ IA  A 
Sbjct: 179 MLPAVAQGALGIECRAGDDAIRALLAPVACATTTTALDAERGLLAELDGSCRTPIAALAQ 238

Query: 254 CKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             G  +   G++   DG     V R G   DA  IGRDA   ++  +    F
Sbjct: 239 VSGDRISLDGLLFLPDGSRHWAVHREGLAADADAIGRDAGAELKRAAGDVYF 290


>gi|26250543|ref|NP_756583.1| porphobilinogen deaminase [Escherichia coli CFT073]
 gi|110644128|ref|YP_671858.1| porphobilinogen deaminase [Escherichia coli 536]
 gi|227888613|ref|ZP_04006418.1| hydroxymethylbilane synthase [Escherichia coli 83972]
 gi|300979364|ref|ZP_07174522.1| porphobilinogen deaminase [Escherichia coli MS 200-1]
 gi|300985714|ref|ZP_07177569.1| porphobilinogen deaminase [Escherichia coli MS 45-1]
 gi|301047316|ref|ZP_07194402.1| porphobilinogen deaminase [Escherichia coli MS 185-1]
 gi|26110973|gb|AAN83157.1|AE016769_272 Porphobilinogen deaminase [Escherichia coli CFT073]
 gi|110345720|gb|ABG71957.1| porphobilinogen deaminase [Escherichia coli 536]
 gi|227834452|gb|EEJ44918.1| hydroxymethylbilane synthase [Escherichia coli 83972]
 gi|300300835|gb|EFJ57220.1| porphobilinogen deaminase [Escherichia coli MS 185-1]
 gi|300308036|gb|EFJ62556.1| porphobilinogen deaminase [Escherichia coli MS 200-1]
 gi|300407988|gb|EFJ91526.1| porphobilinogen deaminase [Escherichia coli MS 45-1]
 gi|307555929|gb|ADN48704.1| porphobilinogen deaminase [Escherichia coli ABU 83972]
 gi|315293155|gb|EFU52507.1| porphobilinogen deaminase [Escherichia coli MS 153-1]
 gi|324007476|gb|EGB76695.1| porphobilinogen deaminase [Escherichia coli MS 57-2]
 gi|324014708|gb|EGB83927.1| porphobilinogen deaminase [Escherichia coli MS 60-1]
          Length = 320

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|330908104|gb|EGH36623.1| porphobilinogen deaminase [Escherichia coli AA86]
          Length = 318

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSLIIRGERRGAPQDAEQMGISLAEEL 299


>gi|312969469|ref|ZP_07783671.1| porphobilinogen deaminase [Escherichia coli 2362-75]
 gi|312286016|gb|EFR13934.1| porphobilinogen deaminase [Escherichia coli 2362-75]
          Length = 313

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|222054398|ref|YP_002536760.1| porphobilinogen deaminase [Geobacter sp. FRC-32]
 gi|254800252|sp|B9M416|HEM3_GEOSF RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|221563687|gb|ACM19659.1| porphobilinogen deaminase [Geobacter sp. FRC-32]
          Length = 318

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 166/296 (56%), Gaps = 3/296 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L    + P   + ++ + T GD+I +  L ++GG
Sbjct: 1   MALKQLRIGTRASQLALWQANWVKSELE--QRYPGMEVSLVKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ G+ID AVHS KD+PT+  +GL +     RED RD  IS   +   D
Sbjct: 59  KGLFVKEIEEAMLRGDIDIAVHSMKDVPTEFPEGLGLHCITEREDPRDAVISRGTK-FAD 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG +ETR+NKL   K  A++LA AG+KRL 
Sbjct: 118 LPQGAKIGTSALRRQAQLLKVRPDMEMVIIRGNVETRINKLETEKLDAVILAAAGLKRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + + E L  +   P+ GQGA+ IE  ++N + ++ +   NH  T  +V  ERA L   
Sbjct: 178 FTEKVAEYLPTDLSIPAIGQGALGIECRLDNEEVKQTIDFFNHPATAYAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA F    GS L   G + + DGK     +  G   D   +G   A+ +
Sbjct: 238 EGGCQVPIAAFGEVTGSDLKLVGFIASVDGKTSVRGTITGPAADCEKLGIKLAEQL 293


>gi|91213326|ref|YP_543312.1| porphobilinogen deaminase [Escherichia coli UTI89]
 gi|117626062|ref|YP_859385.1| porphobilinogen deaminase [Escherichia coli APEC O1]
 gi|237702812|ref|ZP_04533293.1| porphobilinogen deaminase [Escherichia sp. 3_2_53FAA]
 gi|91074900|gb|ABE09781.1| porphobilinogen deaminase [Escherichia coli UTI89]
 gi|115515186|gb|ABJ03261.1| porphobilinogen deaminase [Escherichia coli APEC O1]
 gi|226902983|gb|EEH89242.1| porphobilinogen deaminase [Escherichia sp. 3_2_53FAA]
 gi|294490567|gb|ADE89323.1| porphobilinogen deaminase [Escherichia coli IHE3034]
 gi|307628866|gb|ADN73170.1| porphobilinogen deaminase [Escherichia coli UM146]
 gi|315284723|gb|EFU44168.1| porphobilinogen deaminase [Escherichia coli MS 110-3]
          Length = 320

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICKREDPRDAFVSNTYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|215489131|ref|YP_002331562.1| porphobilinogen deaminase [Escherichia coli O127:H6 str. E2348/69]
 gi|215267203|emb|CAS11651.1| hydroxymethylbilane synthase HemC [Escherichia coli O127:H6 str.
           E2348/69]
          Length = 320

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNTYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|331649629|ref|ZP_08350711.1| hydroxymethylbilane synthase [Escherichia coli M605]
 gi|331041499|gb|EGI13647.1| hydroxymethylbilane synthase [Escherichia coli M605]
          Length = 320

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSLIIRGERRGAPQDAEQMGISLAEEL 301


>gi|57239097|ref|YP_180233.1| porphobilinogen deaminase [Ehrlichia ruminantium str. Welgevonden]
 gi|58579044|ref|YP_197256.1| porphobilinogen deaminase [Ehrlichia ruminantium str. Welgevonden]
 gi|57161176|emb|CAH58090.1| porphobilinogen deaminase [Ehrlichia ruminantium str. Welgevonden]
 gi|58417670|emb|CAI26874.1| Porphobilinogen deaminase [Ehrlichia ruminantium str. Welgevonden]
          Length = 299

 Score =  198 bits (504), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 171/296 (57%), Gaps = 9/296 (3%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M      +GTR S LA+A A E +  L +    P  N+ I+ + T GD     +L+EIGG
Sbjct: 1   MNSMNVYVGTRGSILAIAQAMEVKKLLYNYF--PDINVQIVHIVTSGDINDKISLSEIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L++G ID AVHS KD+P      L I   L R    DVFIS   QSL+ 
Sbjct: 59  KGLFLKELEEALLTGTIDLAVHSMKDVPAFYCDSLVIPCILKRSSPYDVFISSKYQSLRS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L  ++VIGTSS+RRK  L+R  S + V+  RG ++TR+ KL   +   I+LA AG+ R+ 
Sbjct: 119 LPDNAVIGTSSIRRKVQLMRLLSSVQVVPIRGNVDTRILKLEAGQYDGIILAKAGLMRIN 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K  VIKE+L+ +    + GQGAI I+   N+ K  +++K++N + ++ SV  ER+F+  +
Sbjct: 179 KTHVIKEVLDPQVMLSAVGQGAIGIQCRANDYKMIDMIKILNCKKSYISVAAERSFMKTV 238

Query: 241 DGSCKSAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDA----INIGRD 291
           +GSC + +A  A Y    TLY   ++   +  +F +     N CDA    IN+G D
Sbjct: 239 NGSCDTPLAALAKYVNSDTLYMSCMLSNEEKTVFSDCYF--NECDAEISGINMGND 292


>gi|300714797|ref|YP_003739600.1| Porphobilinogen deaminase [Erwinia billingiae Eb661]
 gi|299060633|emb|CAX57740.1| Porphobilinogen deaminase [Erwinia billingiae Eb661]
          Length = 313

 Score =  198 bits (503), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 160/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKILRIATRQSPLALWQAHYVQQRLMACH--PGLRVELVPMVTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++    D AVHS KD+P    +GL +     RED  D F+S+   S+  
Sbjct: 59  KGLFVKELEQAMLEDRADIAVHSMKDVPIAFPEGLGLVTICEREDPLDAFVSNQYDSVDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAVVGTSSLRRQCQLSARRPDLIIRSLRGNVGTRLGKLDAGEYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE  +++ +A  L+  +N +DT   V  ERA    L
Sbjct: 179 LGDRIRYAMPAEESLPAVGQGAVGIECRLDDAQAIALLSALNDDDTAIRVKAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  FA  +G  L+  G+V + DG       R G R DA  +G
Sbjct: 239 EGGCQVPIGSFALLQGDELWLRGLVGSPDGTAMIRGERRGPRADAEKMG 287


>gi|218560868|ref|YP_002393781.1| porphobilinogen deaminase [Escherichia coli S88]
 gi|218692081|ref|YP_002400293.1| porphobilinogen deaminase [Escherichia coli ED1a]
 gi|226740633|sp|B7MH66|HEM3_ECO45 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800250|sp|B7N295|HEM3_ECO81 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|218367637|emb|CAR05420.1| hydroxymethylbilane synthase [Escherichia coli S88]
 gi|218429645|emb|CAR10466.1| hydroxymethylbilane synthase [Escherichia coli ED1a]
 gi|323949314|gb|EGB45204.1| porphobilinogen deaminase [Escherichia coli H252]
 gi|323954009|gb|EGB49807.1| porphobilinogen deaminase [Escherichia coli H263]
          Length = 313

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+T  SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICKREDPRDAFVSNTYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|330444901|ref|ZP_08308556.1| porphobilinogen deaminase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489211|dbj|GAA03053.1| porphobilinogen deaminase [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 310

 Score =  198 bits (503), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 108/306 (35%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +P RI TR SPLA+  A   ++ L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MTSQPIRIATRKSPLAMWQAEFVKAELEQAH--PGIVVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++ +
Sbjct: 59  KGLFVKELEVAMLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNKYNNIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  +   R D+ V D RG + TRL KL++ +  AI+LA AG+KRLK
Sbjct: 119 LPQGAIVGTSSLRRQCQIRAQRPDLIVNDLRGNVNTRLRKLDDGEYDAIILACAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+  +  E   P+ GQGA+ IE  +++ + ++L+  +NH+ T   V CERA    L
Sbjct: 179 MDDRIRSEIAPETSLPAVGQGAVGIECRLDDTRVRQLLDALNHQPTATRVLCERAMNNRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
            G C+  I  +A  +G  ++   +V   DG         G    A  +G   A  +    
Sbjct: 239 QGGCQVPIGSYALLEGDEIWLRALVGEPDGSKIVRAEIRGPIAQAEQLGTTLADQLLADG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKDILD 304


>gi|323964049|gb|EGB59539.1| porphobilinogen deaminase [Escherichia coli M863]
 gi|327250654|gb|EGE62360.1| porphobilinogen deaminase [Escherichia coli STEC_7v]
          Length = 313

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +N+ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLNDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|281180853|dbj|BAI57183.1| porphobilinogen deaminase [Escherichia coli SE15]
          Length = 313

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSLIIRGERRGAPQDAEQMGISLAEEL 294


>gi|83590097|ref|YP_430106.1| porphobilinogen deaminase [Moorella thermoacetica ATCC 39073]
 gi|123766782|sp|Q2RJ26|HEM3_MOOTA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|83573011|gb|ABC19563.1| hydroxymethylbilane synthase [Moorella thermoacetica ATCC 39073]
          Length = 313

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/292 (39%), Positives = 166/292 (56%), Gaps = 4/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKI-PPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
            ++G+R S LA    ++ R  +  + K  P  +  ++ L TKGD+I +  L  IG KGLF
Sbjct: 4   IKVGSRESELA---RWQARWVIQALEKAWPGLSCRLVTLKTKGDKILDVALARIGDKGLF 60

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
           T+E+E  L+ G ID AVHS KDMPT L +GL I A  PRED  DV +S    +L  L + 
Sbjct: 61  TKELELALLDGAIDLAVHSMKDMPTTLPEGLVIGAIGPREDPADVLVSPEGYTLATLPIK 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRRKA L   R D+ ++D RG + TRL K+  +   AI+LA AG+KRL   +V
Sbjct: 121 ARVGTSSLRRKAQLAYARPDLELVDLRGNVPTRLAKMERDGLTAIVLAAAGLKRLNHGQV 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           + E +      P+ GQGAI +E    + +  ELV  INH  T  +V  ERA+L  L+G C
Sbjct: 181 LGEPIPYHICLPAVGQGAIGVEIRAGDRRVAELVAAINHPPTAAAVRAERAYLRALEGGC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +  IA  A  + + L   G+V + DG+       +G+  D    GR+ A+ +
Sbjct: 241 QVPIAALATVEDTALVLQGMVASLDGREMLRDIASGSTRDPEAAGRELARKL 292


>gi|260767548|ref|ZP_05876484.1| porphobilinogen deaminase [Vibrio furnissii CIP 102972]
 gi|260617448|gb|EEX42631.1| porphobilinogen deaminase [Vibrio furnissii CIP 102972]
          Length = 312

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 109/302 (36%), Positives = 167/302 (55%), Gaps = 2/302 (0%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           P RI TR SPLAL  A   + +L   H  P   + ++ + T+GD I +  L ++GGKGLF
Sbjct: 6   PIRIATRQSPLALWQAHFVKDALQAAH--PGLEVELVTMVTRGDVILDTPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E  ++ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL +L   
Sbjct: 64  VKELEVAMLEGRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNTYASLDELPHG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           +++GT SLRR+  L   R D+ + + RG + TRL KL+  +  AI+LA AG+KRL+ E+ 
Sbjct: 124 AIVGTCSLRRQCQLKEARPDLVIKELRGNVGTRLGKLDAGEYDAIILAAAGLKRLQLEQR 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I+ ++  E   P+ GQGA+ IE  +++ + + L+  ++  DT D V CERA    L+G C
Sbjct: 184 IRSLIEPEQSLPAVGQGAVGIECRLDDARLRALLAPLSDADTTDRVLCERAMNLTLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNV 304
           +  I  +A   G  L+   +V   DG         G R DA  +G + A  +     +++
Sbjct: 244 QVPIGSYALLDGDDLWLRALVGEPDGSHIVRGEIRGPRQDAERLGVELANQLLADGARDI 303

Query: 305 FN 306
             
Sbjct: 304 LT 305


>gi|254435152|ref|ZP_05048659.1| porphobilinogen deaminase [Nitrosococcus oceani AFC27]
 gi|207088263|gb|EDZ65535.1| porphobilinogen deaminase [Nitrosococcus oceani AFC27]
          Length = 314

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 157/268 (58%), Gaps = 2/268 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR S LAL  A     +L   H  P  NI ++ +ST+GD+I +  L +IGGKG
Sbjct: 8   KTCLRIATRKSLLALWQAEYVADTLR--HHYPDLNIELVRMSTQGDKILDTPLAKIGGKG 65

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E+ L SGE D AVHS KD+P  L + L I+    R D RD F+S+  Q L  L 
Sbjct: 66  LFIKELEQGLFSGEADIAVHSMKDVPVDLPENLHIAVICQRGDPRDAFVSNHWQDLDSLP 125

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR++ +   R D  V+D RG + TRL KL+NN+  AI+LA AG+KRL+  
Sbjct: 126 EGARVGTSSLRRQSQVRERRPDFQVLDLRGNVNTRLAKLDNNEFDAIILAAAGLKRLELT 185

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+E L  E   P+ GQGAI IE    +   +EL+KV+ H  T  ++  ERA  A L G
Sbjct: 186 QRIRESLAPEVSLPAIGQGAIGIECRKGDTATEELIKVLEHPPTRITIRAERALNARLAG 245

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            C+  IAG+A  +   L    +V   DG
Sbjct: 246 GCQVPIAGYAELEDERLRLRALVGQPDG 273


>gi|331685522|ref|ZP_08386106.1| hydroxymethylbilane synthase [Escherichia coli H299]
 gi|331077223|gb|EGI48437.1| hydroxymethylbilane synthase [Escherichia coli H299]
          Length = 313

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSLIIRGERRGAPQDAEQMGISLAEEL 294


>gi|77164030|ref|YP_342555.1| porphobilinogen deaminase [Nitrosococcus oceani ATCC 19707]
 gi|76882344|gb|ABA57025.1| hydroxymethylbilane synthase [Nitrosococcus oceani ATCC 19707]
          Length = 310

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/268 (43%), Positives = 157/268 (58%), Gaps = 2/268 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR S LAL  A     +L   H  P  NI ++ +ST+GD+I +  L +IGGKG
Sbjct: 4   KTCLRIATRKSLLALWQAEYVADTLR--HHYPDLNIELVRMSTQGDKILDTPLAKIGGKG 61

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E+ L SGE D AVHS KD+P  L + L I+    R D RD F+S+  Q L  L 
Sbjct: 62  LFIKELEQGLFSGEADIAVHSMKDVPVDLPENLHIAVICQRGDPRDAFVSNHWQDLDSLP 121

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR++ +   R D  V+D RG + TRL KL+NN+  AI+LA AG+KRL+  
Sbjct: 122 EGARVGTSSLRRQSQVRERRPDFQVLDLRGNVNTRLAKLDNNEFDAIILAAAGLKRLELT 181

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+E L  E   P+ GQGAI IE    +   +EL+KV+ H  T  ++  ERA  A L G
Sbjct: 182 QRIRESLAPEVSLPAIGQGAIGIECRKGDTATEELIKVLEHPPTRITIRAERALNARLAG 241

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            C+  IAG+A  +   L    +V   DG
Sbjct: 242 GCQVPIAGYAELEDERLRLRALVGQPDG 269


>gi|261418339|ref|YP_003252021.1| porphobilinogen deaminase [Geobacillus sp. Y412MC61]
 gi|297529191|ref|YP_003670466.1| porphobilinogen deaminase [Geobacillus sp. C56-T3]
 gi|319767702|ref|YP_004133203.1| porphobilinogen deaminase [Geobacillus sp. Y412MC52]
 gi|261374796|gb|ACX77539.1| porphobilinogen deaminase [Geobacillus sp. Y412MC61]
 gi|297252443|gb|ADI25889.1| porphobilinogen deaminase [Geobacillus sp. C56-T3]
 gi|317112568|gb|ADU95060.1| porphobilinogen deaminase [Geobacillus sp. Y412MC52]
          Length = 310

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 116/291 (39%), Positives = 175/291 (60%), Gaps = 7/291 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKI-PPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +G+R S LAL    +T+  + ++ ++  P    +  + TKGDR+ + TL+++GGKGLF +
Sbjct: 6   VGSRRSKLALT---QTKWVINELKQLGAPFTFEVKEIVTKGDRVLDVTLSKVGGKGLFVK 62

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE +L++G ID AVHS KDMP  L +GL I A   RED RDV +S   + L DL   SV
Sbjct: 63  EIEHELLAGGIDMAVHSMKDMPAVLPEGLVIGAVPRREDARDVLVSKGNRMLSDLPPGSV 122

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVI 185
           IGTSSLRR A LL +R D+++   RG I+TRL KL + +  AI+LA AG+ R+   + VI
Sbjct: 123 IGTSSLRRSAQLLAYRPDLTIKWIRGNIDTRLAKLESEEYDAIVLAAAGLARMGWGDDVI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L  +   P+ GQGA+ +E   ++ + ++ +  +N E T  +V  ERAFL +++G C+
Sbjct: 183 SDYLPFDVCVPAVGQGALAVECREDDDELRQWLSRLNDEQTERAVRAERAFLQQMEGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             IAG+A   G  +    +V + DGK  ++    G   D   +GR AA  +
Sbjct: 243 VPIAGYAEADGGMVRLTALVASPDGKEKYKEMVTG--ADPEAVGRQAAAVL 291


>gi|260771623|ref|ZP_05880543.1| porphobilinogen deaminase [Vibrio metschnikovii CIP 69.14]
 gi|260613400|gb|EEX38599.1| porphobilinogen deaminase [Vibrio metschnikovii CIP 69.14]
          Length = 312

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/303 (36%), Positives = 167/303 (55%), Gaps = 4/303 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIV-IIPLSTKGDRITNRTLTEIGGKGL 63
           P RI TR SPLAL  A   + +L   H   PH  V ++ + T+GD + +  L ++GGKGL
Sbjct: 6   PIRIATRQSPLALWQAHFVKDALQAAH---PHLAVELVTMVTRGDVLLDTPLAKVGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  ++ G  D AVHS KD+P     GL +     RED RD F+S+T  SL+ L  
Sbjct: 63  FVKELEVAMLEGRADLAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNTYHSLEALPH 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +++GT SLRR+  +   R DI + + RG + TRL KL+  +  AI+LA AG+KRLK E+
Sbjct: 123 GAIVGTCSLRRQCQIKAARPDIIIKELRGNVGTRLAKLDAGEFDAIVLAAAGLKRLKLEQ 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I   ++ E   P+ GQGA+ IE  +++ +   L++ +NH DT+D V CERA    L G 
Sbjct: 183 RIASFISPEQSLPAVGQGAVGIECRLDDQRLLTLLEPLNHADTYDRVICERAMNLTLQGG 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C+  I  +    G  ++   +V   DG         G R  A  +G + AQ +     ++
Sbjct: 243 CQVPIGSYTELDGEQIWLRALVGEPDGSRIIRGEIRGPRQQAERLGVELAQQLLDQGARD 302

Query: 304 VFN 306
           + N
Sbjct: 303 ILN 305


>gi|288940050|ref|YP_003442290.1| porphobilinogen deaminase [Allochromatium vinosum DSM 180]
 gi|288895422|gb|ADC61258.1| porphobilinogen deaminase [Allochromatium vinosum DSM 180]
          Length = 308

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 166/284 (58%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLA+  A    + L  +H  P   + II ++TKGD++ +  L+++GGKGLF 
Sbjct: 5   IRIATRKSPLAMWQAEHVTARLKALH--PGLTVEIIGMTTKGDQLLDSPLSKVGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E+ +++GE D AVHS KD+P +  +GL ++  + RE+  D F+S+T  +L +L   +
Sbjct: 63  KELEQGMLAGEADIAVHSMKDVPVEFPEGLHLAVIMERENPYDAFVSNTYANLAELPEGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+ RL  E  I
Sbjct: 123 CVGTSSLRRQCQLADRRPDLRIEPLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFESRI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           ++ ++  D  P+ GQGAI IE  V++ +  +L+  +   DT D V  ERA  A L+G C+
Sbjct: 183 RDCIDPVDSLPAIGQGAIGIECRVDDERVHQLIAPLADRDTTDRVLAERAMNARLNGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I G A   G  L   G+V  +DG        +G R +A  IG
Sbjct: 243 VPIGGHAVLDGDRLILKGLVGTTDGSRILRAEASGPRAEAEAIG 286


>gi|170680193|ref|YP_001746121.1| porphobilinogen deaminase [Escherichia coli SMS-3-5]
 gi|170517911|gb|ACB16089.1| porphobilinogen deaminase [Escherichia coli SMS-3-5]
          Length = 318

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+  +SL  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYESLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 299


>gi|87118400|ref|ZP_01074299.1| porphobilinogen deaminase [Marinomonas sp. MED121]
 gi|86166034|gb|EAQ67300.1| porphobilinogen deaminase [Marinomonas sp. MED121]
          Length = 308

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 168/289 (58%), Gaps = 2/289 (0%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           I TR S LAL  A   + SL  ++  P   + ++ ++TKGD+I N  L++IGGKGLF +E
Sbjct: 7   IATRESQLALWQANNVKDSLAALY--PDIQVELLGMTTKGDQILNSPLSKIGGKGLFVKE 64

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           +E  L+ G  D AVHS KD+P    +GL ++    RED  D F+S+   +L  L   +V+
Sbjct: 65  LEHALLDGRADIAVHSMKDVPMAFPEGLGLAVICEREDPTDAFVSNKYDNLASLPQGAVV 124

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSSLRR + L   R D+ + D RG + TRL KL+N +  AI+LA AG+ RL+    IKE
Sbjct: 125 GTSSLRRSSQLALARPDLVIKDLRGNVNTRLRKLDNQEYDAIILATAGLMRLEMTDRIKE 184

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
            ++ +D  P+ GQGA+ IE   ++    +L+  + H++T+  V  ERA    L+G C++ 
Sbjct: 185 RISDQDSLPAGGQGAMGIECRSDDADMIKLLAPLQHQETYYRVTAERAVNERLNGGCQAP 244

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           IA F+  +G  LY  G+V + DG         G++ DA  +G   A+ +
Sbjct: 245 IAAFSLLEGDELYLRGLVGSVDGSTILRDEIRGSKNDAHALGVQLAEKL 293


>gi|127511252|ref|YP_001092449.1| porphobilinogen deaminase [Shewanella loihica PV-4]
 gi|126636547|gb|ABO22190.1| porphobilinogen deaminase [Shewanella loihica PV-4]
          Length = 317

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 109/289 (37%), Positives = 166/289 (57%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L   H+     + ++P+STKGD I +  L ++GG
Sbjct: 9   MSQNVIRIATRKSPLAMWQAEFVKAELEKAHE--GLVVELLPMSTKGDVILDTPLAKVGG 66

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G+ D AVHS KD+P    +GL +     RED RD F+S+T +++++
Sbjct: 67  KGLFVKELEVAMLEGKADIAVHSMKDVPVDFPEGLGLQVICEREDPRDAFVSNTYKNIEE 126

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 127 LPQGAIVGTSSLRRQCQIRAARPDLEIRDLRGNVGTRLAKLDAGNYDAIILAAAGLKRLK 186

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++ ED  P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 187 LEDRIASFISAEDSLPANGQGAVGIECRTDDERVKALLAPLEHIETRYRVIAERAMNTRL 246

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A   G TL   G+V   DG      + +G + DA  +G
Sbjct: 247 EGGCQVPIGAYAEIDGDTLSLRGLVGNPDGSQVIRGTTSGAKQDAEQLG 295


>gi|21674248|ref|NP_662313.1| porphobilinogen deaminase [Chlorobium tepidum TLS]
 gi|25453021|sp|Q8KCJ4|HEM3_CHLTE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|21647416|gb|AAM72655.1| porphobilinogen deaminase [Chlorobium tepidum TLS]
          Length = 312

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 159/269 (59%), Gaps = 2/269 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   IGTR SPLAL  A  T++ L      P  NI +  + T GD + +  L++IG  G
Sbjct: 2   KKELIIGTRSSPLALWQAEFTKAEL--SRHFPELNITLKLVKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK L++ EID AVHS KD+PT   +GL IS++  RED RDV IS + + LKDL 
Sbjct: 60  LFTKDIEKHLLAKEIDLAVHSLKDVPTGTPEGLVISSFTKREDTRDVIISKSGKGLKDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            ++ + TSSLRR + LL  R D+ ++D RG + TR  K ++ +  A++LAYAG+ RL+  
Sbjct: 120 PNARMATSSLRRMSQLLSMRPDLQILDIRGNLNTRFKKFDDGEFDAMMLAYAGVYRLEFS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  +   P+ GQGA+ IET  ++ +  E+V+V+N  +T      ERA L  L G
Sbjct: 180 DRISEILPHDVMLPAVGQGALGIETRTDDAETIEIVRVMNDSNTEICCRAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK 271
            C+  I  +      TL     V + DGK
Sbjct: 240 GCQIPIGCYGSYISGTLKLLAFVGSVDGK 268


>gi|188996629|ref|YP_001930880.1| porphobilinogen deaminase [Sulfurihydrogenibium sp. YO3AOP1]
 gi|188931696|gb|ACD66326.1| porphobilinogen deaminase [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 310

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 166/270 (61%), Gaps = 3/270 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A      L ++H I    + ++ ++T+GD+I +  L +IGGKGLF 
Sbjct: 3   IRIGTRKSQLALWQANYIADRLREIHGI---EVELVKITTQGDKILDVPLAKIGGKGLFV 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L+  EID AVHS KD+PT L +GL++ A   RED RD F+S   +++  L  ++
Sbjct: 60  KEIEDALLRNEIDIAVHSLKDVPTVLPEGLELIAITEREDPRDAFLSIRYENIYQLPENT 119

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           VIGTSSLRRK+ +++ R D+ + D RG ++TR+ KL   +  AI+LAYAG+KRL  +  +
Sbjct: 120 VIGTSSLRRKSQIMKIRKDLQIKDLRGNVDTRIRKLEEGQYDAIILAYAGLKRLGLDSKV 179

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           K I + ++  P+  QG + IE   ++ + + L+K +NH +++     ER+FL  L+G C+
Sbjct: 180 KYIFSPDEMIPAVCQGFLAIEGRSDDERIKNLIKPLNHYESYLRATAERSFLKTLEGGCQ 239

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHE 275
             +  +   K ++    G +   +GK +++
Sbjct: 240 VPLGAYCEIKENSFIITGFIADLEGKEYYQ 269


>gi|238798585|ref|ZP_04642061.1| Porphobilinogen deaminase [Yersinia mollaretii ATCC 43969]
 gi|238717541|gb|EEQ09381.1| Porphobilinogen deaminase [Yersinia mollaretii ATCC 43969]
          Length = 313

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 159/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH DT   V  ERA    L
Sbjct: 179 LETRIRYAMPAEESLPAVGQGAVGIECRLDDDVTRQLLAPLNHRDTELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A   G  L+   +V A DG       R G   +A  +G
Sbjct: 239 EGGCQVPIGSYAELAGGELWLRALVGAPDGSEIIRGERRGPAENAEQMG 287


>gi|50083560|ref|YP_045070.1| porphobilinogen deaminase [Acinetobacter sp. ADP1]
 gi|55976395|sp|Q6FFA9|HEM3_ACIAD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|49529536|emb|CAG67248.1| porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Acinetobacter
           sp. ADP1]
          Length = 311

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 156/270 (57%), Gaps = 2/270 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  +I TR SPLAL  A   R  L  ++  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 7   QTLKIATRQSPLALWQAEHIRDRLQALY--PELKVELVKFVTQGDKILDTPLAKIGGKGL 64

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+   S   L L
Sbjct: 65  FVKELEAALLDGRADLAVHSMKDVPMHLPEGLSLAVICEREDPLDAFVSNHVMSFDQLPL 124

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK  +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL    
Sbjct: 125 GARVGTSSLRRKCQILKQRPDLEIIDLRGNVGTRLAKLDDGQYDAIVLASAGLKRLGLIS 184

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +N E   P+ GQGA+ +E   N+ K  +L+  + H+ T   V  ERAF A L+G 
Sbjct: 185 RIRHSINAEISLPAVGQGALGLECRANDKKILDLIAPLAHQPTSACVRAERAFNAYLEGG 244

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIF 273
           C+  IAGFA      L   G V + DGK  
Sbjct: 245 CQVPIAGFATLTQECLTLEGRVGSVDGKTL 274


>gi|308273123|emb|CBX29726.1| Porphobilinogen deaminase [uncultured Desulfobacterium sp.]
          Length = 323

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 123/309 (39%), Positives = 168/309 (54%), Gaps = 8/309 (2%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+   IGTR S LAL  A   +S L  V K    ++ +  + TKGDRI +  L ++GGKG
Sbjct: 17  KRKIIIGTRGSKLALWQAEWVKSYL--VQKFTDLSVELKIIKTKGDRILDVALAKVGGKG 74

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIE+ L    ID AVHS KDMP  L  GL I A   RE+ RDV IS     L  L 
Sbjct: 75  LFVKEIEQSLADSSIDIAVHSMKDMPADLHDGLCIGAIPERENPRDVLISGKGLLLSQLP 134

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +++GTSSLRR A + R R D+ +   RG ++TR+NKL   +  AI+LA AG+KRL  E
Sbjct: 135 EGALVGTSSLRRIAQIKRIRPDLVIAPLRGNLDTRINKLEMGEIDAIILAAAGVKRLGLE 194

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           K+I E LN +   P+ GQGA+CIE   ++      +  +NH  T   V  ERAFL  ++G
Sbjct: 195 KIITEYLNEDTMLPAVGQGALCIEIRKDDHDISGFINEMNHFVTRAVVLGERAFLKRIEG 254

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI------ 296
            C+  IAG+   +       G+V   DGK     ++ G+   + +IG   A  +      
Sbjct: 255 GCQVPIAGYGKVENDIFIIRGLVADPDGKTIITDTQRGSLESSESIGAALADRLISMGAK 314

Query: 297 RFISNKNVF 305
           R + N NV 
Sbjct: 315 RLLDNLNVL 323


>gi|152972793|ref|YP_001337939.1| porphobilinogen deaminase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|166217775|sp|A6TGI8|HEM3_KLEP7 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|150957642|gb|ABR79672.1| porphobilinogen deaminase [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
          Length = 313

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 164/289 (56%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLKVELVPMVTRGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     R+D RD F+S+   S+ +
Sbjct: 59  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNRYASIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+++   RG + TRL+KL+N +  AI+LA AG+KRL+
Sbjct: 119 LPAGSVVGTSSLRRQCQLAATRPDLAIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLQ 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   + L+  +NH +T   V  ERA    L
Sbjct: 179 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTRGLLAPLNHTETAVRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  K   L+   +V A DG       R G    A  +G
Sbjct: 239 EGGCQVPIGSYAELKDGELWLRALVGAPDGSQLVRGERRGPAEQAEALG 287


>gi|116053408|ref|YP_793733.1| porphobilinogen deaminase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|122256573|sp|Q02EA3|HEM3_PSEAB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|115588629|gb|ABJ14644.1| porphobilinogen deaminase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 313

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 158/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHSDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           +G C+  IA +A  +G  L+  G+V   DG
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDG 268


>gi|300939977|ref|ZP_07154605.1| porphobilinogen deaminase [Escherichia coli MS 21-1]
 gi|300455181|gb|EFK18674.1| porphobilinogen deaminase [Escherichia coli MS 21-1]
          Length = 320

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+  +SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYESLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|238892405|ref|YP_002917139.1| porphobilinogen deaminase [Klebsiella pneumoniae NTUH-K2044]
 gi|329997497|ref|ZP_08302799.1| hydroxymethylbilane synthase [Klebsiella sp. MS 92-3]
 gi|238544721|dbj|BAH61072.1| porphobilinogen deaminase [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|328539065|gb|EGF65104.1| hydroxymethylbilane synthase [Klebsiella sp. MS 92-3]
          Length = 318

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 164/289 (56%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLKVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     R+D RD F+S+   S+ +
Sbjct: 64  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPEGLGLVTICERDDPRDAFVSNRYASIDE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+++   RG + TRL+KL+N +  AI+LA AG+KRL+
Sbjct: 124 LPAGSVVGTSSLRRQCQLAATRPDLAIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLQ 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   + L+  +NH +T   V  ERA    L
Sbjct: 184 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTRGLLAPLNHTETAVRVRAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  K   L+   +V A DG       R G    A  +G
Sbjct: 244 EGGCQVPIGSYAELKDGELWLRALVGAPDGSQLVRGERRGPAEQAEALG 292


>gi|156935870|ref|YP_001439786.1| porphobilinogen deaminase [Cronobacter sakazakii ATCC BAA-894]
 gi|166217766|sp|A7MQJ1|HEM3_ENTS8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|156534124|gb|ABU78950.1| hypothetical protein ESA_03753 [Cronobacter sakazakii ATCC BAA-894]
          Length = 313

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 161/284 (56%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAQYVKQRLEACH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+  +SL ++   S
Sbjct: 64  KELELAMLDGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNQYKSLDEMPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  +   R D+ +   RG + TRL+KL+N    AI+LA AG+KRL+ +  I
Sbjct: 124 IVGTSSLRRQCQIAARRPDLIIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLQLDARI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L  E   P+ GQGA+ IE  +++ + +EL+  +NHE+T   V  ERA    L+G C+
Sbjct: 184 TSPLAPEISLPAVGQGAVGIECRLDDTRTRELLAPLNHEETAVRVRAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  +   L+   +V A DG       R G   DA  +G
Sbjct: 244 VPIGSYAELRDGELWLRALVGAPDGSRIVRGERRGAPEDARQLG 287


>gi|221633109|ref|YP_002522334.1| porphobilinogen deaminase [Thermomicrobium roseum DSM 5159]
 gi|221155998|gb|ACM05125.1| porphobilinogen deaminase [Thermomicrobium roseum DSM 5159]
          Length = 560

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/270 (38%), Positives = 160/270 (59%), Gaps = 3/270 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIG+R S LALA   E    L  +  +P  ++ ++P+ T GDR    +LT +GG G+F 
Sbjct: 5   IRIGSRGSTLALAQTEEVVERLRRL--VPECSVTVVPIVTTGDRDRATSLTVLGGSGVFA 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+ + L++G ID AVHSAKD+PT+L  GL + A L RED RDV ++   + L +L   +
Sbjct: 63  KELHEALLAGTIDLAVHSAKDLPTQLPPGLVLVAVLAREDARDVLVTSPPRKLGELPAGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSS RR+ALL R R D+ V+D RG ++TRL KL      A++L  AG++RL +  ++
Sbjct: 123 RVGTSSRRRQALLQRARPDLIVVDIRGNVDTRLRKLREGIVDALVLGAAGLRRLSQADLV 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E L+ ++F P+PGQGA+ +    ++ +  EL+  ++     ++V  ERAFLA     C 
Sbjct: 183 AEYLDPDEFVPAPGQGALAVVARESDGR-LELLSRLDEPLVHEAVAVERAFLAAFGSGCS 241

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHE 275
             +  +A   G+ L F   VL  DG+   +
Sbjct: 242 VPLGAYATIAGNRLRFRIAVLLPDGRFISQ 271


>gi|296392119|ref|ZP_06881594.1| porphobilinogen deaminase [Pseudomonas aeruginosa PAb1]
          Length = 313

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 158/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSALHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           +G C+  IA +A  +G  L+  G+V   DG
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDG 268


>gi|16767209|ref|NP_462824.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194449507|ref|YP_002047954.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|207859144|ref|YP_002245795.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|6960263|gb|AAF33453.1| 89% identity with E. coli porphobilinogen deaminase (HEMC)
           (SP:P06983); contains similarity to Pfam family PF01379
           (Porphobilinogen deaminase), score=627.8, E=6.2e-185,
           N=1 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16422502|gb|AAL22783.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194407811|gb|ACF68030.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|206710947|emb|CAR35314.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261249062|emb|CBG26922.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267996216|gb|ACY91101.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160454|emb|CBW19983.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|320088349|emb|CBY98109.1| Porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|323132286|gb|ADX19716.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|326625658|gb|EGE32003.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332990774|gb|AEF09757.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 318

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 158/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL DL   S
Sbjct: 69  KELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDDLPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L+G C+
Sbjct: 189 RTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G+   A  +G   A+ +
Sbjct: 249 VPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEEL 299


>gi|94987453|ref|YP_595386.1| porphobilinogen deaminase [Lawsonia intracellularis PHE/MN1-00]
 gi|123262097|sp|Q1MPL2|HEM3_LAWIP RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|94731702|emb|CAJ55065.1| Porphobilinogen deaminase [Lawsonia intracellularis PHE/MN1-00]
          Length = 309

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 162/287 (56%), Gaps = 3/287 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K   I TR S LA   A   +  L  ++     ++++I   TKGD I +  L ++GGKGL
Sbjct: 2   KKITIATRGSKLAFWQANYIKDQLQKMYSYLEVDLMVI--KTKGDHILDVPLAKVGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +EIE+ L+SGE DCAVHS KD+P +L   L ++A   RED  D+F+S     +K L  
Sbjct: 60  FVKEIEEALLSGEADCAVHSMKDVPMELPFELCLAAITEREDPTDMFLSIKYSGVKSLPE 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
           ++++GTSSLRR+A LL  R D+ +I  RG I+TRL KL   +  AI++A AGIKRL    
Sbjct: 120 NALVGTSSLRRQAQLLALRPDLQIIPLRGNIDTRLRKLMAEEFDAIIMATAGIKRLGLIA 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
                L      P+ GQGA+ IE         EL   +NH++T+  +  ER FLA LDG 
Sbjct: 180 PYMSSLPCSVMLPAVGQGALGIEVQKERQDVLELFSFLNHKETYHCIQAERDFLAGLDGG 239

Query: 244 CKSAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           C+  IAG+A  CK  T+   G+V  SDG +        +  DA +IG
Sbjct: 240 CQVPIAGYATICKQETICLEGLVAKSDGSVMIRNRLERSVSDAYDIG 286


>gi|239502040|ref|ZP_04661350.1| porphobilinogen deaminase [Acinetobacter baumannii AB900]
          Length = 309

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 167/291 (57%), Gaps = 2/291 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 6   KTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 63

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 64  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 123

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   +
Sbjct: 124 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLAE 183

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G 
Sbjct: 184 RIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEGG 243

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           C+  IAG+A  +   +Y  G V + DG+            +A  +G + A+
Sbjct: 244 CQVPIAGYATLQDGKIYIEGRVGSVDGQTLLRAELTDEANNAQQLGENLAR 294


>gi|260551059|ref|ZP_05825263.1| porphobilinogen deaminase [Acinetobacter sp. RUH2624]
 gi|260405826|gb|EEW99314.1| porphobilinogen deaminase [Acinetobacter sp. RUH2624]
          Length = 314

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 169/293 (57%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 11  KTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 68

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 69  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 128

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ ++D RG + TRL+KL++ +  AI+LA AG+KRL  E+
Sbjct: 129 GAKVGTSSLRRKSQILKQRPDLQIVDLRGNVGTRLSKLDDGQYDAIILASAGLKRLGLEE 188

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +      P+ GQGA+ +E   ++     L++ + H +T   V  ERAF A L+G 
Sbjct: 189 RIRHCIEPSVSLPAVGQGALGLECRADDQDVLALIQPLLHTETDVCVRAERAFNAYLEGG 248

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 249 CQVPIAGYATLQDGKIHIEGRVGSPDGQTLLRAELTDEAHNAQQLGENLARNL 301


>gi|194434066|ref|ZP_03066336.1| porphobilinogen deaminase [Shigella dysenteriae 1012]
 gi|194417724|gb|EDX33823.1| porphobilinogen deaminase [Shigella dysenteriae 1012]
 gi|320176046|gb|EFW51115.1| Porphobilinogen deaminase [Shigella dysenteriae CDC 74-1112]
          Length = 318

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 299


>gi|238789375|ref|ZP_04633161.1| Porphobilinogen deaminase [Yersinia frederiksenii ATCC 33641]
 gi|238722518|gb|EEQ14172.1| Porphobilinogen deaminase [Yersinia frederiksenii ATCC 33641]
          Length = 313

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 159/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQDLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSPNYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH +T   V  ERA    L
Sbjct: 179 LETRIRSAMPAEESLPAVGQGAVGIECRLDDDFTRQLLAPLNHRETELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G  L+   +V A DG       R G    A  +G
Sbjct: 239 EGGCQVPIGSYAELEGDILWLRALVGAPDGSEIIRGERRGPAQHAEQMG 287


>gi|15600453|ref|NP_253947.1| porphobilinogen deaminase [Pseudomonas aeruginosa PAO1]
 gi|107104362|ref|ZP_01368280.1| hypothetical protein PaerPA_01005437 [Pseudomonas aeruginosa PACS2]
 gi|218894362|ref|YP_002443232.1| porphobilinogen deaminase [Pseudomonas aeruginosa LESB58]
 gi|254243856|ref|ZP_04937178.1| porphobilinogen deaminase [Pseudomonas aeruginosa 2192]
 gi|12230932|sp|Q60169|HEM3_PSEAE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226740638|sp|B7V5F0|HEM3_PSEA8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|9951571|gb|AAG08645.1|AE004938_7 porphobilinogen deaminase [Pseudomonas aeruginosa PAO1]
 gi|126197234|gb|EAZ61297.1| porphobilinogen deaminase [Pseudomonas aeruginosa 2192]
 gi|218774591|emb|CAW30408.1| porphobilinogen deaminase [Pseudomonas aeruginosa LESB58]
          Length = 313

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 158/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           +G C+  IA +A  +G  L+  G+V   DG
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDG 268


>gi|205354497|ref|YP_002228298.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205274278|emb|CAR39298.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|326629631|gb|EGE35974.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 318

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 158/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL DL   S
Sbjct: 69  KELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDDLPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLEPRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L+G C+
Sbjct: 189 RTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G+   A  +G   A+ +
Sbjct: 249 VPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEEL 299


>gi|62182409|ref|YP_218826.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|167553883|ref|ZP_02347627.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168244626|ref|ZP_02669558.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168263173|ref|ZP_02685146.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168467648|ref|ZP_02701485.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194442426|ref|YP_002043172.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|197247501|ref|YP_002148864.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|213029666|ref|ZP_03344113.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213416718|ref|ZP_03349862.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213425401|ref|ZP_03358151.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213649584|ref|ZP_03379637.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213865139|ref|ZP_03387258.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|62130042|gb|AAX67745.1| porphobilinogen deaminase (hydroxymethylbilane synthase)
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|194401089|gb|ACF61311.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|195630016|gb|EDX48676.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197211204|gb|ACH48601.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|205321788|gb|EDZ09627.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205336530|gb|EDZ23294.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205348255|gb|EDZ34886.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|322716902|gb|EFZ08473.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 320

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 158/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL DL   S
Sbjct: 71  KELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDDLPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L+G C+
Sbjct: 191 RTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G+   A  +G   A+ +
Sbjct: 251 VPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEEL 301


>gi|113460193|ref|YP_718250.1| porphobilinogen deaminase [Haemophilus somnus 129PT]
 gi|170718229|ref|YP_001785251.1| porphobilinogen deaminase [Haemophilus somnus 2336]
 gi|123131907|sp|Q0I178|HEM3_HAES1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238058918|sp|B0UWZ8|HEM3_HAES2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|112822236|gb|ABI24325.1| hydroxymethylbilane synthase (porphobilinogen deaminase, PGB)
           [Haemophilus somnus 129PT]
 gi|168826358|gb|ACA31729.1| porphobilinogen deaminase [Haemophilus somnus 2336]
          Length = 321

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 156/262 (59%), Gaps = 2/262 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   ++ L    +    ++ ++P+ TKGD I +  L +IGGKGL
Sbjct: 5   KTLKIATRQSPLALWQANYVKNRLQ--QRYSHLSVELVPIITKGDVILDTPLAKIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L++GE D AVHS KD+P +  KGL++S   PRED RD F+S+  ++L +L  
Sbjct: 63  FVKELENALLNGEADIAVHSMKDVPMQFPKGLELSVICPREDPRDAFVSNKYRTLDELPQ 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +++GTSSLRR+  L  WR+D+ +   RG + TRLNKL+     AI+LA AG+ RL   +
Sbjct: 123 GAIVGTSSLRRQCQLKNWRADLDIRSLRGNVGTRLNKLDQGDYDAIILASAGLIRLGLTE 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  + I+   P+ GQGA+ IE  V++   Q L+  +  + T   V  ERA    L G 
Sbjct: 183 RIRSFIEIDTILPACGQGAVGIECRVDDRDVQSLLMPLADQTTTYCVLAERAMNFHLQGG 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIV 265
           C+  I  +A  + + LY  G+V
Sbjct: 243 CQVPIGAYAILENNQLYLRGLV 264


>gi|254238043|ref|ZP_04931366.1| porphobilinogen deaminase [Pseudomonas aeruginosa C3719]
 gi|126169974|gb|EAZ55485.1| porphobilinogen deaminase [Pseudomonas aeruginosa C3719]
          Length = 313

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 158/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           +G C+  IA +A  +G  L+  G+V   DG
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDG 268


>gi|325124236|gb|ADY83759.1| porphobilinogen deaminase [Acinetobacter calcoaceticus PHEA-2]
          Length = 309

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 110/293 (37%), Positives = 168/293 (57%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 6   KTLKIATRQSPLALWQAEHIRARLEELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 63

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  ++  DL  
Sbjct: 64  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNRFETFADLPQ 123

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL+  +  AI+LA AG+KRL   +
Sbjct: 124 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDEGQYDAIILASAGLKRLGLSE 183

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L  +   P+ GQGA+ +E    +     L++ + HE+T   V  ERAF A L+G 
Sbjct: 184 RIRHCLTPDISLPAVGQGALGLECRAVDQDVLALIQPLLHEETDVCVRAERAFNAYLEGG 243

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 244 CQVPIAGYATLQNGQIHIEGRVGSPDGQTLLRAELTDEANNAQQLGENLARNL 296


>gi|16762196|ref|NP_457813.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143685|ref|NP_807027.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415793|ref|YP_152868.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194734788|ref|YP_002116870.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197264899|ref|ZP_03164973.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197301061|ref|ZP_02663450.2| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197364723|ref|YP_002144360.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198243181|ref|YP_002217871.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205358019|ref|ZP_02574964.2| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205360118|ref|ZP_02834695.2| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|224585757|ref|YP_002639556.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238912944|ref|ZP_04656781.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289825622|ref|ZP_06544800.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|61225723|sp|P0A1Q8|HEM3_SALTY RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|61225724|sp|P0A1Q9|HEM3_SALTI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|81599707|sp|Q5PKL7|HEM3_SALPA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226706297|sp|B5FN93|HEM3_SALDC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238059000|sp|B5BIU8|HEM3_SALPK RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|238059001|sp|B4TNV3|HEM3_SALSV RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800257|sp|C0Q3B3|HEM3_SALPC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|25292188|pir||AD0920 porphobilinogen deaminase [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504500|emb|CAD09382.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139320|gb|AAO70887.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56130050|gb|AAV79556.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|194710290|gb|ACF89511.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197096200|emb|CAR61796.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197243154|gb|EDY25774.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288774|gb|EDY28149.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197937697|gb|ACH75030.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|205328154|gb|EDZ14918.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205340974|gb|EDZ27738.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|224470285|gb|ACN48115.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|312915057|dbj|BAJ39031.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321225457|gb|EFX50514.1| Porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322613018|gb|EFY09969.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617394|gb|EFY14294.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625614|gb|EFY22436.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322627037|gb|EFY23830.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631247|gb|EFY28010.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322638280|gb|EFY34979.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642784|gb|EFY39371.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646974|gb|EFY43476.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650361|gb|EFY46774.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322656348|gb|EFY52642.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657573|gb|EFY53843.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665984|gb|EFY62165.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322666723|gb|EFY62900.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322671034|gb|EFY67164.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322679259|gb|EFY75311.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681663|gb|EFY77690.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322686010|gb|EFY81998.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323192636|gb|EFZ77864.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196502|gb|EFZ81652.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203746|gb|EFZ88767.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323205379|gb|EFZ90353.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323210748|gb|EFZ95624.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215916|gb|EGA00649.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221409|gb|EGA05827.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227573|gb|EGA11729.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231758|gb|EGA15869.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323236173|gb|EGA20250.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239590|gb|EGA23638.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244314|gb|EGA28322.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249589|gb|EGA33501.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250319|gb|EGA34205.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256526|gb|EGA40257.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323259776|gb|EGA43409.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323265184|gb|EGA48682.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268387|gb|EGA51859.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 313

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 158/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL DL   S
Sbjct: 64  KELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDDLPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L+G C+
Sbjct: 184 RTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G+   A  +G   A+ +
Sbjct: 244 VPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEEL 294


>gi|261867394|ref|YP_003255316.1| porphobilinogen deaminase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261412726|gb|ACX82097.1| porphobilinogen deaminase [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 308

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 159/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  +I TR SPLAL  A   +  L  ++  P  N+ ++P+ TKGD I +  L +IGG
Sbjct: 1   MTQKSLKIATRQSPLALWQANYVKDLLQQLY--PDLNVELVPMVTKGDVILDSPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L++ E D AVHS KD+P +  +GL ++    RED RD F+S++ ++L +
Sbjct: 59  KGLFVKELENALLNKEADIAVHSMKDVPMQFPEGLGLAVICKREDPRDAFVSNSYRTLAE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+ RL 
Sbjct: 119 LPQGAVVGTSSLRRQCQLKTLRPDLEIRSLRGNVGTRLSKLDNGDYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   +++E   P+ GQGA+ IE   ++   Q+L+  +   +T   V  ERA    L
Sbjct: 179 LAERIASFIDVEQSLPAAGQGAVGIECRTDDVAVQQLLAPLADAETTSCVLAERAMNHHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            G C+  I G+A  + S LY   +V + DG
Sbjct: 239 QGGCQVPIGGYAVLRDSELYLRALVGSVDG 268


>gi|307140503|ref|ZP_07499859.1| porphobilinogen deaminase [Escherichia coli H736]
          Length = 318

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 299


>gi|49085204|gb|AAT51260.1| PA5260 [synthetic construct]
          Length = 314

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 158/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLEQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           +G C+  IA +A  +G  L+  G+V   DG
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDG 268


>gi|261345249|ref|ZP_05972893.1| hydroxymethylbilane synthase [Providencia rustigianii DSM 4541]
 gi|282566947|gb|EFB72482.1| hydroxymethylbilane synthase [Providencia rustigianii DSM 4541]
          Length = 314

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 162/265 (61%), Gaps = 2/265 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A+  ++ L  +H  P   + ++P+ TKGD I +  L ++GGKGLF 
Sbjct: 7   VRIATRKSPLALWQAYFVKAKLEQLH--PNLQVELVPMVTKGDIILDTPLAKVGGKGLFV 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++ +L   S
Sbjct: 65  KELELALLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYANIDELPAGS 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL+ ++ I
Sbjct: 125 IVGTSSLRRQCQLKELRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLELDERI 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           K  L  E   P+ GQGA+ IE  +++ + ++L+  +NH++T   V  ERA    L+G C+
Sbjct: 185 KTALEPELSLPAVGQGAVGIECRLDDQRTRDLLAKLNHDETSICVLAERAMNMRLEGGCQ 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDG 270
             I  +A  + + ++   +V A DG
Sbjct: 245 VPIGSYAIWQDNKIWLRALVGAPDG 269


>gi|193067963|ref|ZP_03048928.1| porphobilinogen deaminase [Escherichia coli E110019]
 gi|192958583|gb|EDV89021.1| porphobilinogen deaminase [Escherichia coli E110019]
          Length = 318

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 299


>gi|187733255|ref|YP_001882498.1| porphobilinogen deaminase [Shigella boydii CDC 3083-94]
 gi|187430247|gb|ACD09521.1| porphobilinogen deaminase [Shigella boydii CDC 3083-94]
          Length = 320

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMTSH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|238765355|ref|ZP_04626280.1| Porphobilinogen deaminase [Yersinia kristensenii ATCC 33638]
 gi|238696442|gb|EEP89234.1| Porphobilinogen deaminase [Yersinia kristensenii ATCC 33638]
          Length = 313

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 163/293 (55%), Gaps = 2/293 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELAMLDGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSSNYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  + HAI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDKGEYHAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH +T   V  ERA    L
Sbjct: 179 LETRIRYAMPAEESLPAVGQGAVGIECRLDDDYTRQLLAPLNHRETELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
           +G C+  I  +A   G+TL+   +V A DG       R G   +A  +G + A
Sbjct: 239 EGGCQVPIGSYAELDGNTLWLRALVGAPDGSEIIRGERRGPAENAEQMGVELA 291


>gi|329297028|ref|ZP_08254364.1| porphobilinogen deaminase [Plautia stali symbiont]
          Length = 313

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 159/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLNKIFRIATRQSPLALWQAQYVQQRLMAAH--PGLQVELMPMVTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P     GL +     RED RD F+S+   S+  
Sbjct: 59  KGLFVKELELAMLENRADMAVHSMKDVPVDFPDGLGLVTICEREDPRDAFVSNHYSSIDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ +   RG + TRL+KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAVVGTSSLRRQCQISARRPDLVIHSLRGNVGTRLSKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L  E   P+ GQGA+ IE  +++     L++ +NH DT   V  ERA    L
Sbjct: 179 LEDRIRQALPAEFSLPAVGQGAVGIECRLDDQPLITLLQALNHSDTAVCVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  FA  +   L+  G+V A DG       R G R  A  +G
Sbjct: 239 EGGCQVPIGSFAVLEDDQLWLRGLVGAPDGSQMVVGERRGPREQAEQMG 287


>gi|200388118|ref|ZP_03214730.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199605216|gb|EDZ03761.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
          Length = 320

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 158/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL DL   S
Sbjct: 71  KELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDDLPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L+G C+
Sbjct: 191 RTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G+   A  +G   A+ +
Sbjct: 251 VPIGSYAEIINGEIWLRALVGAPDGSVIVRGERRGSPEQAEQMGISLAEEL 301


>gi|187776117|ref|ZP_02800653.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4196]
 gi|188025006|ref|ZP_02775407.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4113]
 gi|189010242|ref|ZP_02805709.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4076]
 gi|189401833|ref|ZP_02778707.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4401]
 gi|189403100|ref|ZP_02793091.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4486]
 gi|189404376|ref|ZP_02788935.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4501]
 gi|189404861|ref|ZP_02811648.2| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC869]
 gi|208806069|ref|ZP_03248406.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4206]
 gi|208812922|ref|ZP_03254251.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4045]
 gi|208819553|ref|ZP_03259873.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4042]
 gi|209396873|ref|YP_002273321.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4115]
 gi|217324566|ref|ZP_03440650.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. TW14588]
 gi|261225578|ref|ZP_05939859.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255624|ref|ZP_05948157.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. FRIK966]
 gi|187768841|gb|EDU32685.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4196]
 gi|188015439|gb|EDU53561.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4113]
 gi|189001539|gb|EDU70525.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4076]
 gi|189359021|gb|EDU77440.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4401]
 gi|189362764|gb|EDU81183.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4486]
 gi|189365984|gb|EDU84400.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4501]
 gi|189373238|gb|EDU91654.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC869]
 gi|208725870|gb|EDZ75471.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4206]
 gi|208734199|gb|EDZ82886.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4045]
 gi|208739676|gb|EDZ87358.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4042]
 gi|209158273|gb|ACI35706.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4115]
 gi|217320787|gb|EEC29211.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. TW14588]
 gi|320191103|gb|EFW65753.1| Porphobilinogen deaminase [Escherichia coli O157:H7 str. EC1212]
 gi|320666093|gb|EFX33107.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. LSU-61]
 gi|326344260|gb|EGD68020.1| Porphobilinogen deaminase [Escherichia coli O157:H7 str. 1125]
 gi|326347912|gb|EGD71626.1| Porphobilinogen deaminase [Escherichia coli O157:H7 str. 1044]
          Length = 318

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 299


>gi|147677307|ref|YP_001211522.1| porphobilinogen deaminase [Pelotomaculum thermopropionicum SI]
 gi|189028095|sp|A5D3L5|HEM3_PELTS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|146273404|dbj|BAF59153.1| porphobilinogen deaminase [Pelotomaculum thermopropionicum SI]
          Length = 312

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 166/294 (56%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+   +GTR S LA+  A      L ++   P  +  I+ + T GDRI +  L +IG KG
Sbjct: 2   KREIAVGTRVSKLAMWQARWVVDRLKEL--CPGCSFRIVGIRTLGDRILDAALVKIGDKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+E+E  ++ GEID AVHS KD+PT+L +GL I A   RE   DV +S   + L +L 
Sbjct: 60  LFTKELEAAMLRGEIDMAVHSMKDLPTELPEGLVIGAVCKREHPADVLVSRRGKKLDELP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +++GTSSLRR A LL +R D+ +++ RG I TRL KL      A +LAYAG+ R+ ++
Sbjct: 120 GGALVGTSSLRRCAQLLWYRDDLRMVNLRGNINTRLRKLEEENLDAAVLAYAGLFRMGRQ 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I +++  +   P+ GQG+I +E   ++ +  ELVK I+H ++  +V  ERAFL  L+G
Sbjct: 180 DAITQVIPFDICLPAVGQGSIGVEVRSDDGEVLELVKKIDHRESRLAVFAERAFLRRLEG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  +      +   L   G+V   DGK        GN  DA  IG   A+ +
Sbjct: 240 GCQVPVGALGTVENDRLRLEGVVATPDGKQLVRSFVEGNGGDAAAIGLRLAEKL 293


>gi|126653692|ref|ZP_01725611.1| porphobilinogen deaminase [Bacillus sp. B14905]
 gi|126589729|gb|EAZ83864.1| porphobilinogen deaminase [Bacillus sp. B14905]
          Length = 310

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 117/301 (38%), Positives = 167/301 (55%), Gaps = 8/301 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           +G+R S LAL       + L       P    +  + TKGD+I +  L+++GGKGLF +E
Sbjct: 6   VGSRRSKLALTQTNWFINELKAAG--APFEFEVKEIVTKGDQILDVQLSKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L   EID AVHS KDMP  L +GL I    PRED RD FIS       DL   +V+
Sbjct: 64  IEQALYDKEIDFAVHSMKDMPAVLPEGLVIGCIPPREDARDAFISKGHVKFADLPAGAVV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVIK 186
           GTSSLRR A LL  R D+ +   RG ++TRL KL   +  AI+LA AG+KRL   E V+ 
Sbjct: 124 GTSSLRRSAQLLTVRPDLEIKWIRGNVDTRLAKLETEEYDAIILAAAGLKRLGWSEDVVT 183

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E L++ED  P+  QG++ IE   ++ +    +  +  + TW   + ERAFLA +DG C+ 
Sbjct: 184 EFLSVEDCLPAVAQGSLGIECRGDDTELLAELAKLTDQLTWQEAHAERAFLAAMDGGCQV 243

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
            IAG+A   G  +   G+V A D  + ++ +  G+  DA  IG + A     ++ +  F+
Sbjct: 244 PIAGYATSNGDEITLTGLVAAPDASVVYKETVVGS--DAQKIGEELAT---ILTKQGAFD 298

Query: 307 F 307
            
Sbjct: 299 L 299


>gi|238897905|ref|YP_002923584.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|259647800|sp|C4K4E3|HEM3_HAMD5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|229465662|gb|ACQ67436.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 309

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 160/293 (54%), Gaps = 2/293 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     R+ TR SPLAL  A   ++ L   H  P   ++++P+ T+GD I    L++ GG
Sbjct: 1   MSNNMIRLATRQSPLALWQAHYVKTGLEFFH--PDLKVILLPMVTQGDNILGTALSKTGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++    D AVHS KDMP    +GL + A   RED RD F+S     +  
Sbjct: 59  KGLFVKELERAVLDNRADIAVHSIKDMPLYFPEGLGLVAVCEREDPRDAFLSLRYHDVAQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L +    I V D RG +  RL KL+     AI+LA AG+KRL 
Sbjct: 119 LPEGSVVGTSSLRRQCQLYKNYPGIVVRDLRGNVGARLKKLDQGDYDAIVLAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  + +IL  E   P+ GQGAI IE  +++    + V  +NH  +   ++CERA L  L
Sbjct: 179 LENRMTQILRPETSLPAAGQGAIGIECRLDDTVTLQRVATLNHRPSQLKISCERALLKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
           +G C++ I  +A  +   L+    V A DG++  +  R GN   A  IG + A
Sbjct: 239 EGGCQTPIGSYAEIENDELWLRAFVGAPDGQLIIDGERRGNFDSAEKIGFELA 291


>gi|331660148|ref|ZP_08361084.1| hydroxymethylbilane synthase [Escherichia coli TA206]
 gi|320185465|gb|EFW60234.1| Porphobilinogen deaminase [Shigella flexneri CDC 796-83]
 gi|331052716|gb|EGI24751.1| hydroxymethylbilane synthase [Escherichia coli TA206]
 gi|332084681|gb|EGI89869.1| porphobilinogen deaminase [Shigella boydii 5216-82]
 gi|332084931|gb|EGI90113.1| porphobilinogen deaminase [Shigella dysenteriae 155-74]
          Length = 313

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|82546156|ref|YP_410103.1| porphobilinogen deaminase [Shigella boydii Sb227]
 gi|300904058|ref|ZP_07121938.1| porphobilinogen deaminase [Escherichia coli MS 84-1]
 gi|301303699|ref|ZP_07209820.1| porphobilinogen deaminase [Escherichia coli MS 124-1]
 gi|81247567|gb|ABB68275.1| porphobilinogen deaminase [Shigella boydii Sb227]
 gi|300403938|gb|EFJ87476.1| porphobilinogen deaminase [Escherichia coli MS 84-1]
 gi|300840999|gb|EFK68759.1| porphobilinogen deaminase [Escherichia coli MS 124-1]
 gi|315254168|gb|EFU34136.1| porphobilinogen deaminase [Escherichia coli MS 85-1]
 gi|315296783|gb|EFU56075.1| porphobilinogen deaminase [Escherichia coli MS 16-3]
          Length = 320

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|332998254|gb|EGK17856.1| porphobilinogen deaminase [Shigella flexneri K-272]
 gi|333013794|gb|EGK33157.1| porphobilinogen deaminase [Shigella flexneri K-227]
          Length = 313

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|157163278|ref|YP_001460596.1| porphobilinogen deaminase [Escherichia coli HS]
 gi|170022172|ref|YP_001727126.1| porphobilinogen deaminase [Escherichia coli ATCC 8739]
 gi|188494806|ref|ZP_03002076.1| porphobilinogen deaminase [Escherichia coli 53638]
 gi|254039017|ref|ZP_04873068.1| porphobilinogen deaminase [Escherichia sp. 1_1_43]
 gi|300950432|ref|ZP_07164354.1| porphobilinogen deaminase [Escherichia coli MS 116-1]
 gi|300955191|ref|ZP_07167588.1| porphobilinogen deaminase [Escherichia coli MS 175-1]
 gi|301646129|ref|ZP_07246029.1| porphobilinogen deaminase [Escherichia coli MS 146-1]
 gi|331644538|ref|ZP_08345658.1| hydroxymethylbilane synthase [Escherichia coli H736]
 gi|157068958|gb|ABV08213.1| porphobilinogen deaminase [Escherichia coli HS]
 gi|169757100|gb|ACA79799.1| porphobilinogen deaminase [Escherichia coli ATCC 8739]
 gi|188490005|gb|EDU65108.1| porphobilinogen deaminase [Escherichia coli 53638]
 gi|226838708|gb|EEH70736.1| porphobilinogen deaminase [Escherichia sp. 1_1_43]
 gi|260451352|gb|ACX41774.1| porphobilinogen deaminase [Escherichia coli DH1]
 gi|300317908|gb|EFJ67692.1| porphobilinogen deaminase [Escherichia coli MS 175-1]
 gi|300450239|gb|EFK13859.1| porphobilinogen deaminase [Escherichia coli MS 116-1]
 gi|301075655|gb|EFK90461.1| porphobilinogen deaminase [Escherichia coli MS 146-1]
 gi|315138381|dbj|BAJ45540.1| porphobilinogen deaminase [Escherichia coli DH1]
 gi|331036210|gb|EGI08445.1| hydroxymethylbilane synthase [Escherichia coli H736]
          Length = 320

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|49176416|ref|YP_026260.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89110215|ref|AP_003995.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           W3110]
 gi|170083288|ref|YP_001732608.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238902882|ref|YP_002928678.1| hydroxymethylbilane synthase [Escherichia coli BW2952]
 gi|256026151|ref|ZP_05440016.1| porphobilinogen deaminase [Escherichia sp. 4_1_40B]
 gi|312971913|ref|ZP_07786087.1| porphobilinogen deaminase [Escherichia coli 1827-70]
 gi|2506504|sp|P06983|HEM3_ECOLI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|229836108|sp|B1XAH2|HEM3_ECODH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|259647795|sp|C4ZZ69|HEM3_ECOBW RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|4388845|pdb|2YPN|A Chain A, Hydroxymethylbilane Synthase
 gi|28373294|pdb|1GTK|A Chain A, Time-Resolved And Static-Ensemble Structural Chemistry Of
           Hydroxymethylbilane Synthase
 gi|41666|emb|CAA31132.1| unnamed protein product [Escherichia coli]
 gi|48994974|gb|AAT48218.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85676246|dbj|BAE77496.1| hydroxymethylbilane synthase [Escherichia coli str. K12 substr.
           W3110]
 gi|169891123|gb|ACB04830.1| hydroxymethylbilane synthase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238861470|gb|ACR63468.1| hydroxymethylbilane synthase [Escherichia coli BW2952]
 gi|309704240|emb|CBJ03588.1| porphobilinogen deaminase [Escherichia coli ETEC H10407]
 gi|310334290|gb|EFQ00495.1| porphobilinogen deaminase [Escherichia coli 1827-70]
 gi|315618498|gb|EFU99084.1| porphobilinogen deaminase [Escherichia coli 3431]
 gi|323934193|gb|EGB30624.1| porphobilinogen deaminase [Escherichia coli E1520]
 gi|323938941|gb|EGB35160.1| porphobilinogen deaminase [Escherichia coli E482]
 gi|332345783|gb|AEE59117.1| porphobilinogen deaminase HemC [Escherichia coli UMNK88]
          Length = 313

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|168801133|ref|ZP_02826140.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC508]
 gi|195938092|ref|ZP_03083474.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC4024]
 gi|218707439|ref|YP_002414958.1| porphobilinogen deaminase [Escherichia coli UMN026]
 gi|254795801|ref|YP_003080638.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. TW14359]
 gi|293413246|ref|ZP_06655908.1| porphobilinogen deaminase [Escherichia coli B354]
 gi|298383172|ref|ZP_06992766.1| hydroxymethylbilane synthase [Escherichia coli FVEC1302]
 gi|331665450|ref|ZP_08366349.1| hydroxymethylbilane synthase [Escherichia coli TA143]
 gi|23821693|sp|Q8XAP3|HEM3_ECO57 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226740636|sp|B7NFA7|HEM3_ECOLU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189376679|gb|EDU95095.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. EC508]
 gi|218434536|emb|CAR15462.1| hydroxymethylbilane synthase [Escherichia coli UMN026]
 gi|254595201|gb|ACT74562.1| hydroxymethylbilane synthase [Escherichia coli O157:H7 str.
           TW14359]
 gi|284923908|emb|CBG37007.1| porphobilinogen deaminase [Escherichia coli 042]
 gi|291468194|gb|EFF10691.1| porphobilinogen deaminase [Escherichia coli B354]
 gi|298276408|gb|EFI17927.1| hydroxymethylbilane synthase [Escherichia coli FVEC1302]
 gi|320639287|gb|EFX08909.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. G5101]
 gi|320644672|gb|EFX13722.1| porphobilinogen deaminase [Escherichia coli O157:H- str. 493-89]
 gi|320649997|gb|EFX18500.1| porphobilinogen deaminase [Escherichia coli O157:H- str. H 2687]
 gi|320655343|gb|EFX23285.1| porphobilinogen deaminase [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|323974386|gb|EGB69514.1| porphobilinogen deaminase [Escherichia coli TW10509]
 gi|331057348|gb|EGI29337.1| hydroxymethylbilane synthase [Escherichia coli TA143]
          Length = 313

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|15804393|ref|NP_290433.1| porphobilinogen deaminase [Escherichia coli O157:H7 EDL933]
 gi|15833989|ref|NP_312762.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. Sakai]
 gi|300900647|ref|ZP_07118805.1| porphobilinogen deaminase [Escherichia coli MS 198-1]
 gi|301025752|ref|ZP_07189267.1| porphobilinogen deaminase [Escherichia coli MS 69-1]
 gi|331655487|ref|ZP_08356480.1| hydroxymethylbilane synthase [Escherichia coli M718]
 gi|331675273|ref|ZP_08376024.1| hydroxymethylbilane synthase [Escherichia coli TA280]
 gi|12518669|gb|AAG58997.1|AE005611_7 porphobilinogen deaminase = hydroxymethylbilane synthase
           [Escherichia coli O157:H7 str. EDL933]
 gi|13364211|dbj|BAB38158.1| porphobilinogen deaminase [Escherichia coli O157:H7 str. Sakai]
 gi|209753308|gb|ACI74961.1| adenylate cyclase [Escherichia coli]
 gi|209753310|gb|ACI74962.1| adenylate cyclase [Escherichia coli]
 gi|209753312|gb|ACI74963.1| adenylate cyclase [Escherichia coli]
 gi|209753316|gb|ACI74965.1| adenylate cyclase [Escherichia coli]
 gi|300355863|gb|EFJ71733.1| porphobilinogen deaminase [Escherichia coli MS 198-1]
 gi|300395875|gb|EFJ79413.1| porphobilinogen deaminase [Escherichia coli MS 69-1]
 gi|320660969|gb|EFX28412.1| porphobilinogen deaminase [Escherichia coli O55:H7 str. USDA 5905]
 gi|331046808|gb|EGI18892.1| hydroxymethylbilane synthase [Escherichia coli M718]
 gi|331067559|gb|EGI38963.1| hydroxymethylbilane synthase [Escherichia coli TA280]
          Length = 320

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|237727921|ref|ZP_04558402.1| porphobilinogen deaminase [Citrobacter sp. 30_2]
 gi|226910370|gb|EEH96288.1| porphobilinogen deaminase [Citrobacter sp. 30_2]
          Length = 318

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDALMANH--PGLIVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +   GL +     RED RD F+S+   SL +L   S
Sbjct: 69  KELEVALLEKRADIAVHSMKDVPVEFPDGLGLVTICEREDPRDAFVSNKYNSLDELPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L + R D+ +   RG + TRL+KL+N    AI+LA AG+KRL  E  +
Sbjct: 129 IVGTSSLRRQCQLAKRRPDLVIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLGLESRV 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + Q L+  +NHE+T   V  ERA    L+G C+
Sbjct: 189 RTALPPEVSLPAVGQGAVGIECRLDDMRTQALLAPLNHEETALRVKAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAEIIDGEIWLRALVGAPDGSQMVCGERRGATQDAEQMGISLAEEL 299


>gi|152983553|ref|YP_001351322.1| porphobilinogen deaminase [Pseudomonas aeruginosa PA7]
 gi|167008817|sp|A6VE37|HEM3_PSEA7 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|150958711|gb|ABR80736.1| porphobilinogen deaminase [Pseudomonas aeruginosa PA7]
          Length = 313

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 156/270 (57%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P++++GD++ +  L +IGG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVKARLEQAH--PDLTVTLLPMTSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  ++++D  P+ GQGA+ IE    +     L+  ++H DT   V  ERA    L
Sbjct: 179 FESRIRSSISVDDSLPAGGQGAVGIECRTADADLHALLAPLHHADTALRVTAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           +G C+  IA +A  +G  L+  G+V   DG
Sbjct: 239 NGGCQVPIACYAIREGDQLWLRGLVGQPDG 268


>gi|58617102|ref|YP_196301.1| porphobilinogen deaminase [Ehrlichia ruminantium str. Gardel]
 gi|58416714|emb|CAI27827.1| Porphobilinogen deaminase [Ehrlichia ruminantium str. Gardel]
          Length = 299

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 171/296 (57%), Gaps = 9/296 (3%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M      +GTR S LA+A A + +  L +    P  N+ I+ + T GD     +L+EIGG
Sbjct: 1   MNSMNVYLGTRGSILAIAQAMKVKKLLYNYF--PDINVQIVHIVTSGDINDKISLSEIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L++G ID AVHS KD+P      L I   L R    DVFIS   QSL+ 
Sbjct: 59  KGLFLKELEEALLTGTIDLAVHSMKDVPAFYCDSLVIPCILKRSSPYDVFISSKYQSLRS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L  ++VIGTSS+RRK  L+R  S + V+  RG ++TR+ KL   +   I+LA AG+ R+ 
Sbjct: 119 LPDNAVIGTSSIRRKVQLMRLLSSVQVVPIRGNVDTRILKLEAGQYDGIILAKAGLMRIN 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           K  VIKE+L+ +    + GQGAI I+   N+ K  +++K++N + ++ SV  ER+F+  +
Sbjct: 179 KTHVIKEVLDPQVMLSAVGQGAIGIQCRANDYKMIDMIKILNCKKSYISVAAERSFMKTV 238

Query: 241 DGSCKSAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDA----INIGRD 291
           +GSC + +A  A Y    TLY   ++   +  +F +     N CDA    IN+G D
Sbjct: 239 NGSCDTPLAALAKYVNSDTLYMSCMLSNEEKTVFSDCYF--NECDAEISGINMGND 292


>gi|27117223|emb|CAD48146.1| porphobilinogen deaminase [Bacillus megaterium]
          Length = 310

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 120/292 (41%), Positives = 169/292 (57%), Gaps = 8/292 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIP-PHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +G+R S LAL    +T+  +  + K   P    I  + TKGD+I N TL+++GGKGLF +
Sbjct: 6   VGSRRSKLALT---QTKWVIEQLKKQGLPFEFEIKEMVTKGDQILNVTLSKVGGKGLFVK 62

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE+ ++  EID AVHS KDMP  L +GL I     RED RD  IS   +  ++L   +V
Sbjct: 63  EIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAV 122

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK-VI 185
           IGTSSLRR A LL  RSDI +   RG I+TRL KL N    AI+LA AG+ R+   K  +
Sbjct: 123 IGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTV 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L  E   P+ GQGA+ IE   N+ +   L++ +NH++T  +V  ER FL E++G C+
Sbjct: 183 TQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQ 242

Query: 246 SAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             IAG+     G  +    +V + DGK  ++    G   D I IG +AA+ +
Sbjct: 243 VPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGK--DPIAIGSEAAERL 292


>gi|302381524|ref|YP_003817347.1| porphobilinogen deaminase [Brevundimonas subvibrioides ATCC 15264]
 gi|302192152|gb|ADK99723.1| porphobilinogen deaminase [Brevundimonas subvibrioides ATCC 15264]
          Length = 315

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 154/265 (58%), Gaps = 1/265 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LALA +   + ++    ++P   +V++ + T GD+I +R L E+GGK LFT
Sbjct: 4   IRIGTRRSALALAQSGMMQRAIAAAMQLPIEEVVLVEIVTTGDQIQDRRLMEVGGKALFT 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G +D AVHS KD+P +   GL I+A   RED RD FIS     L+ L    
Sbjct: 64  KEIEEALLDGRVDIAVHSMKDVPAEQPPGLTIAAIPEREDARDAFISRDFDELEHLPHGG 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GT+SLRR+A  L  R D+ +   RG I+TRL +       AILLA +G+ RL +   +
Sbjct: 124 RLGTASLRRQAQALALRPDLQIEMLRGNIDTRLRRAAEGDFDAILLAASGLNRLGRSDAV 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+++ F P+PGQGA+ ++T   +      V+ +NH  T   V  ER  +  L+GSC+
Sbjct: 184 RGFLSVDAFLPAPGQGALALQTREGDTD-HAWVQAMNHGPTALCVAAERGAMVALEGSCR 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDG 270
           +A+   A+  G  L     +LA DG
Sbjct: 243 TAVGAHAHIDGDRLTLTTEMLAPDG 267


>gi|268592915|ref|ZP_06127136.1| hydroxymethylbilane synthase [Providencia rettgeri DSM 1131]
 gi|291311707|gb|EFE52160.1| hydroxymethylbilane synthase [Providencia rettgeri DSM 1131]
          Length = 314

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 165/291 (56%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L  +H  P   + ++P+ TKGD I +  L ++GGKGLF 
Sbjct: 7   VRIATRKSPLALWQAHFVKDKLEQLH--PGLLVELVPMVTKGDIILDTPLAKVGGKGLFV 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +  +GL +     RED RD F+S+   +L+ L   S
Sbjct: 65  KELELALLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYDNLEALPEGS 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 125 IVGTSSLRRQCQLRELRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLETRI 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           K  L  E   P+ GQGA+ IE  +N+ K +EL+  +N++ T   V  ERA    L+G C+
Sbjct: 185 KTALAPEQCLPAVGQGAVGIECRLNDSKTRELLAKLNNDATSTCVLAERAMNMRLEGGCQ 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A  +   ++   +V A DG +     R  +  +A   G   A+ +
Sbjct: 245 VPIGSYAIWQDDKIWLRALVGAPDGSVIIRGERRVSPSEANQAGVSLAEEL 295


>gi|110807507|ref|YP_691027.1| porphobilinogen deaminase [Shigella flexneri 5 str. 8401]
 gi|110617055|gb|ABF05722.1| porphobilinogen deaminase [Shigella flexneri 5 str. 8401]
 gi|281603194|gb|ADA76178.1| Porphobilinogen deaminase [Shigella flexneri 2002017]
          Length = 320

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLCALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|238760184|ref|ZP_04621331.1| Porphobilinogen deaminase [Yersinia aldovae ATCC 35236]
 gi|238701620|gb|EEP94190.1| Porphobilinogen deaminase [Yersinia aldovae ATCC 35236]
          Length = 313

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 158/289 (54%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P     GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIAFPDGLGLVTICERDDPRDAFVSSHFAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  + HAI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLVIRDLRGNVGTRLAKLDKGEYHAIILAVAGLNRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH DT   V  ERA    L
Sbjct: 179 LETRIRYAMPAEESLPAVGQGAVGIECRLDDDFTRQLLAPLNHRDTELRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A   G TL+   +V A DG       R G   +A  +G
Sbjct: 239 EGGCQVPIGSYAELDGDTLWLRALVGAPDGSEIIRGERRGPVANAEQMG 287


>gi|169829410|ref|YP_001699568.1| porphobilinogen deaminase [Lysinibacillus sphaericus C3-41]
 gi|238058924|sp|B1HVD6|HEM3_LYSSC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|168993898|gb|ACA41438.1| Porphobilinogen deaminase [Lysinibacillus sphaericus C3-41]
          Length = 310

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 116/301 (38%), Positives = 168/301 (55%), Gaps = 8/301 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           +G+R S LAL       + L       P    +  + TKGD+I +  L+++GGKGLF +E
Sbjct: 6   VGSRRSKLALTQTNWFINELKAAG--APFEFEVKEIVTKGDQILDVQLSKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L   EID AVHS KDMP  L +GL I    PRED RD FIS       +L   +V+
Sbjct: 64  IEQALYEKEIDFAVHSMKDMPAVLPEGLVIGCIPPREDARDAFISKGHVKFSELPAGAVV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVIK 186
           GTSSLRR A LL  R D+ +   RG ++TRL KL   +  AI+LA AG+KRL   E V+ 
Sbjct: 124 GTSSLRRSAQLLTVRPDLEIKWIRGNVDTRLAKLETEEYDAIILAAAGLKRLGWSEDVVT 183

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E L++ED  P+  QG++ IE   ++ +  + +  +  + TW   + ERAFLA +DG C+ 
Sbjct: 184 EFLSVEDCLPAVAQGSLGIECREDDTELLDELAKLTDQLTWQEAHAERAFLAAMDGGCQV 243

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
            IAG+A   G  +   G+V A D  + ++ +  G+  DA  IG + A     ++ +  F+
Sbjct: 244 PIAGYATSNGEEITLTGLVAAPDASVVYKETVVGS--DAQKIGEELAT---ILTKQGAFD 298

Query: 307 F 307
            
Sbjct: 299 L 299


>gi|30064902|ref|NP_839073.1| porphobilinogen deaminase [Shigella flexneri 2a str. 2457T]
 gi|56480439|ref|NP_709607.2| porphobilinogen deaminase [Shigella flexneri 2a str. 301]
 gi|61213578|sp|Q83PH4|HEM3_SHIFL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|30043162|gb|AAP18884.1| porphobilinogen deaminase, hydroxymethylbilane synthase [Shigella
           flexneri 2a str. 2457T]
 gi|56383990|gb|AAN45314.2| porphobilinogen deaminase, hydroxymethylbilane synthase [Shigella
           flexneri 2a str. 301]
 gi|313647157|gb|EFS11612.1| porphobilinogen deaminase [Shigella flexneri 2a str. 2457T]
 gi|332751946|gb|EGJ82341.1| porphobilinogen deaminase [Shigella flexneri 2747-71]
 gi|332996995|gb|EGK16613.1| porphobilinogen deaminase [Shigella flexneri VA-6]
 gi|332997894|gb|EGK17501.1| porphobilinogen deaminase [Shigella flexneri K-218]
 gi|333019501|gb|EGK38782.1| porphobilinogen deaminase [Shigella flexneri K-304]
          Length = 313

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLCALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|293393888|ref|ZP_06638195.1| hydroxymethylbilane synthase [Serratia odorifera DSM 4582]
 gi|291423715|gb|EFE96937.1| hydroxymethylbilane synthase [Serratia odorifera DSM 4582]
          Length = 313

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 118/305 (38%), Positives = 171/305 (56%), Gaps = 2/305 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQQRLMASH--PDLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P +   GL +     R+D RD F+S+   SL  
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPVEFPAGLGLVTICERDDPRDAFVSNRFASLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L + R D+ V D RG + TRL KL+N    AI+LA AG+KRL 
Sbjct: 119 LPQGSVVGTSSLRRQCQLRQRRPDLLVRDLRGNVGTRLAKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  ++ E+  P+ GQGA+ IE  +++   + L+  +NHE T   V  ERA    L
Sbjct: 179 LEQRIRSPMSPEESLPAVGQGAVGIECRLDDAVTRALLAPLNHELTATRVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A   G TL+   +V A DG +     R G    A ++G + A+ +    
Sbjct: 239 EGGCQVPIGSYAELDGDTLWLRALVGAPDGSLMVRGERRGPAAQAEHMGIELAEELLAKG 298

Query: 301 NKNVF 305
            +++ 
Sbjct: 299 ARDIL 303


>gi|293407432|ref|ZP_06651352.1| porphobilinogen deaminase [Escherichia coli FVEC1412]
 gi|291425543|gb|EFE98581.1| porphobilinogen deaminase [Escherichia coli FVEC1412]
          Length = 313

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESHI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|82779017|ref|YP_405366.1| porphobilinogen deaminase [Shigella dysenteriae Sd197]
 gi|81243165|gb|ABB63875.1| porphobilinogen deaminase [Shigella dysenteriae Sd197]
          Length = 320

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDARTRELLVALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|114561627|ref|YP_749140.1| porphobilinogen deaminase [Shewanella frigidimarina NCIMB 400]
 gi|122300909|sp|Q088L3|HEM3_SHEFN RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|114332920|gb|ABI70302.1| porphobilinogen deaminase [Shewanella frigidimarina NCIMB 400]
          Length = 309

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 171/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L +IGG
Sbjct: 1   MSENIIRIATRKSPLAMWQAEFVKAELERIH--PGLTVELLPMSTKGDVILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P +  +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLENRADIAVHSMKDLPVEFPEGLGLQVICEREDPRDAFVSNNYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL++    AI+LA AG+ RLK
Sbjct: 119 LPQGAVVGTSSLRRQCQIRAARPDLVIKDLRGNVGTRLAKLDSGDYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LNERIANFISAEESLPANGQGAVGIECRTDDARVKALLAPLEHLETRYRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  L   G+V   DG      + +G++ DA+ +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEINGDNLTLRGLVGNPDGSQIIIGTVSGSKTDAVALGESLAEDLLSRG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|320178095|gb|EFW53075.1| Porphobilinogen deaminase [Shigella boydii ATCC 9905]
          Length = 559

 Score =  196 bits (497), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 158/284 (55%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A      ++   +V A DG       R G   DA  +G
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMG 287


>gi|317046390|ref|YP_004114038.1| porphobilinogen deaminase [Pantoea sp. At-9b]
 gi|316948007|gb|ADU67482.1| porphobilinogen deaminase [Pantoea sp. At-9b]
          Length = 313

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 159/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K FRI TR SPLAL  A   +  LM  H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MLDKIFRIATRQSPLALWQAQYVQQRLMAAH--PGLQVELVPMVTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+   S+  
Sbjct: 59  KGLFVKELELAMLENRADLAVHSMKDVPVDFPEGLGLVTICEREDPRDAFVSNHYDSIDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ +   RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPQGAVVGTSSLRRQCQLSARRPDLVIRSLRGNVGTRLGKLDAGEYDAIILAAAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  L  E   P+ GQGA+ IE  +++ +   L++ +N  DT   V  ERA    L
Sbjct: 179 LEDRIRFALPAEISLPAVGQGAVGIECRLDDAELITLLQALNDGDTAVCVRAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  FA  +G  L+  G+V + DG       R G R  A  +G
Sbjct: 239 EGGCQVPIGSFAVLEGDQLWLRGLVGSPDGSQMITGERRGPRDQAEQMG 287


>gi|159900065|ref|YP_001546312.1| porphobilinogen deaminase [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893104|gb|ABX06184.1| porphobilinogen deaminase [Herpetosiphon aurantiacus ATCC 23779]
          Length = 300

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 163/289 (56%), Gaps = 3/289 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           IGTR S LAL      R +L+  H  P   I +  ++TKGD I +R L  IG KGLF  E
Sbjct: 6   IGTRKSQLALVQTHAMRDALLAAH--PQLTIELEHITTKGDAILDRPLAAIGDKGLFVSE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE  + +G++D AVHSAKD+P+ L   + I+AY  R D RDV +    + L DL   + +
Sbjct: 64  IEDAMRNGKVDLAVHSAKDLPSILAPDMTIAAYPERADPRDVLVGAEGRRLADLVPGAKV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSS RR A L   R D+++ID RG ++TRL KL+  +  AI+LA AG++RL   K + +
Sbjct: 124 GTSSPRRAAQLRHLRPDLTIIDIRGNVDTRLRKLDEGQYDAIVLAAAGLQRLGLLKRVTQ 183

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
                +  P+  QG + IE    + +  +L+KV++H ++  +   E+AFLA + G C+ A
Sbjct: 184 FFEPAEMTPAVSQGILGIEARAGDQRVADLLKVLDHAESRATAEAEKAFLATIGGGCQVA 243

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +  FA  +   L+  G++ A DG++       G+   A  +G   AQ +
Sbjct: 244 VGAFATYQIGQLHLIGMIGALDGRLVRG-ELTGSASTAQALGTSLAQQL 291


>gi|24375795|ref|NP_719838.1| porphobilinogen deaminase [Shewanella oneidensis MR-1]
 gi|39931562|sp|Q8E9H0|HEM3_SHEON RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|24350743|gb|AAN57282.1|AE015863_11 porphobilinogen deaminase [Shewanella oneidensis MR-1]
          Length = 310

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++  + D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLEDQADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNIYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQLRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE   N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRTNDERVKALLAPLEHLETRYRVIAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIDGDEMTLRGLVGNPDGSEIIEGVITGPKTEATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|209693832|ref|YP_002261760.1| porphobilinogen deaminase [Aliivibrio salmonicida LFI1238]
 gi|226706282|sp|B6EPK1|HEM3_ALISL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|208007783|emb|CAQ77905.1| porphobilinogen deaminase HemC [Aliivibrio salmonicida LFI1238]
          Length = 311

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 167/305 (54%), Gaps = 2/305 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           ++ P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L +IGGK
Sbjct: 3   QQLPVRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKIGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P +  +GL +     R D RD F+S+T  ++ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVEFPEGLGLVTICERGDPRDAFVSNTYNNIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              + +GT SLRR+  L  +R D+ + + RG + TRL KL++    AI+LA AG+ RL  
Sbjct: 121 PQGATVGTCSLRRQCQLKEYRPDLIIKELRGNVGTRLQKLDDGNYDAIILACAGLIRLGL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  IK  +  E   P+ GQGA+ IET +N+ + + L+  +NH +T   V CERA    L+
Sbjct: 181 EDRIKSSIEPEQSLPAVGQGAVGIETRLNDDRIRALLAPLNHPETAHRVLCERAMNNRLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           G C+  I  ++   G  ++   +V   DG I       G   DA  +G   A+ +     
Sbjct: 241 GGCQVPIGSYSLIDGDQIWLRALVGEPDGSIMVRGETTGPVSDAEELGTKLAEQLLNDGA 300

Query: 302 KNVFN 306
           K++ +
Sbjct: 301 KDILD 305


>gi|117924047|ref|YP_864664.1| hydroxymethylbilane synthase [Magnetococcus sp. MC-1]
 gi|117607803|gb|ABK43258.1| hydroxymethylbilane synthase [Magnetococcus sp. MC-1]
          Length = 314

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 167/289 (57%), Gaps = 4/289 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPL-STKGDRITNRTLTEIGGKGLF 64
            RIGTR S LA+  A   +S L   H   P  IV + L  TKGD+I +  L ++GGKGLF
Sbjct: 7   VRIGTRGSALAVWQAEWVKSQLQAHH---PGIIVELELIKTKGDKILDVPLAKVGGKGLF 63

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +E+E+ ++ G +D AVHS KD+P +   GL +   L RED RD  +S   QSL +L   
Sbjct: 64  VKELEEAMLDGRVDLAVHSMKDVPAEFPDGLMLGPILKREDPRDALLSIHYQSLAELPQG 123

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           ++IG+SSLRR++ +   R D+ +   RG + TR+ KL   +  AI+LA AG+KRL   + 
Sbjct: 124 ALIGSSSLRRQSQIKAKRPDLRLDWLRGNVGTRIQKLVEGQFDAIILAAAGVKRLGLTEH 183

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           + + L  E+  P+ GQGA+ IE  V++ +   L+  + H++T   V  ERAFLA+L+G C
Sbjct: 184 VVQYLEPEEMLPAVGQGAVGIEHRVDDARIATLLAPLYHKETHSCVTAERAFLAKLEGGC 243

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
           +  IAG+A     TL   G+V   +G    +    G R DA  +G+  A
Sbjct: 244 QVPIAGYATLHEDTLTLRGLVAEVEGGRVVQAQCQGPRADAYRMGQQLA 292


>gi|301029020|ref|ZP_07192174.1| porphobilinogen deaminase [Escherichia coli MS 196-1]
 gi|299878014|gb|EFI86225.1| porphobilinogen deaminase [Escherichia coli MS 196-1]
          Length = 320

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 160/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S    SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSDNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|238750675|ref|ZP_04612174.1| Porphobilinogen deaminase [Yersinia rohdei ATCC 43380]
 gi|238711065|gb|EEQ03284.1| Porphobilinogen deaminase [Yersinia rohdei ATCC 43380]
          Length = 313

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 160/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLNKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     L D
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSSHYAHLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLNRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH +T   V  ERA    L
Sbjct: 179 LKSRIRYAMPAEESLPAVGQGAVGIECRLDDDFTRQLLVPLNHRETELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G TL+   +V A DG       R G   DA  +G
Sbjct: 239 EGGCQVPIGSYAELEGDTLWLRALVGAPDGSEIIRGERRGPAEDAEQMG 287


>gi|58585034|ref|YP_198607.1| porphobilinogen deaminase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419350|gb|AAW71365.1| Porphobilinogen deaminase [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 292

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 167/288 (57%), Gaps = 8/288 (2%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           RIGTR S LA+A A E +  L+D+      ++ II + T GD+  N  L EIGGKGLF +
Sbjct: 4   RIGTRGSSLAIAQALEAKQKLLDLF--SSLSVEIIKIKTSGDKYANANLAEIGGKGLFIK 61

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE +LI   ID AVHS KD+P    K L I   L R    D FIS+  +SLK L   ++
Sbjct: 62  EIETELIKSNIDMAVHSLKDVPAFFSKDLTIPCILERLSPYDTFISNKYKSLKSLPQQAI 121

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           I TSS+RRK  LL +R D++++  RG + TR   L N     I+LA AG+ RLKK+ +I 
Sbjct: 122 IATSSIRRKVQLLNFRPDLNIVPLRGNVTTR---LQNQSFDGIILAEAGLIRLKKDYLIT 178

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E+L+ +    + GQGAICI+   N+ K  +L++ IN+  ++  V  ER+F+  ++GSC +
Sbjct: 179 EVLSPKTMLSAVGQGAICIQCRKNDIKIIDLLEKINNNKSFIRVKSERSFMKTVNGSCFT 238

Query: 247 AIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
            +A  A Y   + L+ Y ++  +D K  +   R     DA  +G DA 
Sbjct: 239 PLAALAKYVSENVLHLYCML--ADKKNIYFTERTSFVEDAEKMGMDAG 284


>gi|113968732|ref|YP_732525.1| porphobilinogen deaminase [Shewanella sp. MR-4]
 gi|114049125|ref|YP_739675.1| porphobilinogen deaminase [Shewanella sp. MR-7]
 gi|117918843|ref|YP_868035.1| porphobilinogen deaminase [Shewanella sp. ANA-3]
 gi|123131000|sp|Q0HQI7|HEM3_SHESR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|123325438|sp|Q0HN99|HEM3_SHESM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|158512312|sp|A0KS60|HEM3_SHESA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|113883416|gb|ABI37468.1| porphobilinogen deaminase [Shewanella sp. MR-4]
 gi|113890567|gb|ABI44618.1| porphobilinogen deaminase [Shewanella sp. MR-7]
 gi|117611175|gb|ABK46629.1| porphobilinogen deaminase [Shewanella sp. ANA-3]
          Length = 310

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 112/306 (36%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  VH  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERVH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++  + D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLEDQADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNLYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQLRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE   N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRTNDERVKALLAPLEHLETRYRVIAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIHGDEMTLRGLVGNPDGSEIIEGVITGPKTEATKLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|206889552|ref|YP_002248559.1| porphobilinogen deaminase [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206741490|gb|ACI20547.1| porphobilinogen deaminase [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 311

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 175/299 (58%), Gaps = 3/299 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           IG+R S LA+  A   +  L  ++  P   + I  + T GD+I +  L +IGGKGLF +E
Sbjct: 10  IGSRGSKLAMWQANWVKDKLQTLY--PELKVEIEKIKTTGDKILDAPLAKIGGKGLFVKE 67

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L+S  +D AVHS KD+PT++ +GLQISA   RED RD FIS     L +L   +V+
Sbjct: 68  IEEALLSKRVDLAVHSMKDVPTEIPEGLQISAICEREDPRDAFISKDGVLLNELPQEAVL 127

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSSLRR   L   R+D+ +   RG ++TR+ KL + +  AI+LA AG+KR+  E ++ +
Sbjct: 128 GTSSLRRTVQLKALRNDLVIKPLRGNVDTRIRKLKDGEFQAIVLAMAGVKRMGVENLVTQ 187

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
             + +   P+ GQGAI IET V++    EL+K +NHE+T   +  ERAFL+ + G C+  
Sbjct: 188 AFSEDLMIPAIGQGAIGIETRVDDDFVNELIKPLNHEETAICILAERAFLSVMGGGCQVP 247

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKI-FHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
           +A  A    ++L   G++   +GK+   +  R G+   A ++G + A  +     K + 
Sbjct: 248 LACHARIVNNSLKIVGMIGDPEGKMPVIKGFREGSLSQAQSLGVELANELLHRGGKEIL 306


>gi|225175616|ref|ZP_03729610.1| porphobilinogen deaminase [Dethiobacter alkaliphilus AHT 1]
 gi|225168945|gb|EEG77745.1| porphobilinogen deaminase [Dethiobacter alkaliphilus AHT 1]
          Length = 314

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 166/294 (56%), Gaps = 5/294 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHK-IPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           KK   +G+R S LAL    +T   + ++ K  P  +  +  + T+GD+I +  L++IG K
Sbjct: 2   KKTIVVGSRDSELALT---QTHFVIGELQKHFPDVDFTVKHIKTEGDKILDVALSKIGDK 58

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQS-LKD 120
           GLF +EIE  L+S EID AVHS KD+PT +  GLQI+    RED RD +I+   ++ L D
Sbjct: 59  GLFVKEIENALLSKEIDFAVHSMKDVPTAVPDGLQITTITEREDPRDCYIAKDGKTRLFD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
               +VIGTSSLRR A LL  RSD  ++  RG + TR  KL+    H I+LAYAG+ RL 
Sbjct: 119 TPQGAVIGTSSLRRSAQLLHQRSDFEIVPIRGNLNTRFRKLSEQDMHGIILAYAGVYRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I EI++ E   P+ GQGA+ IET  ++     +V  +NH+ T  ++  ERAFL +L
Sbjct: 179 WADKITEIIDFEKSLPAVGQGALGIETRSDDDFTINIVSALNHDTTASAILAERAFLRQL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           +G C+  I  +   +   L   G+V   DG         G+  ++  +G+  AQ
Sbjct: 239 EGGCQVPIGAYGRLEAEELVLDGVVAGLDGSTVLRDQVRGSADESDALGKKLAQ 292


>gi|110835183|ref|YP_694042.1| porphobilinogen deaminase [Alcanivorax borkumensis SK2]
 gi|123345297|sp|Q0VM28|HEM3_ALCBS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|110648294|emb|CAL17770.1| porphobilinogen deaminase [Alcanivorax borkumensis SK2]
          Length = 310

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 162/296 (54%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M ++  RI TR SPLA+  A   +  L  +H+     + ++ + T+GD+I +  L +IGG
Sbjct: 1   MSREILRIATRSSPLAIWQAEYVQQRLESLHE--GLRVELVRIKTQGDKILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +L  G  +     RED RD F+S+T   L  
Sbjct: 59  KGLFVKELEEAMMDGRADIAVHSMKDVPMELPPGFALPVICEREDPRDAFVSNTFDGLSS 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+A +   R D+ V   RG ++TRL KL+     AI+LA AG+KRL+
Sbjct: 119 LPHGACVGTSSLRRQAQVKANRPDLVVNSLRGNVQTRLGKLDAGNFDAIILAAAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE    +    EL+  ++  DTWD V  ERA    L
Sbjct: 179 MHDRIRYEMPPEESLPAVGQGAVGIECREGDESTIELLSPLSDVDTWDRVVAERAMNRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IAGFA  +   L+  G+V   DG           R     +G D A+ +
Sbjct: 239 EGGCQVPIAGFALLEDGQLWLRGLVAEEDGSRVLRAEGTAPRGQGAELGIDIAEQL 294


>gi|194334346|ref|YP_002016206.1| porphobilinogen deaminase [Prosthecochloris aestuarii DSM 271]
 gi|238058997|sp|B4S922|HEM3_PROA2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|194312164|gb|ACF46559.1| porphobilinogen deaminase [Prosthecochloris aestuarii DSM 271]
          Length = 312

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 113/278 (40%), Positives = 167/278 (60%), Gaps = 4/278 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+   IGTR SPLAL  A  T++ L      P  +I +  + T GD + +  L++IG  G
Sbjct: 2   KQQLIIGTRSSPLALWQAEFTKAEL--SKNFPELDIQLKLIKTTGDVLLDSPLSKIGDMG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT++IEK L++ EID AVHS KD+PT+  +GL +SA+  RED RDV IS    +LK L 
Sbjct: 60  LFTKDIEKHLLAKEIDLAVHSLKDVPTETPEGLILSAFTEREDTRDVIISKNGDNLKQLK 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
            ++ I TSSLRR + LL  R D  + D RG + TR  + + +   A++LAYAG+ RL   
Sbjct: 120 PNAKIATSSLRRTSQLLGIRPDFEMGDIRGNLNTRFKRFDESDFDAMILAYAGVHRLNFG 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I EIL  +   P+ GQGA+ IET +++ + +++VKV+N++++      ERA L  L G
Sbjct: 180 DRISEILPHDVLLPAVGQGALGIETRIDDEQTRQIVKVMNNQNSEYCTKAERALLRHLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSR 278
            C+  I  +A  K  TL+    V + DGK  I +E+++
Sbjct: 240 GCQIPIGAYATYKNGTLHLSAFVGSVDGKRAIRNEITK 277


>gi|160877198|ref|YP_001556514.1| porphobilinogen deaminase [Shewanella baltica OS195]
 gi|189028155|sp|A9L5G0|HEM3_SHEB9 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|160862720|gb|ABX51254.1| porphobilinogen deaminase [Shewanella baltica OS195]
 gi|315269402|gb|ADT96255.1| porphobilinogen deaminase [Shewanella baltica OS678]
          Length = 310

 Score =  195 bits (496), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLDDLADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNLYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  +   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQIRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE  +N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRINDERVKALLAPLEHLETRYRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIDGDEMTLRGLVGNPDGSEIIEGVITGPKTDATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|39998374|ref|NP_954325.1| porphobilinogen deaminase [Geobacter sulfurreducens PCA]
 gi|55976461|sp|Q747I1|HEM3_GEOSL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|39985320|gb|AAR36675.1| porphobilinogen deaminase [Geobacter sulfurreducens PCA]
 gi|298507314|gb|ADI86037.1| hydroxymethylbilane synthase [Geobacter sulfurreducens KN400]
          Length = 318

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 164/284 (57%), Gaps = 3/284 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A   +S L    + P   + ++ + T GD+I +  L ++GGKGLF 
Sbjct: 6   LRIGTRASQLALWQANWVKSELE--KRYPGMEVELVKIKTIGDKILDVPLAQVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD FIS+   +  +L   +
Sbjct: 64  KEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLVCITEREDPRDAFISNGV-TFANLPQGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTS+LRR+A LL+ R D+ ++  RG +ETR+ KL  +K  A++LA AG+KRL    V+
Sbjct: 123 KIGTSALRRQAQLLKVRPDLEMVIIRGNVETRIRKLTEDKLDAVILAAAGLKRLGFTDVV 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E L ++   P+ GQGA+ +E  +++   +E +   NH DT  +V  ERA L   +G C+
Sbjct: 183 TEYLPVDLSLPAIGQGALGLECRLDDQAVRETIDFFNHPDTAHAVRAERALLWRCEGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             IA      G +L   G + + DG    + S +G   D   +G
Sbjct: 243 VPIAAHGQVSGDSLTLTGFIASVDGTRSVKESISGPVTDCEKLG 286


>gi|291285218|ref|YP_003502036.1| Porphobilinogen deaminase [Escherichia coli O55:H7 str. CB9615]
 gi|209753314|gb|ACI74964.1| adenylate cyclase [Escherichia coli]
 gi|290765091|gb|ADD59052.1| Porphobilinogen deaminase [Escherichia coli O55:H7 str. CB9615]
          Length = 320

 Score =  195 bits (495), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 160/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +   GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPHGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|330813348|ref|YP_004357587.1| porphobilinogen deaminase [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486443|gb|AEA80848.1| porphobilinogen deaminase [Candidatus Pelagibacter sp. IMCC9063]
          Length = 321

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 111/296 (37%), Positives = 175/296 (59%), Gaps = 2/296 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVH-KIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           K+   IG+R S L+LA +   +  L+  +  + P  I +  + T GD+     L  +GGK
Sbjct: 4   KQKLIIGSRGSRLSLAQSEHFKDELLLANPDLRPDQIELKVIKTSGDKFKTENLASMGGK 63

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +EIE++L+   IDCAVHS KD+PT  +  L+++A+L R+D RD FIS  A+S + L
Sbjct: 64  GLFVKEIEQELLENNIDCAVHSLKDVPTFGVPSLKLAAFLKRKDERDAFISPVAKSFETL 123

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              S +GTSS+RR A L + RSD++++  RG I+TR+ K+      +I+LAYAG+KRL  
Sbjct: 124 KPGSTVGTSSVRRIAQLKKLRSDLNIVSMRGNIDTRIEKVKEGIYDSIVLAYAGLKRLGF 183

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
              + EIL+ E   P+ GQG + I+   N+ +  +L+K +N ++T   V+ ER+FL  ++
Sbjct: 184 HTHVSEILDKEKMLPAAGQGVVTIQCRSNDGELIKLLKSVNDKETEIIVSAERSFLHRVN 243

Query: 242 GSCKSAIAGFAYCK-GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           G+C + +A  A       ++    +L+ DGK      R G    A++IG D A+ I
Sbjct: 244 GACDTPVAVNAVLNDDGEVFIQAEILSLDGKKVFNAHRTGISEKAVSIGLDVAEEI 299


>gi|157834325|pdb|1YPN|A Chain A, Reduced Form Hydroxymethylbilane Synthase (K59q Mutant)
           Crystal Structure After 2 Hours In A Flow Cell
           Determined By Time-Resolved Laue Diffraction
          Length = 313

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 158/284 (55%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GG+GLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGQGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A      ++   +V A DG       R G   DA  +G
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMG 287


>gi|220933221|ref|YP_002512120.1| Hydroxymethylbilane synthase [Thioalkalivibrio sp. HL-EbGR7]
 gi|254800261|sp|B8GSU8|HEM3_THISH RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|219994531|gb|ACL71133.1| Hydroxymethylbilane synthase [Thioalkalivibrio sp. HL-EbGR7]
          Length = 316

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 164/292 (56%), Gaps = 3/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLA+  A    + +   H  P   + ++ ++T+GDRI +  L ++GGKGLF 
Sbjct: 6   LRIATRKSPLAVWQAEHVAALVKARH--PGVRVELVGMTTQGDRILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P +L +GL +   L RED RD F+S+T +SL +L   +
Sbjct: 64  KELETGLLEGRADIAVHSMKDVPMELPEGLCLPVILDREDPRDAFVSNTFKSLDELPRDA 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+  L        ++D RG + TRL KL+  +  AI+LA AG+KRL  E  I
Sbjct: 124 RVGTSSLRRQCQLRHDHPHFQILDLRGNVNTRLAKLDAGEFDAIILAAAGLKRLGFEVRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              +  E   P+ GQGAI IE   N+P+   L+  ++  DT   V  ERA  A L+G C+
Sbjct: 184 ASEITPEQSLPAIGQGAIGIECRENDPEVMALIGSLDDPDTHVRVAAERAMNARLNGGCQ 243

Query: 246 SAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             IAG+A      TL   G+V   DG +      +G R +A  +GR  A  +
Sbjct: 244 VPIAGYAELTDADTLRLRGLVGEPDGSLILRAELSGPRAEAEALGRAVADLL 295


>gi|320197614|gb|EFW72226.1| Porphobilinogen deaminase [Escherichia coli WV_060327]
          Length = 318

 Score =  195 bits (495), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 299


>gi|253775572|ref|YP_003038403.1| porphobilinogen deaminase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|300930031|ref|ZP_07145463.1| porphobilinogen deaminase [Escherichia coli MS 187-1]
 gi|253326616|gb|ACT31218.1| porphobilinogen deaminase [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|300462064|gb|EFK25557.1| porphobilinogen deaminase [Escherichia coli MS 187-1]
          Length = 320

 Score =  195 bits (495), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|254163746|ref|YP_003046854.1| porphobilinogen deaminase [Escherichia coli B str. REL606]
 gi|242379335|emb|CAQ34146.1| hydroxymethylbilane synthase [Escherichia coli BL21(DE3)]
 gi|253975647|gb|ACT41318.1| porphobilinogen deaminase [Escherichia coli B str. REL606]
 gi|253979803|gb|ACT45473.1| porphobilinogen deaminase [Escherichia coli BL21(DE3)]
 gi|323959059|gb|EGB54728.1| porphobilinogen deaminase [Escherichia coli H489]
 gi|323969355|gb|EGB64654.1| porphobilinogen deaminase [Escherichia coli TA007]
          Length = 313

 Score =  195 bits (495), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|104784255|ref|YP_610753.1| porphobilinogen deaminase [Pseudomonas entomophila L48]
 gi|123380753|sp|Q1I316|HEM3_PSEE4 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|95113242|emb|CAK17970.1| porphobilinogen deaminase [Pseudomonas entomophila L48]
          Length = 313

 Score =  195 bits (495), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 163/294 (55%), Gaps = 2/294 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAH--PGLQVSLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T +SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFKSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLEIRFLRGNVNTRLAKLDAGEYDAIILAAAGLVRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADSEIHALLAPLHHIDTADRVVAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRASAEALGVQVAE 292


>gi|218701284|ref|YP_002408913.1| porphobilinogen deaminase [Escherichia coli IAI39]
 gi|226740634|sp|B7NTE0|HEM3_ECO7I RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|218371270|emb|CAR19104.1| hydroxymethylbilane synthase [Escherichia coli IAI39]
          Length = 313

 Score =  195 bits (495), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 294


>gi|120553424|ref|YP_957775.1| porphobilinogen deaminase [Marinobacter aquaeolei VT8]
 gi|166217776|sp|A1TXW9|HEM3_MARAV RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|120323273|gb|ABM17588.1| hydroxymethylbilane synthase [Marinobacter aquaeolei VT8]
          Length = 313

 Score =  195 bits (495), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 114/306 (37%), Positives = 172/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K+  RI TR S LAL  A   ++ L  +H     ++ +I + T+GD+I +  L +IGG
Sbjct: 1   MSKRTLRIATRSSALALWQAEFIKAELERLHD--NVDVELIKIKTQGDKILDVPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +  +GL + A   RED  D F+S+  + +  
Sbjct: 59  KGLFVKELEEAMLDGRADLAVHSMKDVPMEFPEGLGLVAICEREDPTDAFVSNQYEHIDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GT+SLRR+A L   R D+ +   RG + TRL KL+  +  AI+LA +G+KRL 
Sbjct: 119 LPEGAVVGTASLRREAQLRANRPDLQIKVLRGNVNTRLAKLDAGEYDAIVLASSGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  L      P+ GQGA+ IE  V + +  EL+  +NH DTWD V+ ERA    L
Sbjct: 179 FHDRIRYCLPDTFSLPAVGQGALGIECRVGDTELLELIDPLNHTDTWDRVSAERALNRRL 238

Query: 241 DGSCKSAIAGFAYCK-GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  IA +A  +  +TL+  G+V A DG     V     R +   +GR+ A+ +  +
Sbjct: 239 EGGCQVPIAAYALLEDDNTLWLRGLVGAVDGTQIFRVEGRAPRAEGERLGRELAEQLLSM 298

Query: 300 SNKNVF 305
               V 
Sbjct: 299 GADKVL 304


>gi|15617181|ref|NP_240394.1| porphobilinogen deaminase [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681931|ref|YP_002468317.1| porphobilinogen deaminase [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682486|ref|YP_002468870.1| porphobilinogen deaminase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471641|ref|ZP_05635640.1| porphobilinogen deaminase [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11386824|sp|P57651|HEM3_BUCAI RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800236|sp|B8D8F3|HEM3_BUCA5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800237|sp|B8D8B0|HEM3_BUCAT RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|25292183|pir||H84998 hydroxymethylbilane synthase (EC 4.3.1.8) [imported] - Buchnera sp.
           (strain APS)
 gi|10039246|dbj|BAB13280.1| porphobilinogen deaminase [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219622219|gb|ACL30375.1| porphobilinogen deaminase [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624774|gb|ACL30929.1| porphobilinogen deaminase [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086313|gb|ADP66395.1| porphobilinogen deaminase [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086887|gb|ADP66968.1| porphobilinogen deaminase [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087477|gb|ADP67557.1| porphobilinogen deaminase [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087959|gb|ADP68038.1| porphobilinogen deaminase [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 314

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 175/306 (57%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL      +  ++ ++  P  NI ++P+ T GD I N++L++IGG
Sbjct: 1   MYNKTLRIATRKSPLALKQTKYVQKKILSLY--PDLNIKLVPIVTHGDNILNKSLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  + D A+HS KD+P K+ K L + +   R +  D  +S+  QS+  
Sbjct: 59  KGLFIKELELALLENKADIAIHSMKDLPVKITKELCLVSICKRGNALDSLVSNNYQSINQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L+ +R D+ +   RG IETR+ KL+  K  AI+LA  G+ RL+
Sbjct: 119 LPKGAIVGTSSLRRQCQLITYRPDLIISPLRGNIETRIAKLDQGKYDAIILATEGLNRLR 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I +I+  E   PS GQGAI I++ +++ K    +  +NH +T+  +N ERAF  +L
Sbjct: 179 LKNRITQIIPAELSLPSCGQGAIGIQSRLHDKKVLFFLSRLNHINTFIEINAERAFCRKL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +  C+  I  +A  K + ++  G+V + +GKI  +  R G       +G   A  +    
Sbjct: 239 ESGCQIPIGSYAILKKNKIWLRGLVGSPNGKIILKGERIGCYNTGEKMGYSLADELLKNG 298

Query: 301 NKNVFN 306
            KN+ N
Sbjct: 299 AKNILN 304


>gi|253699058|ref|YP_003020247.1| porphobilinogen deaminase [Geobacter sp. M21]
 gi|259647798|sp|C6DYY8|HEM3_GEOSM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|251773908|gb|ACT16489.1| porphobilinogen deaminase [Geobacter sp. M21]
          Length = 318

 Score =  194 bits (494), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 108/272 (39%), Positives = 157/272 (57%), Gaps = 3/272 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L    + P   + +  + T GD+I +  L ++GG
Sbjct: 1   MALKELRIGTRASQLALWQANWVKSELE--KRYPDMTVTLTKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  IS+  +   D
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVISNNVK-FAD 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG ++TR++KL      A++LA AG+ RL 
Sbjct: 118 LPQGARIGTSALRRQAQLLKVRPDLEMVIIRGNVQTRMDKLKTEGLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I E+L  +   P+ GQGA+ IE +++N   ++ +   NH DT  +V  ERA L   
Sbjct: 178 FADQITELLPTDLSLPAIGQGALGIECNLSNQDVKDAISFFNHPDTSRAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKI 272
           +G C+  IA F    G  L   G + + DGK+
Sbjct: 238 EGGCQVPIAAFGEVTGDELKLTGFIASVDGKV 269


>gi|194438640|ref|ZP_03070728.1| porphobilinogen deaminase [Escherichia coli 101-1]
 gi|194422444|gb|EDX38443.1| porphobilinogen deaminase [Escherichia coli 101-1]
          Length = 318

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDNLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQMGISLAEEL 299


>gi|121997816|ref|YP_001002603.1| porphobilinogen deaminase [Halorhodospira halophila SL1]
 gi|229836112|sp|A1WVT9|HEM3_HALHL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|121589221|gb|ABM61801.1| hydroxymethylbilane synthase [Halorhodospira halophila SL1]
          Length = 310

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 164/290 (56%), Gaps = 2/290 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LA+  A    + L  +H  P   + ++P+ST+GD I ++ L  IGG
Sbjct: 1   MAAESLRIATRRSQLAMWQAEHIAAELQRLH--PGLEVELVPMSTRGDEILDQPLARIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ GE D AVHS KD+P +L +G  ++A   R D RD F+S+    L +
Sbjct: 59  KGLFMKELEDGMLRGEADLAVHSMKDIPWRLPEGFDLAAVSDRADPRDAFVSNHYSDLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GT+SLRR+  ++  R D+ +   RG ++TRL KL++    AI+LA +G+ RL+
Sbjct: 119 LPHGARVGTASLRRQCQIMDRRPDLQIEVLRGNVQTRLRKLDDGVYDAIILAASGLDRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   L  E   P+ GQGA+ IE    + +  +LV+ +NHE T   +N ER   A L
Sbjct: 179 LTHRIAGRLTPEQSLPAVGQGALGIECREGDERVMKLVEGLNHEATRIRINAERGMNARL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGR 290
           +GSC+  I G+A   G  ++  G+V A DG         G   +A N+GR
Sbjct: 239 EGSCQVPIGGYAELDGDEVHLRGLVGAIDGSEVIRGEIRGPAAEAENLGR 288


>gi|184156604|ref|YP_001844943.1| porphobilinogen deaminase [Acinetobacter baumannii ACICU]
 gi|332874912|ref|ZP_08442763.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6014059]
 gi|183208198|gb|ACC55596.1| Porphobilinogen deaminase [Acinetobacter baumannii ACICU]
 gi|322506491|gb|ADX01945.1| hemC [Acinetobacter baumannii 1656-2]
 gi|323516370|gb|ADX90751.1| porphobilinogen deaminase [Acinetobacter baumannii TCDC-AB0715]
 gi|332736855|gb|EGJ67831.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6014059]
          Length = 309

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 168/293 (57%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 6   KTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 63

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 64  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 123

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   +
Sbjct: 124 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLAE 183

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G 
Sbjct: 184 RIRHCIEPSVSLPAVGQGALGLECRADDQEVLTLIQPLLHPETDVCVRAERAFNAYLEGG 243

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 244 CQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNL 296


>gi|193076128|gb|ABO10737.2| porphobilinogen deaminase [Acinetobacter baumannii ATCC 17978]
          Length = 309

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 168/293 (57%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 6   KTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 63

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 64  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 123

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   +
Sbjct: 124 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLAE 183

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G 
Sbjct: 184 RIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEGG 243

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 244 CQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNL 296


>gi|260556364|ref|ZP_05828583.1| porphobilinogen deaminase [Acinetobacter baumannii ATCC 19606]
 gi|260410419|gb|EEX03718.1| porphobilinogen deaminase [Acinetobacter baumannii ATCC 19606]
          Length = 314

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 168/293 (57%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 11  KTLKIATRQSPLALWQAEHIRARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 68

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 69  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 128

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   +
Sbjct: 129 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLAE 188

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G 
Sbjct: 189 RIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEGG 248

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 249 CQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNL 301


>gi|293610070|ref|ZP_06692371.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827302|gb|EFF85666.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 314

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 166/293 (56%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 11  KTLKIATRQSPLALWQAEHIRARLEELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 68

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 69  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 128

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL+  +  AI+LA AG+KRL   +
Sbjct: 129 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDEGQYDAIILASAGLKRLGLSE 188

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L  +   P+ GQGA+ +E    +     L++ + H +T   V  ERAF A L+G 
Sbjct: 189 RIRHCLTPDISLPAVGQGALGLECRAADQDVLALIQPLLHAETDVCVRAERAFNAYLEGG 248

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 249 CQVPIAGYATLQNGQIHIEGRVGSPDGQTLLRAELTDEANNAQQLGENLARNL 301


>gi|193065671|ref|ZP_03046736.1| porphobilinogen deaminase [Escherichia coli E22]
 gi|194429243|ref|ZP_03061771.1| porphobilinogen deaminase [Escherichia coli B171]
 gi|192926638|gb|EDV81267.1| porphobilinogen deaminase [Escherichia coli E22]
 gi|194412755|gb|EDX29049.1| porphobilinogen deaminase [Escherichia coli B171]
 gi|320198489|gb|EFW73090.1| Porphobilinogen deaminase [Escherichia coli EC4100B]
          Length = 318

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 69  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 189 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   +A  +G   A+ +
Sbjct: 249 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEEL 299


>gi|323167552|gb|EFZ53258.1| porphobilinogen deaminase [Shigella sonnei 53G]
          Length = 313

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   +A  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAKQMGISLAEEL 294


>gi|237756363|ref|ZP_04584911.1| porphobilinogen deaminase [Sulfurihydrogenibium yellowstonense
           SS-5]
 gi|237691477|gb|EEP60537.1| porphobilinogen deaminase [Sulfurihydrogenibium yellowstonense
           SS-5]
          Length = 310

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 174/294 (59%), Gaps = 8/294 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A      L ++H +    + ++ ++T+GD+I +  L +IGGKGLF 
Sbjct: 3   IRIGTRKSQLALWQANYIADRLREIHGV---EVELVKITTQGDKILDVPLAKIGGKGLFV 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L+  EID AVHS KD+PT L +GL++ A   RED RD F+S   + +  L  ++
Sbjct: 60  KEIEDALLKNEIDIAVHSLKDVPTVLPEGLELIAITEREDPRDAFLSIKHEHIYQLPENA 119

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           VIGTSSLRRK+ +++ R D+ + D RG ++TR+ KL   +  AI+LAYAG+KRL  +  +
Sbjct: 120 VIGTSSLRRKSQIMKIRKDLQIKDLRGNVDTRIRKLEEGQYDAIILAYAGLKRLGLDGKV 179

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           K I + ++  P+  QG + IE   ++ + + L+K +NH +++     ER+FL  L+G C+
Sbjct: 180 KYIFSPDEMIPAVCQGFLAIEGRSDDERIKNLIKPLNHYESYLRATAERSFLKTLEGGCQ 239

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFH-----EVSRNGNRCDAINIGRDAAQ 294
             +  +   K ++    G +   +G+ ++     E  +   +  AI +G+  A+
Sbjct: 240 VPLGAYCEIKENSFIITGFIADLEGREYYQEKITEQIKENTQEQAIILGKTLAE 293


>gi|209921277|ref|YP_002295361.1| porphobilinogen deaminase [Escherichia coli SE11]
 gi|218556364|ref|YP_002389278.1| porphobilinogen deaminase [Escherichia coli IAI1]
 gi|218697519|ref|YP_002405186.1| porphobilinogen deaminase [Escherichia coli 55989]
 gi|256021454|ref|ZP_05435319.1| porphobilinogen deaminase [Shigella sp. D9]
 gi|260846422|ref|YP_003224200.1| hydroxymethylbilane synthase HemC [Escherichia coli O103:H2 str.
           12009]
 gi|260857792|ref|YP_003231683.1| hydroxymethylbilane synthase HemC [Escherichia coli O26:H11 str.
           11368]
 gi|260870527|ref|YP_003236929.1| hydroxymethylbilane synthase HemC [Escherichia coli O111:H- str.
           11128]
 gi|293417268|ref|ZP_06659893.1| porphobilinogen deaminase [Escherichia coli B185]
 gi|293468119|ref|ZP_06664531.1| porphobilinogen deaminase [Escherichia coli B088]
 gi|331670648|ref|ZP_08371485.1| hydroxymethylbilane synthase [Escherichia coli TA271]
 gi|226706285|sp|B6I4E0|HEM3_ECOSE RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226740635|sp|B7M603|HEM3_ECO8A RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|254800249|sp|B7L959|HEM3_ECO55 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|209914536|dbj|BAG79610.1| porphobilinogen deaminase [Escherichia coli SE11]
 gi|218354251|emb|CAV00923.1| hydroxymethylbilane synthase [Escherichia coli 55989]
 gi|218363133|emb|CAR00774.1| hydroxymethylbilane synthase [Escherichia coli IAI1]
 gi|257756441|dbj|BAI27943.1| hydroxymethylbilane synthase HemC [Escherichia coli O26:H11 str.
           11368]
 gi|257761569|dbj|BAI33066.1| hydroxymethylbilane synthase HemC [Escherichia coli O103:H2 str.
           12009]
 gi|257766883|dbj|BAI38378.1| hydroxymethylbilane synthase HemC [Escherichia coli O111:H- str.
           11128]
 gi|291321497|gb|EFE60935.1| porphobilinogen deaminase [Escherichia coli B088]
 gi|291431036|gb|EFF04031.1| porphobilinogen deaminase [Escherichia coli B185]
 gi|323155206|gb|EFZ41390.1| porphobilinogen deaminase [Escherichia coli EPECa14]
 gi|323182576|gb|EFZ67980.1| porphobilinogen deaminase [Escherichia coli 1357]
 gi|323380839|gb|ADX53107.1| porphobilinogen deaminase [Escherichia coli KO11]
 gi|323943796|gb|EGB39891.1| porphobilinogen deaminase [Escherichia coli H120]
 gi|324115735|gb|EGC09670.1| porphobilinogen deaminase [Escherichia coli E1167]
 gi|331062121|gb|EGI34043.1| hydroxymethylbilane synthase [Escherichia coli TA271]
          Length = 313

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   +A  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEEL 294


>gi|74314316|ref|YP_312735.1| porphobilinogen deaminase [Shigella sonnei Ss046]
 gi|73857793|gb|AAZ90500.1| porphobilinogen deaminase [Shigella sonnei Ss046]
          Length = 320

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   +A  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAKQMGISLAEEL 301


>gi|157156845|ref|YP_001465286.1| porphobilinogen deaminase [Escherichia coli E24377A]
 gi|300818726|ref|ZP_07098933.1| porphobilinogen deaminase [Escherichia coli MS 107-1]
 gi|300823336|ref|ZP_07103467.1| porphobilinogen deaminase [Escherichia coli MS 119-7]
 gi|300921486|ref|ZP_07137834.1| porphobilinogen deaminase [Escherichia coli MS 115-1]
 gi|300923304|ref|ZP_07139352.1| porphobilinogen deaminase [Escherichia coli MS 182-1]
 gi|301328438|ref|ZP_07221519.1| porphobilinogen deaminase [Escherichia coli MS 78-1]
 gi|307313621|ref|ZP_07593241.1| porphobilinogen deaminase [Escherichia coli W]
 gi|331679912|ref|ZP_08380575.1| hydroxymethylbilane synthase [Escherichia coli H591]
 gi|332282690|ref|ZP_08395103.1| porphobilinogen deaminase [Shigella sp. D9]
 gi|157078875|gb|ABV18583.1| porphobilinogen deaminase [Escherichia coli E24377A]
 gi|300411603|gb|EFJ94913.1| porphobilinogen deaminase [Escherichia coli MS 115-1]
 gi|300420390|gb|EFK03701.1| porphobilinogen deaminase [Escherichia coli MS 182-1]
 gi|300524122|gb|EFK45191.1| porphobilinogen deaminase [Escherichia coli MS 119-7]
 gi|300528692|gb|EFK49754.1| porphobilinogen deaminase [Escherichia coli MS 107-1]
 gi|300845148|gb|EFK72908.1| porphobilinogen deaminase [Escherichia coli MS 78-1]
 gi|306906602|gb|EFN37114.1| porphobilinogen deaminase [Escherichia coli W]
 gi|315063097|gb|ADT77424.1| hydroxymethylbilane synthase [Escherichia coli W]
 gi|324016226|gb|EGB85445.1| porphobilinogen deaminase [Escherichia coli MS 117-3]
 gi|331072459|gb|EGI43791.1| hydroxymethylbilane synthase [Escherichia coli H591]
 gi|332105042|gb|EGJ08388.1| porphobilinogen deaminase [Shigella sp. D9]
          Length = 320

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDTRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   +A  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEEL 301


>gi|238918086|ref|YP_002931600.1| porphobilinogen deaminase, [Edwardsiella ictaluri 93-146]
 gi|238867654|gb|ACR67365.1| porphobilinogen deaminase, putative [Edwardsiella ictaluri 93-146]
          Length = 317

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 154/284 (54%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   R  L+   + P   I ++P+ T+GD + +  L ++GGKGLF 
Sbjct: 12  LRIATRQSPLALWQAHYVRDQLL--AQWPQLTIELVPMVTRGDVLLDTPLAKVGGKGLFV 69

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P     GL +     RED RD F+S    SL+ L   S
Sbjct: 70  KELELALLEGRADIAVHSMKDVPVAFPDGLGLVTICQREDPRDAFVSPRFASLEQLPPGS 129

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  L   R D+ + D RG + TRL KL+     AI+LA AG+KRL+ E  I
Sbjct: 130 VVGTSSLRRQCQLRAARPDLQIRDLRGNVGTRLAKLDAGDYDAIILAAAGLKRLQLEDRI 189

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  + +   + L+  +NH +T   V  ERA    L+G C+
Sbjct: 190 RTPLTPEQSLPAVGQGAVGIECRLADDATRRLLAPLNHAETALRVCAERAMNTRLEGGCQ 249

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A   G  L+   +V A DG +     R G    A  +G
Sbjct: 250 VPIGSYAEIDGDRLWLRALVGAPDGSLMICGERRGPLAQAEAMG 293


>gi|204930376|ref|ZP_03221353.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320780|gb|EDZ05982.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 320

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 157/291 (53%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL DL   S
Sbjct: 71  KELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDDLPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L     D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERHPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L+G C+
Sbjct: 191 RTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G+   A  +G   A+ +
Sbjct: 251 VPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEEL 301


>gi|253991598|ref|YP_003042954.1| porphobilinogen deaminase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783048|emb|CAQ86213.1| porphobilinogen deaminase [Photorhabdus asymbiotica]
          Length = 313

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/289 (37%), Positives = 159/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLA+  A   +  L   +  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MSTKTIRIATRQSPLAMWQALYVQQKLQQFY--PDLEVQLVPMVTQGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S    SL +
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPISFPEGLGLVTICERDDPRDAFVSAKYHSLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+++ D RG + TRL+KL+N    AI+LA AG+KRL+
Sbjct: 119 LPTGSIVGTSSLRRQCQLRELRPDLTIRDLRGNVGTRLSKLDNGHYDAIILAVAGLKRLE 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  L+ +   P+ GQGA+ IE  +++ + + L+  +NH DT   V  ER     L
Sbjct: 179 LHDRIRTPLSAKQLLPAVGQGAVGIECRLDDQQTRALLAPLNHYDTEICVLAERTMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +   ++   +V A DG +     R     DA   G
Sbjct: 239 EGGCQVPIGSYAIWQDGKIWLRALVGAPDGSVIIRGERTVLPKDACQAG 287


>gi|331005642|ref|ZP_08329011.1| Porphobilinogen deaminase [gamma proteobacterium IMCC1989]
 gi|330420567|gb|EGG94864.1| Porphobilinogen deaminase [gamma proteobacterium IMCC1989]
          Length = 324

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 165/296 (55%), Gaps = 4/296 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K    I TR SPLAL  A   ++ L  +H  P   + ++P++++GD I +  L ++GGKG
Sbjct: 13  KNTITIATRKSPLALWQAEYVKARLEALH--PEVTVELLPMTSRGDHILDVPLAKVGGKG 70

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L++GE D AVHS KD+P +  +GL +S    RED RD F+S    S  DL 
Sbjct: 71  LFVKELEHALLNGEADIAVHSMKDVPMEFPEGLGLSVICEREDPRDAFVSEKYASFADLP 130

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RLK  
Sbjct: 131 QGAVVGTSSLRRQCQLLEQRPDLQITFLRGNVNTRLRKLDEGEYDAIILAAAGLMRLKMA 190

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I E L  E   P+ GQGA+ IE   ++ + +  +  +N   T + V  ERA    L+G
Sbjct: 191 DRITEYLTPELCLPAGGQGAVGIECRDDDEQVKTWLAPLNDPITHECVAAERAMNRRLEG 250

Query: 243 SCKSAIAGFAY--CKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  IA +A     G  L+  G+V + DGKI  E    G    A ++G   A+ +
Sbjct: 251 GCQVPIASYAIHSADGKQLWLRGLVGSPDGKIMLEDEVTGAPDQADDLGVKLAERL 306


>gi|170724850|ref|YP_001758876.1| porphobilinogen deaminase [Shewanella woodyi ATCC 51908]
 gi|238059003|sp|B1KQC6|HEM3_SHEWM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|169810197|gb|ACA84781.1| porphobilinogen deaminase [Shewanella woodyi ATCC 51908]
          Length = 309

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLAL  A   ++ L   H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSQNVIRIATRKSPLALWQAEFVKAELEKFH--PDLTVELLPMSTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLENRADIAVHSMKDVPVDFPEGLGLEIICEREDPRDAFVSNNYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  +   R D+ + D RG + TRL KL+     AI+LA AG+KRLK
Sbjct: 119 LPKGAVVGTSSLRRQCQIRAARPDLQIRDLRGNVGTRLGKLDAGTYDAIILAAAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++ E+  P+ GQGA+ IE   ++ + + L+  + H +T   V  ERA    L
Sbjct: 179 LEERITSFISAEESLPANGQGAVGIECRTDDERVKALLAPLEHAETRFRVIAERAMNTHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  +A     TL   G+V   DG      ++ G + DA  +G   A+ +    
Sbjct: 239 EGGCQVPIGAYAEIVDDTLTLRGLVGNPDGTQIIASTKVGPKTDAKALGISLAEELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|283834568|ref|ZP_06354309.1| hydroxymethylbilane synthase [Citrobacter youngae ATCC 29220]
 gi|291069698|gb|EFE07807.1| hydroxymethylbilane synthase [Citrobacter youngae ATCC 29220]
          Length = 313

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDALMANH--PGLIVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +   GL +     RED RD F+S+   +L DL   S
Sbjct: 64  KELEVALLEKRADIAVHSMKDVPVEFPDGLGLVTICEREDPRDAFVSNKYNTLDDLPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L + R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  +
Sbjct: 124 IVGTSSLRRQCQLAKRRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRV 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + + L+  +NHE+T   V  ERA    L+G C+
Sbjct: 184 RTALPPEVSLPAVGQGAVGIECRLDDMRTRALLAPLNHEETALRVKAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELINGEIWLRALVGAPDGSQMVCGERRGAVQDAEQMGISLAEEL 294


>gi|323161134|gb|EFZ47052.1| porphobilinogen deaminase [Escherichia coli E128010]
          Length = 313

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 160/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ +  EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDTRTHELLAALNHHETALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   +A  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEEL 294


>gi|152978040|ref|YP_001343669.1| porphobilinogen deaminase [Actinobacillus succinogenes 130Z]
 gi|189042873|sp|A6VL87|HEM3_ACTSZ RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|150839763|gb|ABR73734.1| porphobilinogen deaminase [Actinobacillus succinogenes 130Z]
          Length = 309

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/270 (38%), Positives = 160/270 (59%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+++  +I TR SPLAL  A   +  L +++  P   + ++P+ TKGD I +  L +IGG
Sbjct: 1   MQQEILKIATRQSPLALWQANFVKDRLTEIY--PDLTVELVPMVTKGDVILDTPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L++G+ D AVHS KD+P +   GL +S    RED RD F+S+  ++L D
Sbjct: 59  KGLFVKELENALLNGDADIAVHSMKDVPMEFPAGLGLSVICKREDPRDAFVSNRYRTLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L + R D+++   RG + TRL+KL+     AI+LA AG+ RL 
Sbjct: 119 LPPGAIVGTSSLRRQCQLKKRRPDLNIRSLRGNVGTRLSKLDQGDYDAIILASAGLIRLA 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   +  E   P+ GQGA+ IE  +N+ + Q+L+  +   +T   V  ERA    L
Sbjct: 179 LPERIASFIETEISLPAAGQGAVGIECRINDQRVQKLLAPLADTETTACVLAERAMNNRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            G C+  I G+A   G+ L+   +V A DG
Sbjct: 239 QGGCQVPIGGYAVLNGNELHLRALVGALDG 268


>gi|311105076|ref|YP_003977929.1| porphobilinogen deaminase [Achromobacter xylosoxidans A8]
 gi|310759765|gb|ADP15214.1| porphobilinogen deaminase [Achromobacter xylosoxidans A8]
          Length = 315

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/299 (37%), Positives = 167/299 (55%), Gaps = 2/299 (0%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           I TR S LAL  A   R  L  ++  P   + ++ L+T+GD+I +RTL+++GGKGLF +E
Sbjct: 9   IATRASRLALWQAEHVRDRLRTLY--PACAVELLTLTTRGDQILDRTLSKVGGKGLFVKE 66

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           +E  L+ G  D AVHS KD+P  L    ++ A L R D RD F+S+T  +L DL   +V+
Sbjct: 67  LENALLDGRADLAVHSLKDVPVDLQAPFELCAVLDRADPRDAFVSNTHDTLADLPAGAVV 126

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSSLRR++ +     ++ V   RG ++TRL KL+  +  AI+LA AG++RL     I+ 
Sbjct: 127 GTSSLRRESQIRARYPELVVKPLRGNLDTRLGKLDKGEYDAIVLAAAGLERLGLGARIRS 186

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
           +L  ED  P+ GQGA+ IE   +    +  +  +   DT   V  ERA   +L GSC+  
Sbjct: 187 LLEPEDSLPAAGQGALGIEIRDDRDDMRAWLAPLVSADTTSCVVAERAVSRKLGGSCQVP 246

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
           +A +A   G TL    +V + DG      SR+G   DA  IG  AAQ +     +++  
Sbjct: 247 LAAYAEIAGGTLSLRALVASPDGVRMVHASRSGPVADAQAIGEAAAQALLDAGAQDILR 305


>gi|163782608|ref|ZP_02177605.1| porphobilinogen deaminase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882181|gb|EDP75688.1| porphobilinogen deaminase [Hydrogenivirga sp. 128-5-R1-1]
          Length = 303

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/290 (38%), Positives = 164/290 (56%), Gaps = 5/290 (1%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           RIGTR S LAL  A   +S L    K     + ++ ++T GD+I +  L +IGGKGLF +
Sbjct: 4   RIGTRKSKLALWQANFVKSFL---EKKWGVEVELVKITTTGDKILDSPLAKIGGKGLFVK 60

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE+ L+ G ID AVHS KD+P  + +GL + A   RE+  DV +S     L +L   + 
Sbjct: 61  EIEQALMEGRIDLAVHSLKDVPMVIPEGLTLGAITEREEPHDVLLSRDGGKLLELREGAK 120

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           +GTSSLRR+  L R R D+ V   RG ++TR+ KL      AI+LAYAG+KR+  E  + 
Sbjct: 121 VGTSSLRRQVQLKRLRRDLEVEVLRGNVDTRVRKLKEGMYDAIILAYAGVKRMGYEDEVT 180

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E+L+   F P+ GQG++ IE    + +   L++ +NH ++     CERAFL  L+G C+ 
Sbjct: 181 EVLDY--FIPAVGQGSLAIEIREGDEETLRLIEPLNHPESRVRAECERAFLRRLEGGCQV 238

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            I  FA  KG+TL   G +   +G  F E    G   +A  +G   A+ +
Sbjct: 239 PIGAFAQVKGNTLTVRGFISDLEGLKFIEGEEVGKPEEASELGERLAESL 288


>gi|300721444|ref|YP_003710719.1| hydroxymethylbilane synthase [Xenorhabdus nematophila ATCC 19061]
 gi|297627936|emb|CBJ88482.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 313

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 161/293 (54%), Gaps = 6/293 (2%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLA+  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MTMKTIRIATRQSPLAMWQAHYVQKQLQHFH--PELKVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P +   GL +     R+D RD F+S    SL D
Sbjct: 59  KGLFVKELELALLEKRADIAVHSMKDVPVEFPNGLGLVTICERDDPRDAFVSVKYASLDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L + R D+ + D RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 119 LPTGSVVGTSSLRRQCQLRQLRPDLVIRDLRGNVGTRLSKLDNGDYDAIILATAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH  T   V  ERA    L
Sbjct: 179 LEERIRMPLAPELLLPAVGQGAVGIECRLDDQQTRELLAPLNHARTEICVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
           +G C+  I  +A  +   ++   +V A DG     VS  G R  +    R A 
Sbjct: 239 EGGCQVPIGSYAIWQEDKIWLRALVGAPDGT----VSVRGERVVSPEEARQAG 287


>gi|295706769|ref|YP_003599844.1| porphobilinogen deaminase [Bacillus megaterium DSM 319]
 gi|294804428|gb|ADF41494.1| porphobilinogen deaminase [Bacillus megaterium DSM 319]
          Length = 310

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 168/292 (57%), Gaps = 8/292 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIP-PHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +G+R S LAL    +T+  +  + K   P    I  + TKGD+I N TL+++GGKGLF +
Sbjct: 6   VGSRRSKLALT---QTKWVIEQLKKQGLPFEFEIKEMVTKGDQILNVTLSKVGGKGLFVK 62

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE+ ++  EID AVHS KDMP  L +GL I     RED RD  IS   +  ++L   +V
Sbjct: 63  EIEQAMLDEEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAV 122

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK-VI 185
           IGTSSLRR A LL  RSDI +   RG I+TRL KL N    AI+LA AG+ R+   +  +
Sbjct: 123 IGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNKDYDAIILAAAGLSRMGWSRDTV 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L  E   P+ GQGA+ IE   N+ +   L++ +NH++T  +V  ER FL E++G C+
Sbjct: 183 TQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQ 242

Query: 246 SAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             IAG+     G  +    +V + DGK  ++    G   D + IG  AA+ +
Sbjct: 243 VPIAGYGRILDGGNIELTSLVASPDGKTIYKEQITGK--DPVAIGSAAAERL 292


>gi|290477117|ref|YP_003470030.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Xenorhabdus bovienii SS-2004]
 gi|289176463|emb|CBJ83272.1| hydroxymethylbilane synthase (porphobilinogen deaminase)
           [Xenorhabdus bovienii SS-2004]
          Length = 311

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 109/269 (40%), Positives = 154/269 (57%), Gaps = 2/269 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  RI TR SPLA+  A   +  L   H  P   + +IP+ T+GD I +  L ++GGKGL
Sbjct: 2   KIIRIATRQSPLAMWQAQYVQKQLEQFH--PELKVELIPMVTRGDVILDTPLAKVGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+    D AVHS KD+P +   GL +     R D RD F+S    SL +L +
Sbjct: 60  FVKELELALLENRADIAVHSMKDVPVEFPDGLGLVTICERGDPRDAFVSVKYTSLDELPI 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            S++GTSSLRR+  L + R D+ V D RG + TRL KL+N    AI+LA AG+KRL  E 
Sbjct: 120 GSIVGTSSLRRQCQLRQLRPDLVVRDLRGNVGTRLGKLDNGDYDAIILAAAGLKRLGLED 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L  E   P+ GQGA+ IE  +++ + +EL+  +NH  T   V  ERA    L+G 
Sbjct: 180 RIRMPLEPELLLPAVGQGAVGIECRLDDKQTRELLAPLNHTGTEICVLAERAMNTHLEGG 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKI 272
           C+  I  +A  +G+ ++   +V A DG I
Sbjct: 240 CQVPIGSYAIWQGNNIWLRALVGAPDGSI 268


>gi|326388534|ref|ZP_08210128.1| porphobilinogen deaminase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206999|gb|EGD57822.1| porphobilinogen deaminase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 309

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/266 (41%), Positives = 151/266 (56%), Gaps = 4/266 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            R+GTR SPLA+A A ETR+ L   H  P   + ++P+   GDRI +R L EIGGK L+T
Sbjct: 1   MRLGTRQSPLAMAQAEETRARLCAAHGWPVDAVELVPVVASGDRIQDRPLAEIGGKALWT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E++  L  G ID AVHS KD+ T   + L I+A LPR D+RDV +   A S+ D+   +
Sbjct: 61  KELDAWLAEGTIDAAVHSMKDVETLRPETLTIAAVLPRADVRDVLVG--AASVADIPTGA 118

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTS+ RR A +L  R D++V+ FRG + TRL KL   +A   LLA AG+ RL  E  I
Sbjct: 119 RVGTSAPRRAAQMLHARPDLTVVSFRGNVATRLGKLERGEADVTLLAAAGLVRL-GETGI 177

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L+ E + P+P QGAI IE          L   I+   T  ++  ERA L  L G+C 
Sbjct: 178 GTPLDAETWLPAPAQGAIGIECLAARADLLSLFAAIDDAPTHAAIRAERALLTGLGGTCH 237

Query: 246 SAIAGFAYCKGST-LYFYGIVLASDG 270
           S IA     +G T L+    + + DG
Sbjct: 238 SPIAVLTRPEGDTELFLRAALFSPDG 263


>gi|294501421|ref|YP_003565121.1| porphobilinogen deaminase [Bacillus megaterium QM B1551]
 gi|294351358|gb|ADE71687.1| porphobilinogen deaminase [Bacillus megaterium QM B1551]
          Length = 310

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 169/292 (57%), Gaps = 8/292 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIP-PHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +G+R S LAL    +T+  +  + K   P    I  + TKGD+I N TL+++GGKGLF +
Sbjct: 6   VGSRRSKLALT---QTKWVIEQLKKQGLPFEFEIKEMVTKGDQILNVTLSKVGGKGLFVK 62

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE+ ++  EID AVHS KDMP  L +GL I     RED RD  IS   +  ++L   +V
Sbjct: 63  EIEQAMLDKEIDMAVHSMKDMPAVLPEGLTIGCIPLREDHRDALISKNGERFEELPSGAV 122

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK-VI 185
           IGTSSLRR A LL  RSDI +   RG I+TRL KL N    AI+LA AG+ R+   K  +
Sbjct: 123 IGTSSLRRGAQLLSMRSDIEIKWIRGNIDTRLEKLKNEDYDAIILAAAGLSRMGWSKDTV 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L  E   P+ GQGA+ IE   N+ +   L++ +NH++T  +V  ER FL E++G C+
Sbjct: 183 TQYLEPEISVPAVGQGALAIECRENDHELLSLLQALNHDETARAVRAERVFLKEMEGGCQ 242

Query: 246 SAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             IAG+     G  +    +V + DGK  ++    G   + + IG +AA+ +
Sbjct: 243 VPIAGYGRILDGGNIELTSLVASPDGKTIYKEHITGK--NPVAIGSEAAERL 292


>gi|291288798|ref|YP_003505614.1| porphobilinogen deaminase [Denitrovibrio acetiphilus DSM 12809]
 gi|290885958|gb|ADD69658.1| porphobilinogen deaminase [Denitrovibrio acetiphilus DSM 12809]
          Length = 308

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 116/300 (38%), Positives = 168/300 (56%), Gaps = 5/300 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPH-NIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           I TR S LAL  A+ TR  L   H +    NI+     TKGD+I +  L +IGGKGLF +
Sbjct: 6   IATRGSNLALWQAYYTRDRLQKEHGVEVELNII----KTKGDKILDVPLAKIGGKGLFVK 61

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE+ LI G+ D AVHS KD+P ++ +GL++ A        D F+S     + +L   +V
Sbjct: 62  EIEQALIDGKADIAVHSMKDVPMEMPEGLELYASPEGASPYDCFVSVKYNEVVELPQGAV 121

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           +GTSSLRRK  LL+ R D+ + D RG + TRL KL   +   I+LA AG+ RL+   VIK
Sbjct: 122 VGTSSLRRKLQLLKMRPDLVIKDLRGNVNTRLAKLEAGEFDGIVLAKAGLVRLELGHVIK 181

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E    +   P+  QGA+  +   N+ + +EL++ +    T   V+ ERAFL  L+G C++
Sbjct: 182 ETFTADQMLPACCQGALGFQIRANDTRMKELLRFMKDPATETKVSMERAFLRRLEGGCQA 241

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
            IAG +   GS +   GIV A DG+ F E    G+  DA  +G + A+ +     K++  
Sbjct: 242 PIAGHSVLTGSKICMKGIVAALDGRTFIEQFIEGHAEDAEKLGLELAERVLNAGAKDILE 301


>gi|217975048|ref|YP_002359799.1| porphobilinogen deaminase [Shewanella baltica OS223]
 gi|304412540|ref|ZP_07394146.1| porphobilinogen deaminase [Shewanella baltica OS183]
 gi|307307199|ref|ZP_07586937.1| porphobilinogen deaminase [Shewanella baltica BA175]
 gi|254800258|sp|B8E879|HEM3_SHEB2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|217500183|gb|ACK48376.1| porphobilinogen deaminase [Shewanella baltica OS223]
 gi|304349182|gb|EFM13594.1| porphobilinogen deaminase [Shewanella baltica OS183]
 gi|306910438|gb|EFN40869.1| porphobilinogen deaminase [Shewanella baltica BA175]
          Length = 310

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 170/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLDDLADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNLYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  +   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQIRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE  +N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRINDERVKALLAPLEHLETRYRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIDGDEMTLRGLVGNPDGSEIIEGVITGPKTEATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|254418576|ref|ZP_05032300.1| porphobilinogen deaminase [Brevundimonas sp. BAL3]
 gi|196184753|gb|EDX79729.1| porphobilinogen deaminase [Brevundimonas sp. BAL3]
          Length = 317

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 158/270 (58%), Gaps = 5/270 (1%)

Query: 5   PFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNI-VIIPLS---TKGDRITNRTLTEIGG 60
           P RIGTR S LALA +   + ++     +    I   +PL    T GDRI +R L E+GG
Sbjct: 4   PLRIGTRRSKLALAQSGMMQRAIGRALGVAEAEIEAAVPLVEIVTTGDRIQDRRLMEMGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           K LFT+EIE+ L+   ID A+HS KD+P +  +GL I+A   RED RD FIS    S   
Sbjct: 64  KALFTKEIEEALLDRRIDIAIHSMKDVPAEQPEGLCIAAIPEREDARDAFISRDFDSFDQ 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GT+SLRR+A  L  R D+ V   RG I+TRL +       AILLA +G+ RL 
Sbjct: 124 LPFGARLGTASLRRQAQALALRPDLKVEMLRGNIDTRLRRAAEGDFDAILLAVSGMTRLG 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+E L+++ F P+PGQGA+ I+T  ++  A   V  +NH +T  +V  ER  +  L
Sbjct: 184 VTEHIREKLSLDAFLPAPGQGALAIQTRADDIDAP-WVAALNHPETAVAVAAERGAMTAL 242

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
           +GSC++A+  +A  +G TL     +L+ DG
Sbjct: 243 EGSCRTAVGAYALIEGDTLRLTTEMLSPDG 272


>gi|328952141|ref|YP_004369475.1| Porphobilinogen deaminase [Desulfobacca acetoxidans DSM 11109]
 gi|328452465|gb|AEB08294.1| Porphobilinogen deaminase [Desulfobacca acetoxidans DSM 11109]
          Length = 311

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 108/263 (41%), Positives = 152/263 (57%), Gaps = 2/263 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RIGTR S LALA A   +  +    + P   + +  + T GD+I +  L +IGGKG
Sbjct: 2   KNHLRIGTRGSALALAQAAWVQQQIQ--GRYPQITVDLEIIKTTGDKIQDVALAKIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+EIE  ++SGE+D  VHS KD+PT++  GL I     RED RD FIS   +SL ++ 
Sbjct: 60  LFTKEIEMAILSGEVDLGVHSMKDVPTEIPLGLVIGITTVREDPRDAFISRKYRSLAEIP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
           L   IGT SLRR+A LL  R D+ ++  RG ++TRL KL      AI+LA AG+ RL + 
Sbjct: 120 LGGRIGTGSLRRRAQLLHLRPDLEIVPLRGNVDTRLRKLTEADLDAIILAAAGLHRLGRA 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I  IL      P+ GQGA+ +E   ++    EL++ ++  +T  +V  ERAFLA L+G
Sbjct: 180 AEITAILPETQMLPAIGQGALGLEYRQDDAVTMELLEFLDDPETRVAVAAERAFLARLEG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIV 265
            C+  IA     K   L+  G++
Sbjct: 240 GCQVPIAAMGTLKKGELFLDGLI 262


>gi|255320960|ref|ZP_05362133.1| porphobilinogen deaminase [Acinetobacter radioresistens SK82]
 gi|262379948|ref|ZP_06073103.1| porphobilinogen deaminase [Acinetobacter radioresistens SH164]
 gi|255301924|gb|EET81168.1| porphobilinogen deaminase [Acinetobacter radioresistens SK82]
 gi|262298142|gb|EEY86056.1| porphobilinogen deaminase [Acinetobacter radioresistens SH164]
          Length = 307

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 165/291 (56%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +I TR SPLAL  A   R+ L ++H  P   + ++   T+GD+I +  L +IGGKGLF 
Sbjct: 5   LKIATRKSPLALWQAEHIRACLQELH--PGLTVELVTFVTQGDKILDTPLAKIGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P  L  GL +     RED  D F+S+  +  + L   +
Sbjct: 63  KELEAALLDGRADLAVHSMKDVPMHLPTGLSLPVICEREDPCDAFVSNRFEGFEQLPKGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRRK  +L+ R D++++D RG + TRL+KL+  +  AI+LA AG+KRL   + I
Sbjct: 123 TVGTSSLRRKTQILKARPDLNILDLRGNVGTRLSKLDAGEYDAIILASAGLKRLGLSERI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           K  L+ E   P+ GQGA+ +E   ++    +L+  + HE T   V  ERAF + L+G C+
Sbjct: 183 KHTLSPELSLPAVGQGALGLECRTDDQAILDLISPLQHEQTSICVRAERAFNSHLEGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             IA +A  +   L   G V + DG I      +G    A  +G + A+ +
Sbjct: 243 VPIAAYATLENGQLQLEGRVGSVDGLILLSSQVSGQPEHAEQLGIELAENL 293


>gi|123440582|ref|YP_001004576.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332159812|ref|YP_004296389.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|158512667|sp|A1JI86|HEM3_YERE8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|122087543|emb|CAL10324.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318607646|emb|CBY29144.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664042|gb|ADZ40686.1| porphobilinogen deaminase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862558|emb|CBX72712.1| porphobilinogen deaminase [Yersinia enterocolitica W22703]
          Length = 313

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 162/293 (55%), Gaps = 2/293 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     L +
Sbjct: 59  KGLFVKELELALLEGRADIAVHSMKDVPIAFPEGLGLVTICERDDPRDAFVSINYAHLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+  + HAI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDKGEYHAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH +T   V  ERA    L
Sbjct: 179 LETRIRYAMPAEESLPAVGQGAVGIECRLDDNFTRQLLAPLNHRETELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
           +G C+  I  +A   G TL+   +V A DG       R G   +A  +G + A
Sbjct: 239 EGGCQVPIGSYAELDGDTLWLRALVGAPDGSEIIRGERRGPAENAEQMGVELA 291


>gi|191166073|ref|ZP_03027908.1| porphobilinogen deaminase [Escherichia coli B7A]
 gi|190903849|gb|EDV63563.1| porphobilinogen deaminase [Escherichia coli B7A]
          Length = 313

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 160/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH  T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHKTALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   +A  +G   A+ +
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEEL 294


>gi|325272336|ref|ZP_08138739.1| porphobilinogen deaminase [Pseudomonas sp. TJI-51]
 gi|324102530|gb|EGB99973.1| porphobilinogen deaminase [Pseudomonas sp. TJI-51]
          Length = 313

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 111/296 (37%), Positives = 163/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAH--PELRVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+   SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNHFASLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    +     L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITATISVDDSLPAGGQGAVGIECRSADHAIHALLAPLHHHDTADRVVAERAMNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G + A+++
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRATAEALGVEVAEHL 294


>gi|309796256|ref|ZP_07690666.1| porphobilinogen deaminase [Escherichia coli MS 145-7]
 gi|308120138|gb|EFO57400.1| porphobilinogen deaminase [Escherichia coli MS 145-7]
          Length = 320

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 160/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH  T   V  ERA    L+G C+
Sbjct: 191 RAALPPEISLPAVGQGAVGIECRLDDARTRELLAALNHHKTALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   +A  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQNAEQMGISLAEEL 301


>gi|126176187|ref|YP_001052336.1| porphobilinogen deaminase [Shewanella baltica OS155]
 gi|153002481|ref|YP_001368162.1| porphobilinogen deaminase [Shewanella baltica OS185]
 gi|166217785|sp|A3D9Q4|HEM3_SHEB5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|166217786|sp|A6WTG0|HEM3_SHEB8 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|125999392|gb|ABN63467.1| porphobilinogen deaminase [Shewanella baltica OS155]
 gi|151367099|gb|ABS10099.1| porphobilinogen deaminase [Shewanella baltica OS185]
          Length = 310

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 169/306 (55%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++    D AVHS KD+P    +GL +     RED RD F+S+  +S+ +
Sbjct: 59  KGLFVKELEVAMLDDLADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNLYKSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  +   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQIRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I   ++ E+  P+ GQGA+ IE  +N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSERIASFISAEESLPANGQGAVGIECRINDERVKALLAPLEHLETRYRVLAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEIDGDEMTLRGLVGNPDGSEIIEGVITGPKTEATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K + +
Sbjct: 299 AKTILD 304


>gi|59710673|ref|YP_203449.1| porphobilinogen deaminase [Vibrio fischeri ES114]
 gi|197333951|ref|YP_002154835.1| porphobilinogen deaminase [Vibrio fischeri MJ11]
 gi|75431912|sp|Q5E8T5|HEM3_VIBF1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226706298|sp|B5FF97|HEM3_VIBFM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|59478774|gb|AAW84561.1| hydroxymethylbilane synthase [Vibrio fischeri ES114]
 gi|197315441|gb|ACH64888.1| porphobilinogen deaminase [Vibrio fischeri MJ11]
          Length = 311

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 106/295 (35%), Positives = 165/295 (55%), Gaps = 2/295 (0%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           ++ P RI TR SPLAL  A   + +L   H  P   + ++ + TKGD I +  L ++GGK
Sbjct: 3   QQLPVRIATRKSPLALWQAHFVKDALQAAH--PGLEVELVTMVTKGDIILDTPLAKVGGK 60

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           GLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+T  ++ +L
Sbjct: 61  GLFVKELEVAMLEGRADLAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNTYNNIDEL 120

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT SLRR+  L   R D+ + + RG + TRL KL++    AI+LA AG+ RL  
Sbjct: 121 PQGAVVGTCSLRRQCQLKEARPDLIIKELRGNVGTRLQKLDDGNYDAIILACAGLIRLGL 180

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E  IK  +  E   P+ GQGA+ IE  +++ + + L++ +NH +T + V CERA    L+
Sbjct: 181 EDRIKSAIEPEQSLPAVGQGAVGIEARLDDDRLRALLEPLNHPETANRVLCERAMNNRLE 240

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           G C+  I  ++   G  ++   +V   DG +      +G   DA  +G   A  +
Sbjct: 241 GGCQVPIGSYSLIDGDQIWLRALVGEPDGSVMIRGEVSGPVSDAEALGTQLADQL 295


>gi|262040885|ref|ZP_06014111.1| hydroxymethylbilane synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259041774|gb|EEW42819.1| hydroxymethylbilane synthase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 318

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 109/289 (37%), Positives = 163/289 (56%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  +I TR SPLAL  A   ++ L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 6   MLDKVLKIATRQSPLALWQAQYVKARLEQAH--PGLKVELVPMVTRGDVILDTPLAKVGG 63

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  + L +     R+D RD F+S+   S+ +
Sbjct: 64  KGLFVKELELAMLEGRADIAVHSMKDVPVEFPECLGLVTICERDDPRDAFVSNRYASIDE 123

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R D+++   RG + TRL+KL+N +  AI+LA AG+KRL+
Sbjct: 124 LPAGSVVGTSSLRRQCQLAATRPDLAIRSLRGNVGTRLSKLDNGEYDAIILAAAGLKRLQ 183

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I++ L+ E   P+ GQGA+ IE  +++   + L+  +NH +T   V  ERA    L
Sbjct: 184 LEARIRQPLSPEQSLPAVGQGAVGIECRLDDAWTRGLLAPLNHTETAVRVRAERAMNTRL 243

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  K   L+   +V A DG       R G    A  +G
Sbjct: 244 EGGCQVPIGSYAELKDGELWLRALVGAPDGSQLVRGERRGPAEQAEALG 292


>gi|157144433|ref|YP_001451752.1| porphobilinogen deaminase [Citrobacter koseri ATCC BAA-895]
 gi|157081638|gb|ABV11316.1| hypothetical protein CKO_00147 [Citrobacter koseri ATCC BAA-895]
          Length = 318

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 161/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +L+  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKDALIAQH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   +L +L   S
Sbjct: 69  KELEVALLEKRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNQYNNLDELPAGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+KRL     I
Sbjct: 129 IVGTSSLRRQCQLAERRPDLVIRSLRGNVGTRLSKLDNGDYDAIILAVAGLKRLGLTSRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + Q L+  +NHE+T   V  ERA    L+G C+
Sbjct: 189 RTALPPEISLPAVGQGAVGIECRLDDARTQALLAPLNHEETALRVKAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAEIIDGEVWLRALVGAPDGSQMIRGERRGLPQDAAQMGISLAEEL 299


>gi|215484908|ref|YP_002327147.1| porphobilinogen deaminase [Acinetobacter baumannii AB307-0294]
 gi|301346814|ref|ZP_07227555.1| porphobilinogen deaminase [Acinetobacter baumannii AB056]
 gi|301512648|ref|ZP_07237885.1| porphobilinogen deaminase [Acinetobacter baumannii AB058]
 gi|301595532|ref|ZP_07240540.1| porphobilinogen deaminase [Acinetobacter baumannii AB059]
 gi|332851472|ref|ZP_08433469.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6013150]
 gi|332866846|ref|ZP_08437233.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6013113]
 gi|213987600|gb|ACJ57899.1| porphobilinogen deaminase [Acinetobacter baumannii AB307-0294]
 gi|332729925|gb|EGJ61256.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6013150]
 gi|332734374|gb|EGJ65495.1| hydroxymethylbilane synthase [Acinetobacter baumannii 6013113]
          Length = 309

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 167/293 (56%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L + H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 6   KTLKIATRQSPLALWQAEHIRARLQERH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 63

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 64  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 123

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   +
Sbjct: 124 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLAE 183

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G 
Sbjct: 184 RIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEGG 243

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 244 CQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNL 296


>gi|169797472|ref|YP_001715265.1| porphobilinogen deaminase [Acinetobacter baumannii AYE]
 gi|213155714|ref|YP_002317759.1| porphobilinogen deaminase [Acinetobacter baumannii AB0057]
 gi|169150399|emb|CAM88296.1| porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Acinetobacter
           baumannii AYE]
 gi|213054874|gb|ACJ39776.1| porphobilinogen deaminase [Acinetobacter baumannii AB0057]
          Length = 314

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 167/293 (56%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L + H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 11  KTLKIATRQSPLALWQAEHIRARLQERH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 68

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 69  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 128

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   +
Sbjct: 129 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLAE 188

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G 
Sbjct: 189 RIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDVCVRAERAFNAYLEGG 248

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 249 CQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNL 301


>gi|194469126|ref|ZP_03075110.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205358767|ref|ZP_02658924.2| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194455490|gb|EDX44329.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205332052|gb|EDZ18816.1| porphobilinogen deaminase [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 313

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 157/291 (53%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNKYHSLDVLPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  +   P+ GQGA+ IE  +++ + Q L+  +NH  T   V  ERA    L+G C+
Sbjct: 184 RTALPPDVSLPAVGQGAVGIECRLDDARTQALLAPLNHSQTALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G+   A  +G   A+ +
Sbjct: 244 VPIGSYAEIINGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEEL 294


>gi|254455286|ref|ZP_05068715.1| porphobilinogen deaminase [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082288|gb|EDZ59714.1| porphobilinogen deaminase [Candidatus Pelagibacter sp. HTCC7211]
          Length = 305

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 110/300 (36%), Positives = 177/300 (59%), Gaps = 4/300 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K   IG+R S LAL +A + +  ++    I   +I+I  ++TKGD++ +  L+E+GGKGL
Sbjct: 3   KKITIGSRGSKLALIYAQKAKDKIIQNTNIKDEDIIIKEITTKGDQVQDMRLSEVGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F+  IEK+L   +ID AVH+ KDMP     GL+ + +L R D R++ I+ + + L +L +
Sbjct: 63  FSTNIEKELQDKKIDIAVHALKDMPAIETVGLRTNTFLKRNDPREILIAQSGKKLNELKI 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
           +S+IGTSS RR+  + + RSDI+    RG ++TR+ KLN+    AI+L+YAGIK L+ E 
Sbjct: 123 NSIIGTSSYRREFQIKKIRSDINCKLIRGNVDTRIKKLNDGLYDAIILSYAGIKSLEIED 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I EI +IE+  PS GQG I ++   N+ +   ++  IN ++T    + ER  L  L+G 
Sbjct: 183 KITEIFSIEEIIPSAGQGIIALQCRNNDIEIISVLDEINDKETSSMAHAERNVLKVLEGD 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           C++AI   A  +   +     + + DGK   F + S   N  DA  +G++  + ++  SN
Sbjct: 243 CETAIGTHAIIEEDKIILQAELFSLDGKQRFFEKKSSKIN--DARELGKELGEILKTKSN 300


>gi|238793582|ref|ZP_04637206.1| Porphobilinogen deaminase [Yersinia intermedia ATCC 29909]
 gi|238727172|gb|EEQ18702.1| Porphobilinogen deaminase [Yersinia intermedia ATCC 29909]
          Length = 313

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 160/289 (55%), Gaps = 2/289 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD I +  L ++GG
Sbjct: 1   MLDKIIRIATRQSPLALWQAHYVQHLLQANH--PGLQVELVPMVTRGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+ G  D AVHS KD+P    +GL +     R+D RD F+S     + D
Sbjct: 59  KGLFVKELELALLDGRADIAVHSMKDVPVAFPEGLGLVTICERDDPRDAFVSPHFAHIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL KL+N   HAI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYHAIILAVAGLNRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE  +++   ++L+  +NH  T   V  ERA    L
Sbjct: 179 LASRIRYAMPAEESLPAVGQGAVGIECRLDDDFTRQLLAPLNHRVTELRVCAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  I  +A  +G+TL+  G+V A DG       R G   +A  +G
Sbjct: 239 EGGCQVPIGSYAELEGNTLWLRGLVGAPDGSEIIRGERRGPAENAEQMG 287


>gi|77461708|ref|YP_351215.1| porphobilinogen deaminase [Pseudomonas fluorescens Pf0-1]
 gi|123602840|sp|Q3K4T0|HEM3_PSEPF RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|77385711|gb|ABA77224.1| porphobilinogen deaminase [Pseudomonas fluorescens Pf0-1]
          Length = 313

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 109/275 (39%), Positives = 160/275 (58%), Gaps = 3/275 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEAAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLENEADIAVHSMKDVPMDFPEGLGLFCICEREDPRDAFVSNTYSSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLTRRPDLEIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSADTEIHALLAPLHHADTADRVTAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIV-LASDGKIFH 274
           +G C+  IA +A  +G  L+  G+V   S GK+ +
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGEPSGGKLLN 273


>gi|167031229|ref|YP_001666460.1| porphobilinogen deaminase [Pseudomonas putida GB-1]
 gi|189028150|sp|B0KH05|HEM3_PSEPG RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|166857717|gb|ABY96124.1| porphobilinogen deaminase [Pseudomonas putida GB-1]
          Length = 313

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 162/294 (55%), Gaps = 2/294 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFDSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHADTADRVVAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRTAAETLGVQVAE 292


>gi|322421444|ref|YP_004200667.1| porphobilinogen deaminase [Geobacter sp. M18]
 gi|320127831|gb|ADW15391.1| porphobilinogen deaminase [Geobacter sp. M18]
          Length = 318

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 164/290 (56%), Gaps = 5/290 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L    + P   + +  + T GD+I +  L ++GG
Sbjct: 1   MALKELRIGTRASQLALWQANWVKSELE--KRYPDMTVTLKKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  IS   +   D
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVISRGVK-FAD 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG ++TR++KL      A++LA AG+ RL 
Sbjct: 118 LPQGARIGTSALRRQAQLLKVRPDLEMVIIRGNVQTRMDKLETEGLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I E+L  +   P+ GQGA+ IE  ++N + ++ +   NH DT  +V  ERA L   
Sbjct: 178 FADQITELLPTDLSLPAIGQGALGIECSLSNEEVKDAISFFNHPDTSRAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHE--VSRNGNRCDAINI 288
           +G C+  IA +    G  L   G + + DGK+  +  V+   + C+ + +
Sbjct: 238 EGGCQVPIAAYGEVTGDQLKLTGFIASVDGKVSVKGVVTGPADECEKLGV 287


>gi|183600277|ref|ZP_02961770.1| hypothetical protein PROSTU_03837 [Providencia stuartii ATCC 25827]
 gi|188020068|gb|EDU58108.1| hypothetical protein PROSTU_03837 [Providencia stuartii ATCC 25827]
          Length = 314

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 155/265 (58%), Gaps = 2/265 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A+  +  L   H  P   + ++P+ TKGD I +  L ++GGKGLF 
Sbjct: 7   VRIATRKSPLALWQAYFVKEKLEQFH--PGLQVELVPMVTKGDIILDTPLAKVGGKGLFV 64

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 65  KELELALLEKRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNQYDSLDALPAGS 124

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  L   R D+ + D RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 125 VVGTSSLRRQCQLRELRPDLVIRDLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLEARI 184

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + ++L++ +N ++T   V  ERA    L+G C+
Sbjct: 185 RTALAPEQSLPAVGQGAVGIECRLDDERTRQLLEKLNDDNTSVCVLAERAMNMRLEGGCQ 244

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDG 270
             I  +A  +   ++   +V A DG
Sbjct: 245 VPIGSYAIWQDGQIWLRALVGAPDG 269


>gi|163797975|ref|ZP_02191917.1| Porphobilinogen deaminase [alpha proteobacterium BAL199]
 gi|159176769|gb|EDP61340.1| Porphobilinogen deaminase [alpha proteobacterium BAL199]
          Length = 321

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 111/303 (36%), Positives = 159/303 (52%), Gaps = 5/303 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           +G+R SPLAL    E R  L          I +  + T GD + +R L EIGGKGLF +E
Sbjct: 17  LGSRGSPLALRQTHEVRDRLAAAWPELAGAIAVQEIRTTGDAVRDRPLAEIGGKGLFIKE 76

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L++G+ID AVHS KDM T +     + A LPRED RD ++S  A  + DL   + I
Sbjct: 77  IEQALMAGQIDAAVHSMKDMETTIAPASVLVAVLPREDPRDAWLSPIADRVDDLPSGAKI 136

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GT+S+RR A +L  R D+ V+ FRG ++TRL KL   +     LA AG+ RL        
Sbjct: 137 GTASVRRAAQVLNRRPDLQVVLFRGNVDTRLRKLAEGEVAGTFLAAAGLSRLGMLDKATR 196

Query: 188 ILNIEDFPPSPGQGAICI-----ETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           IL +++  P+  QGAI +     E    + + +  + +++   +   V  ERA LA LDG
Sbjct: 197 ILEVDEMLPAVSQGAIGVQCRDGEASARDAEIRNWLSILDDRPSRLRVTAERAMLATLDG 256

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
           SC++ IAG A   G+ L   G+V + DG+  H         D   +GR   + I     +
Sbjct: 257 SCRTPIAGHATLGGARLTLSGMVFSLDGQSSHGAVDTSATDDPEALGRTVGEAILARGGR 316

Query: 303 NVF 305
           N  
Sbjct: 317 NFL 319


>gi|148655885|ref|YP_001276090.1| porphobilinogen deaminase [Roseiflexus sp. RS-1]
 gi|166217784|sp|A5UU37|HEM3_ROSS1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|148567995|gb|ABQ90140.1| hydroxymethylbilane synthase [Roseiflexus sp. RS-1]
          Length = 303

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 161/287 (56%), Gaps = 3/287 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+   IGTR S LAL   +  R +L   H  P   + +  ++T+GD I +R L  IG KG
Sbjct: 2   KQTLIIGTRASKLALVQTYMVRDALQSAH--PGLTVAVEHITTRGDIILDRPLNAIGDKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF  EIE+ + +G ID AVHSAKD+P+ L   + ++A   R D RD  ++    +L  L 
Sbjct: 60  LFVVEIEEAMRAGRIDLAVHSAKDLPSVLPPDMTLAACPRRADPRDALVAQPGMTLAALP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR   L   R D++++D RG ++TRL KL   +  AI+LA AG+KRL  +
Sbjct: 120 SGARVGTSSLRRACQLRALRPDLTLVDLRGNVDTRLRKLREGQYDAIVLAAAGLKRLGLD 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I E++  +   P+ GQG I +E   ++ +   L+  ++ +    ++  ERAFLA + G
Sbjct: 180 GAISELIEPDVLIPAVGQGVIGVEARADDEEVLRLLAPLDDQAARIAITAERAFLARIGG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
            C+  +   A+ +G  L   G++ A DG++   + R G+  D + +G
Sbjct: 240 GCQVPVGALAHLEGDELLLRGMIGARDGRMVRGMQR-GSASDPVGLG 285


>gi|325690356|gb|EGD32360.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK115]
          Length = 306

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 114/310 (36%), Positives = 172/310 (55%), Gaps = 16/310 (5%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L ++H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVEQLKELH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KRL   
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLAFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLG-- 177

Query: 183 KVIKEILNIEDFP-----PSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
            + + +L+I+        P+  QGA+ +E    + + ++L+  +  E T   V  ERA L
Sbjct: 178 WLDQSLLHIQPLETRLCLPAISQGALAVEYREEDEELRKLLATVQDEKTAAEVAVERAVL 237

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           A+++  C   IA  A  KG       ++   DG+    VS  G     +     A Q +R
Sbjct: 238 AQMNADCTFPIAALAQKKGQDYQLEAMLAKEDGQCVF-VSLQGQDGQEL-----AEQAVR 291

Query: 298 FISNKNVFNF 307
            +++K     
Sbjct: 292 QLADKGAVGM 301


>gi|121535332|ref|ZP_01667145.1| porphobilinogen deaminase [Thermosinus carboxydivorans Nor1]
 gi|121306118|gb|EAX47047.1| porphobilinogen deaminase [Thermosinus carboxydivorans Nor1]
          Length = 317

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 117/303 (38%), Positives = 167/303 (55%), Gaps = 2/303 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K    IGTR S LAL  A      L   H  P   + I  + T GD+I +  L +IGGKG
Sbjct: 2   KNKLVIGTRGSKLALWQANYIAHRLCQYH--PGLEVTIKHIVTTGDKILDVPLAKIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           +FT+EIE  ++ GEID AVHS KDMPT+L  GL ++A   RE+  D  IS    +L  L 
Sbjct: 60  VFTKEIELAMLRGEIDLAVHSLKDMPTELPPGLTLAAITEREEPFDALISPKYGTLDKLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR+A LL  R D++V D RG ++TRL KL   +  AI+LA AG+KRL  +
Sbjct: 120 HGAKVGTSSLRRRAQLLNCRPDLTVCDLRGNVDTRLRKLETEELDAIVLAQAGLKRLGWD 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I + L  +   P+ GQGA+ +ET  ++ +   LV  ++ EDT  +V  ER+FL EL+G
Sbjct: 180 DRITQQLPPDICLPAVGQGALALETRSDDSEVLALVAFLHDEDTAAAVTAERSFLNELEG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNK 302
            C+  I  +   +   L     +L+ DG    +    G    A ++GR  AQ++     +
Sbjct: 240 GCQVPIGVYGRVENGELVLDAAILSLDGAAALKDRICGAPAAAEDLGRKLAQHMYVTGGR 299

Query: 303 NVF 305
            + 
Sbjct: 300 EIL 302


>gi|269137476|ref|YP_003294176.1| porphobilinogen deaminase [Edwardsiella tarda EIB202]
 gi|267983136|gb|ACY82965.1| porphobilinogen deaminase [Edwardsiella tarda EIB202]
 gi|304557549|gb|ADM40213.1| Porphobilinogen deaminase [Edwardsiella tarda FL6-60]
          Length = 317

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 112/284 (39%), Positives = 152/284 (53%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   R  L+     P   I ++P+ T+GD + +  L ++GGKGLF 
Sbjct: 12  LRIATRQSPLALWQAHYVRDQLL--THWPQLTIELVPMVTRGDVLLDTPLAKVGGKGLFV 69

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+ G  D AVHS KD+P     GL +     RED RD F+S    SL+ L   S
Sbjct: 70  KELELALLEGRADIAVHSMKDVPVAFPDGLGLVTICQREDPRDAFVSPRFASLEQLPPGS 129

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  L   R D+ + D RG + TRL KL+     AI+LA AG+KRL+ +  I
Sbjct: 130 VVGTSSLRRQCQLRAARPDLQIRDLRGNVGTRLAKLDAGDYDAIILAAAGLKRLQLDDRI 189

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  + +   + L+  +NH DT   V  ERA    L+G C+
Sbjct: 190 RTPLTPEQSLPAVGQGAVGIECRLADDATRRLLAPLNHADTALRVCAERAMNTRLEGGCQ 249

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A   G  L+   +V A DG       R G    A  +G
Sbjct: 250 VPIGSYAEIDGDQLWLRALVGAPDGSRIIRGERRGPLTQAEAMG 293


>gi|148204|gb|AAA67601.1| porphobilinogen deaminase [Escherichia coli str. K-12 substr.
           MG1655]
          Length = 320

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 160/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 13  LRIATRQSPLALWQAHYVKDKLMASH--PGLVVELVPMVTRGDVILDXPLAKVGGKGLFV 70

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 71  KELEVALLENRADIAVHSMKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 130

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 131 IVGTSSLRRQCQLGERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 190

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 191 RAGLPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAMNTRLEGGCQ 250

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V   DG       R G   DA  +G   A+ +
Sbjct: 251 VPIGSYAELIDGEIWLRALVGRPDGSQIIRGERRGAPQDAEQMGISLAEEL 301


>gi|237801592|ref|ZP_04590053.1| porphobilinogen deaminase [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331024452|gb|EGI04508.1| porphobilinogen deaminase [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 313

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 165/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   +S L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSTREIRIATRQSALALWQAEYVKSRLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLEDRADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFDSLQA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   +++ED  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVEDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G + A+ +
Sbjct: 239 NGGCQVPIACYAILEGDDVWLRGLVGDPSGSVLLHAEARAPQTSAQALGVEVAEAL 294


>gi|120600512|ref|YP_965086.1| porphobilinogen deaminase [Shewanella sp. W3-18-1]
 gi|146294670|ref|YP_001185094.1| porphobilinogen deaminase [Shewanella putrefaciens CN-32]
 gi|158512986|sp|A1RPD7|HEM3_SHESW RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|166217787|sp|A4YBG2|HEM3_SHEPC RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|120560605|gb|ABM26532.1| porphobilinogen deaminase [Shewanella sp. W3-18-1]
 gi|145566360|gb|ABP77295.1| porphobilinogen deaminase [Shewanella putrefaciens CN-32]
 gi|319427906|gb|ADV55980.1| porphobilinogen deaminase [Shewanella putrefaciens 200]
          Length = 310

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 168/306 (54%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +   RI TR SPLA+  A   ++ L  +H  P   + ++P+STKGD I +  L ++GG
Sbjct: 1   MSENRIRIATRKSPLAMWQAEFVKAELERIH--PGIVVELLPMSTKGDVILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++  + D AVHS KD+P    +GL +     RED RD F+S+  +++ +
Sbjct: 59  KGLFVKELEVAILEDQADIAVHSMKDVPVDFPEGLGLEVICEREDPRDAFVSNIYKTISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L + +GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+ RLK
Sbjct: 119 LPLGATVGTSSLRRQCQLRASRPDLIIKDLRGNVGTRLAKLDNGEYDAIILAAAGLIRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   ++ E   P+ GQGA+ IE   N+ + + L+  + H +T   V  ERA    L
Sbjct: 179 LSGRIASFISAEQSLPANGQGAVGIECRTNDERVKALLAPLEHLETRYRVIAERAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  I  FA   G  +   G+V   DG    E    G + +A  +G   A+ +    
Sbjct: 239 EGGCQVPIGAFAEINGDEMTLRGLVGNPDGSEIIEGIITGPKTEATQLGVALAEELLSKG 298

Query: 301 NKNVFN 306
            K++ +
Sbjct: 299 AKSILD 304


>gi|161505549|ref|YP_001572661.1| porphobilinogen deaminase [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189028154|sp|A9MJ10|HEM3_SALAR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|160866896|gb|ABX23519.1| hypothetical protein SARI_03714 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 313

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 156/291 (53%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +I TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LKIATRQSPLALWQAHYVKDALMATH--PGLTVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+   SL DL   S
Sbjct: 64  KELEIALLEKRADIAVHSMKDVPVAFPDGLGLVTICEREDPRDAFVSNQYHSLDDLPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL     I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLASRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGAI IE  +++ +   L+  +NH  T   V  ERA    L+G C+
Sbjct: 184 RTALPPEVSLPAVGQGAIGIECRLDDARTHALLAPLNHPQTALRVTAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      ++   +V A DG +     R G+   A  +G   A+ +
Sbjct: 244 VPIGSYAEIFNGEIWLRALVGAPDGSVMVRGERRGSPEQAEQMGISLAEEL 294


>gi|242237686|ref|YP_002985867.1| porphobilinogen deaminase [Dickeya dadantii Ech703]
 gi|242129743|gb|ACS84045.1| porphobilinogen deaminase [Dickeya dadantii Ech703]
          Length = 313

 Score =  192 bits (488), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 106/284 (37%), Positives = 157/284 (55%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P   + ++P+ T+GD + +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVQQRLQACH--PGLRVELVPMVTRGDVLLDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +    L +     R+D RD F+S+   +L  L   +
Sbjct: 64  KELELALLEDRADIAVHSMKDVPVEFPAQLGLVTICERDDPRDAFVSNRYANLDALPPGA 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  L   R D+ + D RG + TRL KL+N    AI+LA AG+ RL  E  I
Sbjct: 124 VVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLGKLDNGDYDAIILAVAGLNRLGLEGRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L+ E   P+ GQGA+ +E  +++ + + L+  +NH+DT   V  ERA    L+G C+
Sbjct: 184 RAALSPEQSLPAVGQGAVGVECRLDDTRTRALLAPLNHDDTAARVLAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A  +G  ++   +V + DG       R G R DA  +G
Sbjct: 244 VPIGSYAELQGDAIWLRALVGSPDGSRIIRGERTGRRQDAEQLG 287


>gi|90406695|ref|ZP_01214888.1| porphobilinogen deaminase [Psychromonas sp. CNPT3]
 gi|90312148|gb|EAS40240.1| porphobilinogen deaminase [Psychromonas sp. CNPT3]
          Length = 311

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 162/296 (54%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RI TR SPLA+  A   +S L+  H  P   + ++ + TKGD+I +  L ++GG
Sbjct: 1   MSNKIIRIATRHSPLAMWQANFVKSELLKWH--PELQVELLAMKTKGDKILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P    +GL ++    RED RD F+S+   ++  
Sbjct: 59  KGLFVKELEVAILEGRADIAVHSMKDVPVDFPEGLGLAVICEREDPRDAFVSNHFANIAA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+  L   R DI V D RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPQGSVVGTSSLRRQCQLRAQRPDIKVKDLRGNVNTRLAKLDAGEYDAIILASAGLIRLD 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   +++E+  P+ GQGA+ IE  +++ +   L+K + H  T   V  ERA    L
Sbjct: 179 MHDRIASYMSVEESLPAVGQGAVGIECRLDDMQTLALLKPLEHRITRLRVTAERAMNLAL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            G C+  I  +   K  TL+  G+V + DG         G   DA  +G + AQ +
Sbjct: 239 QGGCQVPIGSYCILKEDTLWLRGLVGSVDGTHIIRKEIRGKVADAEQMGLNLAQQL 294


>gi|254784450|ref|YP_003071878.1| hydroxymethylbilane synthase [Teredinibacter turnerae T7901]
 gi|237686105|gb|ACR13369.1| hydroxymethylbilane synthase [Teredinibacter turnerae T7901]
          Length = 324

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 170/289 (58%), Gaps = 6/289 (2%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR S LAL  A   +S L   H  P   + ++PL+++GD+I +  L ++GGKG
Sbjct: 15  KHTLRIATRKSALALWQAEFVKSELCRHH--PELAVELVPLTSRGDKILDVPLAKVGGKG 72

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E+ +I+GE D AVHS KD+P +  +GL ++    RED RD  +S+   +L  + 
Sbjct: 73  LFVKELEQAIIAGEADIAVHSMKDVPMEFPQGLGLAVICEREDPRDALVSNKYSNLDAIP 132

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +VIGTSSLRR++ LL  R D+ V   RG + TRL KL+  +  AI+LA AG+KRL+  
Sbjct: 133 AGAVIGTSSLRRQSQLLAMRPDLEVTFLRGNVNTRLAKLDAGEYDAIILASAGLKRLQMV 192

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I E +  E   P+ GQGA+ IE   ++ +   L++ ++H  T  +V  ERA   +L+G
Sbjct: 193 DRIAEFIAPEVMLPAGGQGAVGIECRTDDQETLALLQPLHHGVTEQAVLAERAMNRKLEG 252

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSRNGNRCDAINIG 289
            C+  I GFA  + + L+  G+V   DG   ++ +V   G+  DA  +G
Sbjct: 253 GCQVPIGGFAIHQDNQLWVRGLVADPDGSEVLYDQVI--GDPADAETLG 299


>gi|300115116|ref|YP_003761691.1| porphobilinogen deaminase [Nitrosococcus watsonii C-113]
 gi|299541053|gb|ADJ29370.1| porphobilinogen deaminase [Nitrosococcus watsonii C-113]
          Length = 314

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 113/268 (42%), Positives = 156/268 (58%), Gaps = 2/268 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR S LAL  A    ++L   H  P  ++ ++ +ST+GD+I +  L +IGGKG
Sbjct: 8   KTCLRIATRKSLLALWQAEYVANTLR--HHYPDLSVELVRMSTQGDKILDTPLAKIGGKG 65

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E+ L SGE D AVHS KD+P  L + L I+    R D RD F+S+  Q L  L 
Sbjct: 66  LFIKELEQGLFSGEADIAVHSMKDVPVDLPENLHIAVICQRGDPRDAFVSNHWQDLDSLP 125

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR++ +   R D  V+D RG + TRL KL+NN+   I+LA AG+KRL+  
Sbjct: 126 EGARLGTSSLRRQSQVRERRPDFQVLDLRGNVNTRLAKLDNNEFDGIILATAGLKRLELT 185

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I+E L  E   P+ GQGAI IE    +   +EL+KV+ H  T  ++  ERA  A L G
Sbjct: 186 HRIRESLAPEVSLPAIGQGAIGIECRKGDTATEELIKVLEHPPTRITLQAERALNARLAG 245

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            C+  IAG+A  +   L    +V   DG
Sbjct: 246 GCQVPIAGYAELEDERLRLRALVGQPDG 273


>gi|108761567|ref|YP_630875.1| porphobilinogen deaminase [Myxococcus xanthus DK 1622]
 gi|123374611|sp|Q1D8Z8|HEM3_MYXXD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|108465447|gb|ABF90632.1| porphobilinogen deaminase [Myxococcus xanthus DK 1622]
          Length = 314

 Score =  192 bits (487), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 151/265 (56%), Gaps = 2/265 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A    + L   H  P   + ++ ++T+GDR  +  L+ +GGKGLF 
Sbjct: 5   VRIATRQSPLALWQARHVGALLTSRH--PGLEVTLVEMTTEGDRFLSAPLSAVGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G  D AVHS KDM +   +GL ++A   RED RDVF      +L  L   +
Sbjct: 63  KEIEQALLDGRADIAVHSLKDMTSVFPEGLILAAVPEREDPRDVFCGLGGLTLDTLPQGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR  +L   R D+ ++  RG ++TRL +         LLAYAG+KRL  E VI
Sbjct: 123 RVGTSSLRRSCILRSRRPDVDIVSVRGNVQTRLARTREQGLAGALLAYAGLKRLGLEDVI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++L  E   P+ GQG + I+   ++ + + L+  + H  T  +V  ERA LA+L+G C 
Sbjct: 183 TQVLPPEVSLPAVGQGVLAIQCRTDDARVRALLVPLEHATTRIAVTAERALLAKLEGGCT 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDG 270
             +AG+A   G T++  G+V   DG
Sbjct: 243 VPLAGYATVSGDTVFLRGLVGRPDG 267


>gi|78044433|ref|YP_360051.1| porphobilinogen deaminase [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|123756773|sp|Q3ACT3|HEM3_CARHZ RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|77996548|gb|ABB15447.1| porphobilinogen deaminase [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 311

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 167/294 (56%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK   +G+R S LAL         L  +H  P  N  I+ + TKGD+I +  L +IG KG
Sbjct: 2   KKEVIVGSRDSALALWQTNWVVERLSKIH--PEINFKIVTMKTKGDKILDVALAKIGDKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LFT+E+E  L++  ID AVHS KD+PT L +GL+I A+  RE   DVFIS       +L 
Sbjct: 60  LFTKELEHALLNKTIDMAVHSMKDLPTVLPEGLKIGAFCEREYPGDVFISPKGFKFLELP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + IGTSSLRR A +L  R D+  I  RG + TR  K+       I+LAYAG+KRL  E
Sbjct: 120 QGARIGTSSLRRIAQILAVRPDLQAIPLRGNLPTRFRKMEEMDLDGIILAYAGVKRLGYE 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I E+L+ +   P+ GQG+I +E   ++   +EL+K I+H  T  ++  ERAFL  L+G
Sbjct: 180 DKITEMLSFDLCLPAVGQGSIGVEIRADDTFIEELLKPIDHFATNRAIRAERAFLKRLEG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  I  ++  K + L+  G+V + DGK+  +  + G+  +   +G   A+ +
Sbjct: 240 GCQIPIGAYSEVKENRLHLKGVVASLDGKLVIKGEKEGSIEEPEKVGISLAEEL 293


>gi|59727198|gb|AAW92125.1| hydroxymethylbilane synthase [Enterobacter asburiae]
          Length = 313

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 158/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H      + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKQRLEACHS--GLRVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELELALLENRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYDSLDALPKGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 124 VVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH++T   V  ERA    L+G C+
Sbjct: 184 RVALPPELSLPAVGQGAVGIECRLDDARTRELLAPLNHDETAIRVKAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      L+   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELTEGELWLRALVGAPDGSQMVRGERRGKAQDAEQLGVSLAEEL 294


>gi|283787518|ref|YP_003367383.1| porphobilinogen deaminase [Citrobacter rodentium ICC168]
 gi|282950972|emb|CBG90649.1| porphobilinogen deaminase [Citrobacter rodentium ICC168]
          Length = 313

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 160/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   + +LM  H  P   + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDALMANH--PGLVVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +   GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLEKRADIAVHSMKDVPVEFPAGLGLVTICEREDPRDAFVSNNYPSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + Q L+  +N E T   V  ERA    L+G C+
Sbjct: 184 RAALPPEVSLPAVGQGAVGIECRLDDRRTQALLAPLNDEITALRVKAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      L+   +V A DG +     R G+   A  +G   A+ +
Sbjct: 244 VPIGSYAEMIDGELWLRALVGAPDGSLMVRGERRGSPEQAEQMGISLAEEL 294


>gi|330993440|ref|ZP_08317375.1| Porphobilinogen deaminase [Gluconacetobacter sp. SXCC-1]
 gi|329759470|gb|EGG75979.1| Porphobilinogen deaminase [Gluconacetobacter sp. SXCC-1]
          Length = 360

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 168/321 (52%), Gaps = 25/321 (7%)

Query: 5   PFRIGTRCSPLALAH--AFETRSS-----LMDVHKIPPHNIVIIPLSTKGDRITNRTLTE 57
           P ++GTR SPLAL    AF T  +     L D+     H I     ST GD++ NR L E
Sbjct: 41  PLKVGTRASPLALVQTRAFLTVLTRFCPVLRDMGAFQEHQI-----STTGDQVQNRKLAE 95

Query: 58  IGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI------ 111
           IGGKGLF +EI + L+ G ID AVHS KD+ T L  GL ++  L RED RDV I      
Sbjct: 96  IGGKGLFAKEIHEALLDGRIDFAVHSLKDLETTLPPGLVLACTLKREDARDVLILGPGCG 155

Query: 112 -SHTAQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAIL 170
               A     L   +++G +S+RR+A +L  R D+     RG ++TRL+KL   +  A L
Sbjct: 156 EPDPADPYSVLPQGALVGCASVRRQAQMLHVRPDLKFGLLRGNVQTRLDKLAARQCDATL 215

Query: 171 LAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSV 230
           LAYAG++RL  E     IL+     P+ GQG + +    ++ + +EL+  I   +     
Sbjct: 216 LAYAGLRRLGMEDRADVILDPTIMVPAAGQGIVGVTVRESDVELRELLSAIEDYEARAVA 275

Query: 231 NCERAFLAELDGSCKSAIAGFAYC------KGSTLYFYGIVLASDGKIFHEVSRNGNRCD 284
             ERA LAELDGSC++ I G+A            L+  G+V   DG    + S +G   D
Sbjct: 276 TAERALLAELDGSCRTPIGGYARLIPVVAGGAPELHLTGLVAREDGSFLLKRSISGAPAD 335

Query: 285 AINIGRDAAQYIRFISNKNVF 305
           A  +GRD  + +R  S  ++F
Sbjct: 336 AARLGRDLGRSLRADSPADIF 356


>gi|226951768|ref|ZP_03822232.1| porphobilinogen deaminase [Acinetobacter sp. ATCC 27244]
 gi|226837483|gb|EEH69866.1| porphobilinogen deaminase [Acinetobacter sp. ATCC 27244]
          Length = 305

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   RS L  ++  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 2   KTLKIATRQSPLALWQAEHIRSRLNTLY--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L  GL ++    RED  D F+S+     +DL  
Sbjct: 60  FVKELEAALLDGRADLAVHSMKDVPMHLPDGLTLAVICEREDPLDAFVSNQYARFEDLPQ 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK  +L+ R D+ +ID RG + TRL+KL++    AI+LA AG+KRL    
Sbjct: 120 GAKVGTSSLRRKCQILQQRPDLEIIDLRGNVGTRLSKLDDGLYDAIILASAGLKRLGLAD 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L      P+ GQGA+ +E   ++ K   L++ + HE+T   V  ERA  A L+G 
Sbjct: 180 RIRHCLAPVLSLPAVGQGALGLECRADDEKLLALIQPLQHEETSICVRAERALNAYLEGG 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           C+  IAG+A      L   G V + DGK   +    G+   A  +G   AQ
Sbjct: 240 CQVPIAGYATIVNHQLQIEGRVGSVDGKTLLKKQLIGSTDQAEQLGEQLAQ 290


>gi|288550563|ref|ZP_06391088.1| hydroxymethylbilane synthase [Enterobacter cancerogenus ATCC 35316]
 gi|288314627|gb|EFC53565.1| hydroxymethylbilane synthase [Enterobacter cancerogenus ATCC 35316]
          Length = 318

 Score =  191 bits (486), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 159/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H      + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 11  LRIATRQSPLALWQAHYVKQRLEACHS--GLRVELVPMVTRGDVILDTPLAKVGGKGLFV 68

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     R+D RD F+S+   SL  + + S
Sbjct: 69  KELELALLENRADIAVHSMKDVPVEFPQGLGLVTICERDDPRDAFVSNHYDSLDAMPVGS 128

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  L   R D+ +   RG + TRL KL+N +  AI+LA AG+KRL  E  I
Sbjct: 129 VVGTSSLRRQCQLAERRPDLVIRSLRGNVGTRLGKLDNGEYDAIILAVAGLKRLDLESRI 188

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + + L+  +NH+DT   V  ERA    L+G C+
Sbjct: 189 RVALPPEFSLPAVGQGAVGIECRLDDDRTRALLAPLNHDDTAIRVKAERAMNTRLEGGCQ 248

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      L+   +V A DG       R G   DA  +G   A+ +
Sbjct: 249 VPIGSYAELSNGELWLRALVGAPDGSQMVRGERRGKPQDAEALGVSLAEEL 299


>gi|155967344|gb|ABU41508.1| HemC [Heliophilum fasciatum]
          Length = 315

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 162/287 (56%), Gaps = 3/287 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P  IGTR S LAL         L    + P     I  + TKGD+I +  L +IG KGL
Sbjct: 6   RPIVIGTRDSALALWQTHWVLEQLQ--ARFPEQRFEIKAIKTKGDKILDVALAKIGDKGL 63

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT+E+E  ++ GE+D AVHS KD+PT+L +GL + A   RED RDV I  TA++L +L  
Sbjct: 64  FTKELEVAMLEGEVDMAVHSLKDLPTQLPEGLTVGAMCIREDYRDVLIGRTARTLAELKP 123

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GT+SLRRK+ + + R D+ ++D RG ++TR+ K+       I+LA AG+ RL    
Sbjct: 124 GARVGTASLRRKSQIWKVRPDLELLDIRGNLQTRMRKMEEQDLDGIILAAAGVLRLGWAD 183

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I + ++ +   P+ GQG++ IE    +     +V  +NH+DT D +  ERA +  L+G 
Sbjct: 184 KITQYIDEDVCLPAVGQGSVGIEIRDGDEAIARVVGALNHKDTADCITAERALMRTLEGG 243

Query: 244 CKSAIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           C+  I       +  +L  +G+V + DG+        G+R +A ++G
Sbjct: 244 CQVPIGALGKLGEDDSLTLHGVVASLDGREICRDQVTGHRSEAADLG 290


>gi|327469193|gb|EGF14665.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK330]
          Length = 306

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 114/308 (37%), Positives = 169/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L ++H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKELH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLTFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            +  +  + L      P+  QGA+ +E    + +  +L+  +  E T   V  ERA LA+
Sbjct: 180 DQSHLHIQPLETSLCLPAISQGALAVECREEDKELLQLLATVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA FA  KG       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAAFAQKKGQDYQLEAMLAKEDGQCVF-VSLKGQDGQEL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|148262442|ref|YP_001229148.1| porphobilinogen deaminase [Geobacter uraniireducens Rf4]
 gi|189028092|sp|A5GCW2|HEM3_GEOUR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|146395942|gb|ABQ24575.1| porphobilinogen deaminase [Geobacter uraniireducens Rf4]
          Length = 318

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 112/290 (38%), Positives = 162/290 (55%), Gaps = 5/290 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L    + P   + ++ + T GD+I +  L ++GG
Sbjct: 1   MALKTLRIGTRASQLALWQANWVKSELE--KRYPGLEVSLLKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ G+ID AVHS KD+PT+  +GL +     RED RD  IS   +   D
Sbjct: 59  KGLFVKEIEEAMLRGDIDIAVHSMKDVPTEFPEGLGLHCITEREDPRDAVISRGIK-FAD 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG +ETR+NKL      A++LA AG+KRL 
Sbjct: 118 LPKGAKIGTSALRRQAQLLKIRPDMEMVIIRGNVETRINKLEAENLDAVILAAAGLKRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               + E L  +   P+ GQGA+ IE  ++N + +  +   NH  T  +V  ERA L   
Sbjct: 178 FTDKVAEYLPTDLSIPAIGQGALGIECRLDNEEVKSAIDFFNHPATAYAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSRNGNRCDAINI 288
           +G C+  IA F   +G  L   G + + DGK  +   VS     C+ + I
Sbjct: 238 EGGCQVPIAAFGEVEGDQLKLTGFIASVDGKTSVKGSVSGPAEECEKLGI 287


>gi|156742007|ref|YP_001432136.1| porphobilinogen deaminase [Roseiflexus castenholzii DSM 13941]
 gi|189028097|sp|A7NKU8|HEM3_ROSCS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|156233335|gb|ABU58118.1| porphobilinogen deaminase [Roseiflexus castenholzii DSM 13941]
          Length = 303

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 161/294 (54%), Gaps = 3/294 (1%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           +    IGTR S LAL      R +L   H  P   + +  ++T+GD I +R L  IG KG
Sbjct: 2   RNSLTIGTRASKLALVQTHMIRDALQAAH--PGLTVAVERITTRGDIILDRPLNAIGDKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF  EIE+ + +G +D AVHSAKD+P+ L   + ++    R D RD  ++    +L  L 
Sbjct: 60  LFVVEIEEAMRAGRVDLAVHSAKDLPSTLPPDMTLAVCPRRADPRDALVAQPGMTLASLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR   L   R D++++D RG ++TRL KL   +  AI+LA AG+KRL  E
Sbjct: 120 HGARVGTSSLRRACQLRALRPDLTLLDLRGNVDTRLRKLREGQYDAIVLAAAGLKRLGLE 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           +VI E+L  +   P+ GQG I +E    + +   L+  ++      ++  ERAFLA + G
Sbjct: 180 EVITELLEPDVLIPAVGQGIIGVEARAGDDEVLRLLAPLDDPAARAAITAERAFLARIGG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  +   A  +G  L  YG++ A DG++   + R+G+  D   +G   A+ +
Sbjct: 240 GCRVPVGALALLEGDELLLYGMIGALDGRMVRGM-RSGSASDPAGLGSALAEEL 292


>gi|239995985|ref|ZP_04716509.1| porphobilinogen deaminase [Alteromonas macleodii ATCC 27126]
          Length = 312

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 167/293 (56%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR S LAL  A   ++ L++ +  P   + ++P+ST+GD+I +  L +IGGKGL
Sbjct: 8   RTVRIATRKSALALWQAEYVKAKLLEHY--PSMTVELVPMSTQGDKILDTPLAKIGGKGL 65

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  ++ G  D AVHS KD+P +  +G  + A   RE+  D F+S+   SL  L  
Sbjct: 66  FIKELEIAMLEGRADIAVHSMKDVPVEFPEGFGLHAICERENPFDAFVSNNHDSLDALPQ 125

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +V+GTSSLRR+  + ++R D+ + D RG + TRL KL+  +  AI+LA AG+ RL+ E 
Sbjct: 126 GAVVGTSSLRRQCQIRKYRPDLIIKDLRGNVNTRLAKLDAGEYDAIILASAGLIRLEMES 185

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L  +   P+ GQGA+ IE   ++ +  +L++ +NH DT   V  ERA    L+G 
Sbjct: 186 RIRMPLPADISLPAVGQGAVGIECRNDDEELIKLLQALNHTDTNTRVTAERAMNERLEGG 245

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  I  FA   G  L   G+V   DG      S   +R  A +IG + A+ +
Sbjct: 246 CQVPIGSFATLDGDVLTLTGMVGKPDGSELLFASATASREKAADIGVEVAESL 298


>gi|325696921|gb|EGD38808.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK160]
          Length = 306

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 113/308 (36%), Positives = 169/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKALH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQKLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLAFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + ++L+  +  + T   V  ERA LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRQLLATVQDDKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA FA  KG       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAAFAQKKGQAYQLEAMLAKEDGQCVF-VSLQGQDGQEL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|292493894|ref|YP_003529333.1| porphobilinogen deaminase [Nitrosococcus halophilus Nc4]
 gi|291582489|gb|ADE16946.1| porphobilinogen deaminase [Nitrosococcus halophilus Nc4]
          Length = 310

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/268 (41%), Positives = 154/268 (57%), Gaps = 2/268 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR S LAL  A     +L   H  P  ++ ++ +ST+GD+I +  L ++GGKG
Sbjct: 4   KTCLRIATRKSLLALWQAEYVADTLR--HHHPGLSVELVRMSTQGDKILDTPLAKVGGKG 61

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E+ L+SGE D AVHS KD+P  L + L IS    RED RD F+S+  Q L  L 
Sbjct: 62  LFVKELEQGLLSGEADIAVHSMKDVPVVLPEDLHISVICEREDPRDAFVSNHWQQLDSLP 121

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + +GTSSLRR++ +   R D  V+D RG + TRL KL+NN+   I+LA +G+KRL   
Sbjct: 122 EGARVGTSSLRRQSQVRERRPDFHVLDLRGNVNTRLAKLDNNEFDGIVLAASGLKRLGLT 181

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I E+L  E   P+ GQGAI IE    +   +EL+KV+ H  T  ++  ERA    L G
Sbjct: 182 DRITELLAPEVSLPAIGQGAIGIECRKGDTATEELLKVLEHTPTRTTIRAERALNERLAG 241

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            C+  IA +A   G  L    +V   DG
Sbjct: 242 GCQVPIAAYAELDGERLRLRALVGQPDG 269


>gi|170719443|ref|YP_001747131.1| porphobilinogen deaminase [Pseudomonas putida W619]
 gi|229836111|sp|B1J1V2|HEM3_PSEPW RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|169757446|gb|ACA70762.1| porphobilinogen deaminase [Pseudomonas putida W619]
          Length = 313

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 161/294 (54%), Gaps = 2/294 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+   SL  
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNRFSSLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEERITASISVDDSLPAGGQGAVGIECRSADSEIHALLAPLHHTDTADRVVAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           +G C+  IA +A  +G  L+  G+V    G           R  A  +G   A+
Sbjct: 239 NGGCQVPIACYAVLEGEQLWLRGLVGQPSGGTLLMADARAPRASAETLGVQVAE 292


>gi|197116806|ref|YP_002137233.1| porphobilinogen deaminase [Geobacter bemidjiensis Bem]
 gi|226706286|sp|B5EBG8|HEM3_GEOBB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|197086166|gb|ACH37437.1| hydroxymethylbilane synthase [Geobacter bemidjiensis Bem]
          Length = 318

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 156/272 (57%), Gaps = 3/272 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +S L    + P   + +  + T GD+I +  L ++GG
Sbjct: 1   MALKELRIGTRASQLALWQANWVKSELE--KRYPDMTVTLTKIKTIGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  IS+  +   D
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVISNGVK-FAD 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG ++TR++KL      A++LA AG+ RL 
Sbjct: 118 LPQGARIGTSALRRQAQLLKVRPDLEMVIIRGNVQTRMDKLKTEGLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I E+L  +   P+ GQGA+ IE +++N   ++ +   N  DT  +V  ERA L   
Sbjct: 178 FADQITEMLPTDLSLPAIGQGALGIECNLSNQDVKDAISFFNSPDTSRAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKI 272
           +G C+  IA F    G  L   G + + DGK+
Sbjct: 238 EGGCQVPIAAFGEVTGDQLKLTGFIASVDGKV 269


>gi|303230554|ref|ZP_07317308.1| hydroxymethylbilane synthase [Veillonella atypica ACS-049-V-Sch6]
 gi|302514795|gb|EFL56783.1| hydroxymethylbilane synthase [Veillonella atypica ACS-049-V-Sch6]
          Length = 312

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 107/301 (35%), Positives = 170/301 (56%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  +   +S L  ++  P   + ++  +TKGDRI N+ L E+GGKGLFT
Sbjct: 5   IRIGTRKSALALWQSEYVKSELQRLY--PGVTVELVHFNTKGDRILNKPLAEVGGKGLFT 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            E+E  + +G+ID AVHS KDMPT+L  GL + A   RE   D  +S   ++L  L   +
Sbjct: 63  AELEAAMHAGDIDIAVHSLKDMPTELPDGLTLGAISKREVPFDALVSPKYKTLDQLPEGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTSSLRR+A LL  R D+ +   RG ++TRL K+       ++LA AG+KRL  +  I
Sbjct: 123 RIGTSSLRRQAQLLHRRPDLQIEVIRGNVQTRLGKIETEGLDGVVLAQAGLKRLGLDDRI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++   ++  P+ GQGA+ IE   ++ +  E++  I+ E T  +V  ER+FL +L+G C+
Sbjct: 183 TQVFTADEMIPAVGQGALAIECRSDDTEMLEILSKIDDEPTRLAVEGERSFLNQLNGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +  +   +   L    ++ + DGK  +E   +G     + +G++ A+ +     K++ 
Sbjct: 243 VPMGVYGTVEKGQLNLKALIASLDGKTVYEGELSGPAKKGVMLGKNLAKALYEEGGKHIV 302

Query: 306 N 306
            
Sbjct: 303 E 303


>gi|119475318|ref|ZP_01615671.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2143]
 gi|119451521|gb|EAW32754.1| porphobilinogen deaminase [marine gamma proteobacterium HTCC2143]
          Length = 313

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 108/274 (39%), Positives = 164/274 (59%), Gaps = 5/274 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M     RI TR SPLAL  A   ++ L   H  P  ++ ++ ++T+GD++ +  L +IGG
Sbjct: 1   MPSNLVRIATRESPLALWQAEFIKAGLQAAH--PGLDVELLGMTTRGDKMLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL++S    RED RD F+S+  +++ +
Sbjct: 59  KGLFVKELETAMLEGRADIAVHSMKDVPMEFPEGLELSIICEREDPRDAFVSNHFKTVNE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L L S +GTSSLRR+  L   R D+++ID RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPLGSRVGTSSLRRQCQLRALRPDLNIIDLRGNVNTRLRKLDEGQYDAIILASAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E+ I + + ++   P+ GQGA+ +E   ++ + Q L+  +NH  T   V+ ERA    L
Sbjct: 179 MEQRIADPIAVDSSLPAGGQGAVGVEARSDDHRIQALLAPLNHRSTALRVSAERAMNLRL 238

Query: 241 DGSCKSAIAGFAYC--KGS-TLYFYGIVLASDGK 271
            G C+  IA FA    +GS  L   G+V + DGK
Sbjct: 239 QGGCQVPIACFAELDIEGSGQLRLRGLVGSPDGK 272


>gi|53802806|ref|YP_115447.1| porphobilinogen deaminase [Methylococcus capsulatus str. Bath]
 gi|53756567|gb|AAU90858.1| porphobilinogen deaminase [Methylococcus capsulatus str. Bath]
          Length = 351

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A    S L   H  P   + ++ ++T+GD++ +  L ++GGKGLF 
Sbjct: 47  LRIATRKSPLALWQAEYVASRLRAAH--PDLRVELVGMTTRGDKLLDAPLAKVGGKGLFV 104

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E+ L+ G  D AVHS KD+P +  +GL ++A L RED RD  +SH  +S  +L   +
Sbjct: 105 KELEQGLLEGRADIAVHSMKDVPVEFPEGLHLAAILEREDPRDALVSHRYRSFAELPADA 164

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTSSLRR+  +       S+ D RG + TRL KL+  +  AI+LA AG+KRL  ++ I
Sbjct: 165 RIGTSSLRRQCQIKCRLPGCSLYDLRGNVNTRLAKLDAGEFDAIVLASAGLKRLGFQERI 224

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E L  E   P+ GQGAI +E    + +   L+  ++H  T   V  ERA    LDG C+
Sbjct: 225 AETLTPEQCLPAIGQGAIGVECRSTDTRTNALLVPLHHPPTAWCVLAERAMNRRLDGGCQ 284

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             IAGFA  +G TL   G+V   DG         G+      +G+  A+++
Sbjct: 285 VPIAGFAQLEGDTLSLRGLVGNPDGSGIIRAEAVGHPSTFEALGKRVAEHL 335


>gi|296105312|ref|YP_003615458.1| hydroxymethylbilane synthase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295059771|gb|ADF64509.1| hydroxymethylbilane synthase [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 313

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 158/291 (54%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H      + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKQRLEACHS--GLRVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELELALLENRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNQFDSLDALPKGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 124 VVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH++T   V  ERA    L+G C+
Sbjct: 184 RVALPPELSLPAVGQGAVGIECRLDDRRTRELLAPLNHDETAIRVKAERAMNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  +A      L+   +V A DG       R G   DA  +G   A+ +
Sbjct: 244 VPIGSYAELINGELWLRALVGAPDGSQMVRGERRGKPQDAEQLGISLAEEL 294


>gi|330827978|ref|YP_004390930.1| Porphobilinogen deaminase [Aeromonas veronii B565]
 gi|328803114|gb|AEB48313.1| Porphobilinogen deaminase [Aeromonas veronii B565]
          Length = 330

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 163/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  +I TR SPLAL  A   +  L  +H  P   + ++P+ST+GD+I +  L ++GG
Sbjct: 22  MAARTLKIATRKSPLALWQANFVKDRLEALH--PQLQVELVPMSTQGDKILDTPLAKVGG 79

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+  +++ +
Sbjct: 80  KGLFVKELETAMLEGRADIAVHSMKDVPVEFPEGLGLHTICEREDPRDAFVSNRFKAIAE 139

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+KRL+
Sbjct: 140 LPQGAVVGTSSLRRQCQLRAARPDLVIRDLRGNVNTRLAKLDAGEYDAIILAAAGLKRLE 199

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   +  E   P+ GQGA+ IE  +++ +   L+  + H +T   V  ERA    L
Sbjct: 200 MAHRITAFIEPEQSLPANGQGAVGIECRLDDVELHALLAPLEHTETRARVLTERAMNRAL 259

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            G C+  I  +A  +G  ++  G+V + DG         G   D   +G   AQ +
Sbjct: 260 QGGCQVPIGAYALVEGEQIWLRGLVGSPDGTQVIRDEIRGPLADGEALGEQLAQRL 315


>gi|32033974|ref|ZP_00134230.1| COG0181: Porphobilinogen deaminase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
          Length = 314

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 162/294 (55%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR SPLAL  A   +  L    + P  ++ ++ + TKGD I +  L +IGGKG
Sbjct: 7   KDTLRIATRQSPLALWQANFVKDELE--KRFPELSVELVTMVTKGDVILDTPLAKIGGKG 64

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L 
Sbjct: 65  LFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDELP 124

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL   
Sbjct: 125 AGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGMP 184

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +++E   P+ GQGA+ IET VN+ +    +  +NH  T   V  ERA    L G
Sbjct: 185 ERIRSFISVEQSLPAAGQGAVGIETRVNDERVLNYLATLNHNPTACCVIAERAMNTRLQG 244

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  I GFA   G+ +    +V A DG      S   +R +A  +G   A+ +
Sbjct: 245 GCQVPIGGFATLNGNEITLNALVGALDGSNIIRASGVADRENAEQLGISVAEQL 298


>gi|294649011|ref|ZP_06726459.1| hydroxymethylbilane synthase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292825146|gb|EFF83901.1| hydroxymethylbilane synthase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 305

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 113/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   RS L  ++  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 2   KTLKIATRQSPLALWQAEHIRSRLNALY--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L  GL ++    RED  D F+S+     +DL  
Sbjct: 60  FVKELEAALLDGRADLAVHSMKDVPMHLPDGLTLAVICEREDPLDAFVSNQYARFEDLPQ 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK  +L+ R D+ ++D RG + TRL+KL++    AI+LA AG+KRL    
Sbjct: 120 GAKVGTSSLRRKCQILQQRPDLEIVDLRGNVGTRLSKLDDGLYDAIILASAGLKRLGLAD 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L      P+ GQGA+ +E   ++ K   L++ + HE+T   V  ERA  A L+G 
Sbjct: 180 RIRHCLAPVLSLPAVGQGALGLECRADDEKLLALIQPLQHEETSICVRAERALNAYLEGG 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           C+  IAG+A      L   G V + DGK   +    G+   A  +G   AQ
Sbjct: 240 CQVPIAGYATIVNHQLQIEGRVGSVDGKTLLKKQLIGSTDQAEQLGEQLAQ 290


>gi|262370151|ref|ZP_06063478.1| porphobilinogen deaminase [Acinetobacter johnsonii SH046]
 gi|262315190|gb|EEY96230.1| porphobilinogen deaminase [Acinetobacter johnsonii SH046]
          Length = 306

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 166/293 (56%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L  +H      + ++   T+GD+I +  L +IGGKGL
Sbjct: 2   KTLKIATRQSPLALWQAEHIRARLEALHA--GLTVELVTFVTQGDKILDTPLAKIGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S++  S   L  
Sbjct: 60  FVKELEAALLDGRADLAVHSMKDVPMALPEGLSLAVICEREDPLDAFVSNSYVSFDALPQ 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK  +L+ R D+ +ID RG + TRL+KL+  +  AI+LA AG+KRL   +
Sbjct: 120 GAKVGTSSLRRKCQILKQRPDLDIIDLRGNVGTRLSKLDAGQYDAIILASAGLKRLGLAE 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I   +  E   P+ GQGA+ +E   N+    +L+  + H DT   V  ERAF A L+G 
Sbjct: 180 RICHTIRPELSLPAVGQGALGLECRANDQAVLDLIHPLLHIDTDTCVRAERAFNAYLEGG 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A    + +   G V + DG+   +    G+  +A ++G   AQ +
Sbjct: 240 CQVPIAGYATLADNRIQLEGRVGSVDGQTLLKAQVAGDAAEAEHLGVVLAQEL 292


>gi|126208484|ref|YP_001053709.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae L20]
 gi|126097276|gb|ABN74104.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
          Length = 309

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 162/294 (55%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR SPLAL  A   +  L    + P  ++ ++ + TKGD I +  L +IGGKG
Sbjct: 2   KDTLRIATRQSPLALWQANFVKDELE--KRFPELSVELVTMVTKGDVILDTPLAKIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L 
Sbjct: 60  LFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDELP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL   
Sbjct: 120 AGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGMP 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +++E   P+ GQGA+ IET VN+ +    +  +NH  T   V  ERA    L G
Sbjct: 180 ERIRSFISVEQSLPAAGQGAVGIETRVNDERVLNYLATLNHNPTACCVIAERAMNTRLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  I GFA   G+ +    +V A DG      S   +R +A  +G   A+ +
Sbjct: 240 GCQVPIGGFATLNGNEITLNALVGALDGSNIIRASGVADRENAEQLGISVAEQL 293


>gi|148284479|ref|YP_001248569.1| porphobilinogen deaminase [Orientia tsutsugamushi str. Boryong]
 gi|167008815|sp|A5CDH4|HEM3_ORITB RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|146739918|emb|CAM79909.1| porphobilinogen deaminase [Orientia tsutsugamushi str. Boryong]
          Length = 298

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 165/291 (56%), Gaps = 5/291 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            R+G+R S LAL  A   ++ +  ++ +   N +IIP+ T GD I N+ L +IGGKGLF 
Sbjct: 3   IRVGSRASRLALIQA---QAVVQKINDLLGLNAIIIPIKTTGDLIQNKNLYDIGGKGLFL 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L++  ID AVHS KD+P  L  GLQ++A L R D+ D+ +S  A  + DL L +
Sbjct: 60  KEIEYALLNNTIDIAVHSLKDVPAYLPDGLQLAAVLERGDVGDMLVSKIANKITDLPLGA 119

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV- 184
           ++GTSS+RR+  LL  R D++++ FRG ++TR NK+ NN+  A +LA AG++RL  +   
Sbjct: 120 IVGTSSVRRRIQLLMLRPDLNIVLFRGNVDTRWNKIINNEVDATVLAAAGLQRLNYDTSR 179

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
              I+   +  P+ GQGAI IE   ++     L   INH+ TW  +  ER +L  L+  C
Sbjct: 180 FCNIIPQSEMLPAIGQGAIAIEARKDDKLIMPLCAKINHQLTWQLIQVERGYLKTLNADC 239

Query: 245 KSAIAGFAYCKGSTLYFYGIVLAS-DGKIFHEVSRNGNRCDAINIGRDAAQ 294
              I G A   G+  +    +L   + + F      G      +IG +AA+
Sbjct: 240 NVPIGGIASYIGNNSFEAKFMLGDYNMRYFFYSEVRGKLQHGYDIGVEAAK 290


>gi|94264595|ref|ZP_01288379.1| Porphobilinogen deaminase [delta proteobacterium MLMS-1]
 gi|93454949|gb|EAT05186.1| Porphobilinogen deaminase [delta proteobacterium MLMS-1]
          Length = 311

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 161/283 (56%), Gaps = 2/283 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LALA A   +  +   H  P   + ++ + TKGD+I +  L ++GGKGLF 
Sbjct: 5   IRIGTRASMLALAQANWIKGRIEAQH--PQCRVELVKIITKGDKIVDVPLAKVGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ ++ GE+D AVHS KD+P +L +GL I     RE+  D F+S+  Q+++ L   +
Sbjct: 63  KEIEEAMLRGEVDIAVHSMKDVPAELPQGLHIGIITQRENPFDAFVSNLYQNIEALPTGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRRK+ L   R D+++ D RG ++TRL KL+  +   I+LA AG+ RL      
Sbjct: 123 RVGTSSLRRKSQLAALRPDLTIEDLRGNLDTRLRKLDEGQYDGIILAAAGLNRLDLAHRA 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
                 E   P+  QGA+ IE    +    E++  ++H  T  +V  ERA+L  L+G C+
Sbjct: 183 TFYFQAEQMLPAVAQGAVGIELRRADADLLEMLSFMDHRATTLAVKAERAYLKRLEGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINI 288
             +AGFA   G  L    +V A DG    +VS++G   +A  I
Sbjct: 243 VPLAGFATLDGDRLQLDTLVAAIDGSRLLKVSKSGPAEEAEEI 285


>gi|148554852|ref|YP_001262434.1| porphobilinogen deaminase [Sphingomonas wittichii RW1]
 gi|148500042|gb|ABQ68296.1| porphobilinogen deaminase [Sphingomonas wittichii RW1]
          Length = 308

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 151/267 (56%), Gaps = 3/267 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +P R+GTR SPLAL  A    ++L   H      + I+ + T GDRI +R L E+GGK L
Sbjct: 7   RPLRLGTRGSPLALTQARMVIAALRAAHGWDETAVEIVAIKTSGDRIQDRALAEVGGKAL 66

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           +T+E++  L  G ID AVHS KD+ T     + I+A LPR D+RD  I   A SL  L  
Sbjct: 67  WTKELDIALADGTIDFAVHSMKDVETIRPAAIVIAAMLPRADVRDRLIG--AASLAALPQ 124

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSS RR A + R R D+ ++ FRG ++TRL KL   +A A LLA AG+ RL +++
Sbjct: 125 GARVGTSSPRRSAQVRRARPDVGIVLFRGNVDTRLGKLAAGEAEATLLAGAGLIRLGRDE 184

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
           +   I  IE+  P+P Q A+ IET       + L+  I+   T  SV+ ERA LA L   
Sbjct: 185 IGHPI-PIEEMLPAPAQAAVGIETLAERTDVRALLGAIDDAPTNASVSAERALLAALGAD 243

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDG 270
           C+S +A  A   G+ L     ++  DG
Sbjct: 244 CRSPVAALAVRSGAGLLLRAEIMTEDG 270


>gi|114797250|ref|YP_761901.1| porphobilinogen deaminase [Hyphomonas neptunium ATCC 15444]
 gi|123128354|sp|Q0BX92|HEM3_HYPNA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|114737424|gb|ABI75549.1| porphobilinogen deaminase [Hyphomonas neptunium ATCC 15444]
          Length = 321

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 170/309 (55%), Gaps = 7/309 (2%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  R+GTR SPLALA A +    +        ++  I+  +T GD++T   L   GGKGL
Sbjct: 11  KRLRLGTRGSPLALAQAHQIADGIR-AASAGAYDCEIVAFTTTGDKLTTERLINSGGKGL 69

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           FT E++  L  GE+D AVHS KD+P+ L  G   +A+  RED RD F+SH A+S++DL  
Sbjct: 70  FTRELDDALSRGELDLAVHSLKDVPSVLPPGQIFAAFPKREDPRDGFLSHGAKSIQDLPE 129

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GT+SLRR+A  L  R D+ V+ FRG + TR+ KL    A A  LA AG+ RL   +
Sbjct: 130 GATLGTASLRREAQALALRPDLKVVTFRGNVATRMRKLEEGLADATFLAMAGLTRLGLSE 189

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVN-NPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           V   I  +ED  P+ GQG I + T  + + +  E++  ++HE +  +   ERAFL +LDG
Sbjct: 190 VATPI-PLEDMLPAAGQGIIGVVTRDDVDTELLEILGQLSHEPSRVAAIAERAFLEKLDG 248

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHE----VSRNGNRCDAINIGRDAAQYIRF 298
           SC++ IA   + +G      G VL+  G           ++      + +GR  AQ I F
Sbjct: 249 SCRTPIAAHLFDRGDEWQLIGEVLSPGGTTRWRGDGVCRKDATDAQLVLLGRAVAQEIIF 308

Query: 299 ISNKNVFNF 307
            + + +  F
Sbjct: 309 AAKEALPVF 317


>gi|262273217|ref|ZP_06051033.1| porphobilinogen deaminase [Grimontia hollisae CIP 101886]
 gi|262222795|gb|EEY74104.1| porphobilinogen deaminase [Grimontia hollisae CIP 101886]
          Length = 311

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 156/270 (57%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M   P RI TR SPLAL  A   +++L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MTSTPIRIATRQSPLALWQAEFVKAALEATH--PGLTVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   S+ +
Sbjct: 59  KGLFVKELEQAMLDGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNHYTSISE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ + D RG + TRL KL+N +  AI+LA AG+KRL 
Sbjct: 119 LPQGAIVGTSSLRRQCQLRAMRPDLVIKDLRGNVGTRLGKLDNGEYDAIILASAGLKRLN 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I+  +  E+  P+ GQGA+ IE  +++ + + L++ +   +T   V CERA    L
Sbjct: 179 LHDRIRNEIEPEEILPAVGQGAVGIECRLDDERVRALLEPLADANTTYRVLCERAMNNRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            G C+  I  +A   G  ++   +V   DG
Sbjct: 239 MGGCQVPIGSYAEIHGDQIHLRALVGEPDG 268


>gi|254360510|ref|ZP_04976659.1| hydroxymethylbilane synthase [Mannheimia haemolytica PHL213]
 gi|261493197|ref|ZP_05989725.1| hydroxymethylbilane synthase [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261495982|ref|ZP_05992397.1| hydroxymethylbilane synthase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|153091050|gb|EDN73055.1| hydroxymethylbilane synthase [Mannheimia haemolytica PHL213]
 gi|261308358|gb|EEY09646.1| hydroxymethylbilane synthase [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311145|gb|EEY12320.1| hydroxymethylbilane synthase [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 311

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/287 (38%), Positives = 162/287 (56%), Gaps = 2/287 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR SPLAL  A   +S L + H  P  ++ ++ + TKGD I +  L +IGGKG
Sbjct: 2   KDILRIATRQSPLALWQANFVKSEL-EKH-FPQLSVELVTMVTKGDIILDTPLAKIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+   SL+DL 
Sbjct: 60  LFVKELELALLENRADIAVHSMKDVPMSFPEGLGLAVICEREDPRDAFVSNNYHSLEDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL  +
Sbjct: 120 KGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGLQ 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +++E   P+ GQGA+ IET  N+ +    +  +NH  T   V  ERA    L G
Sbjct: 180 ERIRSYISVEQSLPAAGQGAVGIETRANDERILNYIAKLNHSSTACCVMAERAMNTRLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
            C+  I G+A  +G  L    +V + DG      S  G++ +A  +G
Sbjct: 240 GCQVPIGGYATLEGDELTLNALVGSLDGSQIIRASAKGHKQEAEQLG 286


>gi|90581042|ref|ZP_01236842.1| porphobilinogen deaminase [Vibrio angustum S14]
 gi|90437738|gb|EAS62929.1| porphobilinogen deaminase [Vibrio angustum S14]
          Length = 310

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 102/270 (37%), Positives = 157/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +P RI TR SPLA+  A   ++ L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MSNQPIRIATRKSPLAMWQAEFVKAELEQAH--PGIIVELVPMITKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++ +
Sbjct: 59  KGLFVKELEVAMLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNKYNNIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ V D RG + TRL K++  +  AI+LA AG+KRLK
Sbjct: 119 LPQGAIVGTSSLRRQCQLRAQRPDLIVNDLRGNVNTRLRKMDEGQYDAIILACAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + ++L+  ++ + T   V CERA    L
Sbjct: 179 MEDRIRSEIAPEVSLPAVGQGAVGIECRLDDTRVRQLLAALSDQATTTRVLCERAMNNYL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            G C+  I  +A  +G  ++   +V   DG
Sbjct: 239 QGGCQVPIGSYAELEGDQIWLRALVGEPDG 268


>gi|161594062|ref|NP_899724.2| porphobilinogen deaminase [Chromobacterium violaceum ATCC 12472]
 gi|55976482|sp|Q7P207|HEM3_CHRVO RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
          Length = 309

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/290 (38%), Positives = 165/290 (56%), Gaps = 4/290 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPH-NIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           I +R S LA+  A   ++ L  ++   PH  + I+ ++T+GD+I ++TL++IGGKGLF +
Sbjct: 6   IASRESRLAMWQAEHIQARLQALY---PHLTVEILGMTTQGDQILDKTLSKIGGKGLFVK 62

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           E+E+ L+ G  D AVHS KD+P  L  G  ++A   RED RD F+S+  Q L +L   SV
Sbjct: 63  ELEQALMDGRADLAVHSLKDVPMTLPDGFALAAVCEREDPRDAFVSNRYQHLSELPAGSV 122

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           +GTSSLRR+A L      ++V   RG ++TRL KL++ +  AI+LA AG+KRL   + I+
Sbjct: 123 VGTSSLRREAQLRARFPQLAVKPLRGNVQTRLKKLDDGEFDAIILAAAGLKRLGLAERIQ 182

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
             L   +  P+ GQGA+ IE   +      L+  +NH DT      ERA   EL GSC+ 
Sbjct: 183 GELAPSESLPAAGQGALGIEIRADRADLSALLAPLNHPDTRACTAAERALAKELGGSCQV 242

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            +  FA     TL   G+V   DG +    S +G    A  +GR  A+ +
Sbjct: 243 PLGAFATLADGTLTLGGLVAHPDGSVVLTASASGPADYADALGRAVAKKL 292


>gi|169634609|ref|YP_001708345.1| porphobilinogen deaminase [Acinetobacter baumannii SDF]
 gi|169153401|emb|CAP02532.1| porphobilinogen deaminase (PBG) (Hydroxymethylbilane synthase)
           (HMBS) (Pre-uroporphyrinogen synthase) [Acinetobacter
           baumannii]
          Length = 314

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 167/293 (56%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A    + L ++H  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 11  KTLKIATRQSPLALWQAEHICARLQELH--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 68

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+  +   DL  
Sbjct: 69  FVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICEREDPLDAFVSNQFEKFADLPQ 128

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK+ +L+ R D+ +ID RG + TRL KL++ +  AI+LA AG+KRL   +
Sbjct: 129 GAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDDGQYDAIILASAGLKRLGLAE 188

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +      P+ GQGA+ +E   ++ +   L++ + H +T   V  ERAF A L+G 
Sbjct: 189 RIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLLHPETDICVRAERAFNAYLEGG 248

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IAG+A  +   ++  G V + DG+            +A  +G + A+ +
Sbjct: 249 CQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDEANNAQQLGENLARNL 301


>gi|61213332|sp|Q602K3|HEM3_METCA RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
          Length = 322

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 162/291 (55%), Gaps = 2/291 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A    S L   H  P   + ++ ++T+GD++ +  L ++GGKGLF 
Sbjct: 18  LRIATRKSPLALWQAEYVASRLRAAH--PDLRVELVGMTTRGDKLLDAPLAKVGGKGLFV 75

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E+ L+ G  D AVHS KD+P +  +GL ++A L RED RD  +SH  +S  +L   +
Sbjct: 76  KELEQGLLEGRADIAVHSMKDVPVEFPEGLHLAAILEREDPRDALVSHRYRSFAELPADA 135

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTSSLRR+  +       S+ D RG + TRL KL+  +  AI+LA AG+KRL  ++ I
Sbjct: 136 RIGTSSLRRQCQIKCRLPGCSLYDLRGNVNTRLAKLDAGEFDAIVLASAGLKRLGFQERI 195

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E L  E   P+ GQGAI +E    + +   L+  ++H  T   V  ERA    LDG C+
Sbjct: 196 AETLTPEQCLPAIGQGAIGVECRSTDTRTNALLVPLHHPPTAWCVLAERAMNRRLDGGCQ 255

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             IAGFA  +G TL   G+V   DG         G+      +G+  A+++
Sbjct: 256 VPIAGFAQLEGDTLSLRGLVGNPDGSGIIRAEAVGHPSTFEALGKRVAEHL 306


>gi|332363838|gb|EGJ41617.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK355]
          Length = 306

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 114/309 (36%), Positives = 170/309 (55%), Gaps = 14/309 (4%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKALH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI-SHTAQSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   + Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQSGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLAFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + + L+  +  E T   V  ERA LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRSLLAAVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGK-IFHEVSRNGNRCDAINIGRDAAQYIRF 298
           ++  C   IA FA   G       ++   DG+ IF  VS  G     +     A Q +R 
Sbjct: 240 MNADCTFPIAAFAQKNGQNYQLEAMLAKEDGQCIF--VSLQGQDGQEL-----AEQAVRQ 292

Query: 299 ISNKNVFNF 307
           +++K     
Sbjct: 293 LADKGAVGM 301


>gi|13676388|dbj|BAB41183.1| porphobilinogen deaminase [Amaranthus tricolor]
          Length = 198

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 133/197 (67%), Gaps = 1/197 (0%)

Query: 57  EIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQ 116
           +IGGKGLFT+EI++ L++ EID AVHS KD+PT L   + +   L RED+RD FIS TA 
Sbjct: 2   DIGGKGLFTKEIDEALLNNEIDIAVHSMKDVPTYLPDKIILPCNLEREDVRDAFISTTAS 61

Query: 117 SLKDLALHSVIGTSSLRRKALLLRWRSDISVID-FRGKIETRLNKLNNNKAHAILLAYAG 175
           SL DL   SV+GT+SLRRK+ LL     + V+D FRG ++TRL KLN     A LLA AG
Sbjct: 62  SLADLPAGSVVGTASLRRKSQLLHRYPSLEVLDNFRGNVQTRLRKLNEGLVQATLLALAG 121

Query: 176 IKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERA 235
           +KRL   + +  +L+I+D  P+  QGAI I    ++ K    + ++NHE+T  +V CERA
Sbjct: 122 LKRLNMTENVSSVLSIDDMLPAVAQGAIGIACLQDDDKMANYLALLNHEETQLAVACERA 181

Query: 236 FLAELDGSCKSAIAGFA 252
           FL  LDGSC++ IAG+A
Sbjct: 182 FLETLDGSCRTPIAGYA 198


>gi|325576792|ref|ZP_08147407.1| hydroxymethylbilane synthase [Haemophilus parainfluenzae ATCC
           33392]
 gi|325160998|gb|EGC73116.1| hydroxymethylbilane synthase [Haemophilus parainfluenzae ATCC
           33392]
          Length = 310

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 155/267 (58%), Gaps = 2/267 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   +  L   H  P  ++ ++P+ TKGD I +  L +IGGKGL
Sbjct: 5   KTLKIATRQSPLALWQANFVKDQLEKFH--PTLSVELVPMVTKGDVILDSPLAKIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+    D AVHS KD+P +  +GL +S    RED RD F+S+T +SL DL  
Sbjct: 63  FVKELENALLEKRADIAVHSMKDVPMEFPEGLGLSVICKREDPRDAFVSNTYRSLDDLPQ 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +++GTSSLRR+  L + R D+ +   RG + TRL+KL+N +  AI+LA AG+ RL   +
Sbjct: 123 GAIVGTSSLRRQCQLKQLRPDLDIRSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGLAE 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I   + +E   P+ GQGA+ IE  V++ + + L+  ++   T   V  ERA    L G 
Sbjct: 183 RIASFIEVEQSLPAAGQGAVGIECRVDDEEVKALLAPLSDATTTTCVLAERAMNTRLQGG 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDG 270
           C+  I G+A  +   ++   +V  +DG
Sbjct: 243 CQVPIGGYAIEQNGEIFLRALVGETDG 269


>gi|330812535|ref|YP_004356997.1| porphobilinogen deaminase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380643|gb|AEA71993.1| porphobilinogen deaminase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 313

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 164/294 (55%), Gaps = 2/294 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MCPREIRIATRKSALALWQAEYVKARLEAAH--PGLIVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLFCICEREDPRDAFVSNTFSSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLTRRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    +     L+  ++HEDT   V  ERA    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSADSDIHALLAPLHHEDTATRVFAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           +G C+  IA +A  +G  ++  G+V   +G           R DA  +G   A+
Sbjct: 239 NGGCQVPIACYAVLEGEQVWLRGLVGDPNGGRLLSAEARAPRHDAEALGVRVAE 292


>gi|325693629|gb|EGD35548.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK150]
          Length = 306

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/308 (36%), Positives = 169/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKALH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLTFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + ++L+  +  E T   V  ERA LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRQLLATVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA FA   G       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAAFAQKNGQDYQLEAMLAKEDGQCVF-VSFQGQDGQEL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|157829875|pdb|1AH5|A Chain A, Reduced Form Selenomethionine-Labelled Hydroxymethylbilane
           Synthase Determined By Mad
          Length = 313

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 155/284 (54%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H  P   + ++P  T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAHYVKDKLXASH--PGLVVELVPXVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL  L   S
Sbjct: 64  KELEVALLENRADIAVHSXKDVPVEFPQGLGLVTICEREDPRDAFVSNNYDSLDALPAGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR+  L   R D+ +   RG + TRL+KL+N +  AI+LA AG+KRL  E  I
Sbjct: 124 IVGTSSLRRQCQLAERRPDLIIRSLRGNVGTRLSKLDNGEYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  L  E   P+ GQGA+ IE  +++ + +EL+  +NH +T   V  ERA    L+G C+
Sbjct: 184 RAALPPEISLPAVGQGAVGIECRLDDSRTRELLAALNHHETALRVTAERAXNTRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A      ++   +V A DG       R G   DA   G
Sbjct: 244 VPIGSYAELIDGEIWLRALVGAPDGSQIIRGERRGAPQDAEQXG 287


>gi|324990199|gb|EGC22137.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK353]
          Length = 306

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/308 (36%), Positives = 169/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L ++H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKELH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 KGALIGTSSIRRQVQLQAQRPDLAFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + + L+  +  E T   V  ERA LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRSLLAAVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA FA   G       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAAFAQKNGQNHQLEAMLAKEDGQCVF-VSLQGQDGQEL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|315303323|ref|ZP_07873952.1| porphobilinogen deaminase [Listeria ivanovii FSL F6-596]
 gi|313628303|gb|EFR96807.1| porphobilinogen deaminase [Listeria ivanovii FSL F6-596]
          Length = 309

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/290 (40%), Positives = 166/290 (57%), Gaps = 9/290 (3%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+   +G+R S LAL  +    + L + +  P  +  I  + TKGDRI + TL+++GGKG
Sbjct: 2   KRKIIVGSRRSKLALTQSGWVIARLKENY--PSIDFEIKEIVTKGDRILDVTLSKVGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF  E+E+ L  G ID AVHS KD+P+ L +GL I A   RE   D F+ +T  + KDL 
Sbjct: 60  LFVSEVEQALSDGLIDFAVHSMKDVPSSLKEGLTIGAIPKRESALDCFVFNTVATFKDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +VIGTSSLRR A +LR R D  +   RG I+TRL KL+     AI+LA AG+ R+   
Sbjct: 120 KGAVIGTSSLRRAAQILRKRPDFVIKPIRGNIDTRLQKLHAENFDAIILAKAGLARMG-- 177

Query: 183 KVIKEILNIEDFP-----PSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
            +    L +ED P     P+ GQGA+ IE   ++ +  +++  I+HE+T   V  ER FL
Sbjct: 178 WLENTTLKLEDIPPELCLPAVGQGALAIECRESDQQICDMLASIHHEETGACVEAERIFL 237

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAIN 287
            +L+G C+  IAGFA     T++F G+V  SDG       ++G   + I 
Sbjct: 238 KKLNGGCEIPIAGFATKTDGTVHFKGLVGNSDGTTILSAEQSGKNPETIG 287


>gi|78224425|ref|YP_386172.1| porphobilinogen deaminase [Geobacter metallireducens GS-15]
 gi|123742774|sp|Q39QM7|HEM3_GEOMG RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|78195680|gb|ABB33447.1| Porphobilinogen deaminase [Geobacter metallireducens GS-15]
          Length = 318

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 160/290 (55%), Gaps = 5/290 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A   +  L    + P   + ++ + T GD+I +  L ++GG
Sbjct: 1   MAPKQLRIGTRASQLALWQANWVKGELE--KRYPGMAVELVKIKTMGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD  IS   +   D
Sbjct: 59  KGLFVKEIEEAMLRGEIDIAVHSMKDVPTEFPEGLGLYCITEREDPRDAVISRGVK-FAD 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A +L+ R D+ ++  RG +ETR+ KL +    A++LA AG+ RL 
Sbjct: 118 LPQGARIGTSALRRQAQILKVRPDLQMVVIRGNVETRIRKLTDENLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               + E L +E   P+ GQGA+ IE  +++   ++ +   NH DT  +V  ERA L   
Sbjct: 178 FADQVSEYLPVELSLPAIGQGALGIECRLDDETIKDTIAFFNHPDTAHAVRAERALLWRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG--KIFHEVSRNGNRCDAINI 288
           +G C+  IA      G TL   G V + DG   +   +S     C+ + I
Sbjct: 238 EGGCQVPIAAHGQVSGDTLTLTGFVASVDGTRSVKDTISGPVTECEKLGI 287


>gi|332363288|gb|EGJ41073.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK49]
          Length = 306

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/308 (36%), Positives = 169/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L ++H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAITQTQQLVDQLKELH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISRREDVRDCLIFRQAGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 KGALIGTSSIRRQVQLQAQRPDLAFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + + L+  +  E T   V  ERA LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRSLLAAVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA FA   G       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAAFAQKNGQDYQLEAMLAKEDGQCVF-VSLQGQDGQEL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|496214|gb|AAA18907.1| porophorbilinogen deaminase [Pseudomonas aeruginosa]
          Length = 314

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 109/290 (37%), Positives = 160/290 (55%), Gaps = 3/290 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHA-FETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIG 59
           M  +  RI TR S LAL  A +   + L   H  P   + ++P++++GD++ +  L +IG
Sbjct: 1   MSSREIRIATRQSALALWQAEYVNSTGLEQAH--PGLTVTLLPMTSRGDKLLDAPLAKIG 58

Query: 60  GKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLK 119
           GKGLF +E+E  L+ G  D AVHS KD+P    +GL +     RED RD F+S+T  SL+
Sbjct: 59  GKGLFVKELETALLEGAADIAVHSMKDVPMDFPEGLGLYTICEREDPRDAFVSNTYASLE 118

Query: 120 DLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRL 179
            L   SV+GTS L R+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL
Sbjct: 119 QLPAGSVVGTSRLGRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGVIRL 178

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
             E  I+  ++++D  P+ GQGA+ IE    +     L++ ++H DT   V  ERA    
Sbjct: 179 GFESRIRSSISVDDSLPAGGQGAVGIECRTADSDLHALLEPLHHTDTALRVTAERALNKR 238

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           L+G C+  IA +A  +G  L+  G+V   DG             DA  +G
Sbjct: 239 LNGGCQVPIACYAIREGDQLWLRGLVGQPDGTQLLRAEGRAPLADAEALG 288


>gi|332365713|gb|EGJ43471.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK1059]
          Length = 306

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 113/308 (36%), Positives = 168/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKKLH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISKREDVRDCLIFRQAGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLTFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + + L+  +  E T   V  ERA LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRSLLATVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA  A  KG       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAALAQKKGQDYQLEAMLAKEDGQCVF-VSLQGQDGQQL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|213971710|ref|ZP_03399816.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato T1]
 gi|301386723|ref|ZP_07235141.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato Max13]
 gi|302062167|ref|ZP_07253708.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato K40]
 gi|302130377|ref|ZP_07256367.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|213923528|gb|EEB57117.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato T1]
          Length = 313

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 166/296 (56%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDSADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  + +AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYNAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVQVAEAL 294


>gi|285019346|ref|YP_003377057.1| hydroxymethylbilane synthase [Xanthomonas albilineans GPE PC73]
 gi|283474564|emb|CBA17065.1| probable hydroxymethylbilane synthase protein [Xanthomonas
           albilineans]
          Length = 302

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/286 (39%), Positives = 165/286 (57%), Gaps = 4/286 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  RI TR SPLAL  +    + L   H  P   ++++P+ST+GD + +R+L  IGGKGL
Sbjct: 2   KILRIATRKSPLALWQSEYVAACLRRAH--PQLEVLLVPMSTRGDEVLDRSLAAIGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  ++ G+ DCAVHS KD+P +L +   +SA LPR D  D  IS+   +L  L L
Sbjct: 60  FLKELELAMLRGDADCAVHSLKDVPMELERPFVLSAILPRADSADALISNLYAALDALPL 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRR+A L   R D+ ++D RG + TRL KL+N    AI+LA AG++RL  E+
Sbjct: 120 GARVGTSSLRRQAQLRARRPDLQLLDLRGNVNTRLAKLDNGDYDAIVLACAGLQRLGLER 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I + L   D+ P+P QGAI +E   +   A  L  V++   T   V  ERA    L GS
Sbjct: 180 RITQRLQAPDWLPAPAQGAIAVECRQDMAAACALFAVLDDVATRTCVEAERAMNRALHGS 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVL-ASDGKIFH-EVSRNGNRCDAIN 287
           C   +A FA  +G  L   G+V   +DG++   ++ R+     A+ 
Sbjct: 240 CHVPVAAFAQWRGEDLLLQGLVGDVADGRLVRAQIQRSAQDPQALG 285


>gi|28867368|ref|NP_789987.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|38257983|sp|Q88B91|HEM3_PSESM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|28850602|gb|AAO53682.1| porphobilinogen deaminase [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 313

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 166/296 (56%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  + +AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYNAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVQVAEAL 294


>gi|238018694|ref|ZP_04599120.1| hypothetical protein VEIDISOL_00538 [Veillonella dispar ATCC 17748]
 gi|237865165|gb|EEP66455.1| hypothetical protein VEIDISOL_00538 [Veillonella dispar ATCC 17748]
          Length = 319

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 108/301 (35%), Positives = 170/301 (56%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A    + L  ++  P   + ++  +TKGDRI  + L ++GGKGLFT
Sbjct: 12  IRIGTRKSALALWQAEHISAELQRLY--PNITVELVHFNTKGDRILEKPLAQVGGKGLFT 69

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            E+E+ +  G+ID AVHS KDMPT+L +GL + A   RE   D  +S   ++L  L   +
Sbjct: 70  AELEEAMHKGDIDIAVHSLKDMPTELPEGLTLGAISAREVPYDALVSPVYKTLDKLPEGA 129

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A LL  R D+ V   RG ++TRL+K+   K   ++LA AG+KRL  +  I
Sbjct: 130 CVGTSSLRRQAQLLHVRPDLKVEVIRGNVQTRLSKIETEKLDGVILAQAGLKRLGLDDQI 189

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++   ++  P+ GQGA+ IE   ++ +  E++  IN E T  +V  ER+FL +L+G C+
Sbjct: 190 TQVFKADEMIPAVGQGALAIECRADDTEMLEMLAPINDEATRYAVEGERSFLRQLNGGCQ 249

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +          L    ++ + DGK  +E   +G    A  +G++ A+ +     K++ 
Sbjct: 250 VPMGVHGTINKGQLILKAMIASLDGKTVYEGEISGPAKKAEILGKNLAKALYEEGGKHIV 309

Query: 306 N 306
           +
Sbjct: 310 D 310


>gi|262373963|ref|ZP_06067240.1| porphobilinogen deaminase [Acinetobacter junii SH205]
 gi|262310974|gb|EEY92061.1| porphobilinogen deaminase [Acinetobacter junii SH205]
          Length = 305

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 109/277 (39%), Positives = 161/277 (58%), Gaps = 2/277 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   R+ L +++  P   + ++   T+GD+I +  L +IGGKGL
Sbjct: 2   KTLKIATRQSPLALWQAEHIRARLNELY--PDLTVELVKFVTQGDKILDTPLAKIGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+ G  D AVHS KD+P  L +GL ++    RED  D F+S+      +L  
Sbjct: 60  FVKELEAALLDGRADLAVHSMKDVPMHLPEGLTLAVICEREDPLDAFVSNQYAHFDELPH 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            + +GTSSLRRK  +L+ R D+ +ID RG + TRL+KL++    AI+LA AG+KRL   +
Sbjct: 120 GAKVGTSSLRRKCQILQQRPDLEIIDLRGNVGTRLSKLDDGLYDAIILASAGLKRLGLAE 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L      P+ GQGA+ +E   ++ +  EL+  + HE T   V  ERAF A L+G 
Sbjct: 180 RIRHCLAPTLSLPAVGQGALGLECRADDQELLELISPLQHEVTSICVRAERAFNAYLEGG 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNG 280
           C+  IAG+A    + L+  G V + DGK   +   +G
Sbjct: 240 CQVPIAGYATITQNQLHIEGRVGSVDGKTLLKEQLSG 276


>gi|146313619|ref|YP_001178693.1| porphobilinogen deaminase [Enterobacter sp. 638]
 gi|167008813|sp|A4WG12|HEM3_ENT38 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|145320495|gb|ABP62642.1| hydroxymethylbilane synthase [Enterobacter sp. 638]
          Length = 313

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 156/284 (54%), Gaps = 2/284 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A   +  L   H+     + ++P+ T+GD I +  L ++GGKGLF 
Sbjct: 6   LRIATRQSPLALWQAQYVKQRLEACHQ--GLRVELVPMVTRGDVILDTPLAKVGGKGLFV 63

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  L+    D AVHS KD+P +  +GL +     RED RD F+S+   SL DL   S
Sbjct: 64  KELEIALLENRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNRYASLDDLPKGS 123

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  L   R D+ +   RG + TRL KL+N    AI+LA AG+KRL  E  I
Sbjct: 124 VVGTSSLRRQCQLAERRPDLVIRSLRGNVGTRLGKLDNGDYDAIILAVAGLKRLGLESRI 183

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           +  +  E   P+ GQGA+ IE  +++ + + L+  +NH++T   V  ERA    L+G C+
Sbjct: 184 RVAMPPELCLPAVGQGAVGIECRLDDDRTRALLSPLNHDETAIRVQAERAMNMRLEGGCQ 243

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
             I  +A      L+   +V A DG       R G   DA  +G
Sbjct: 244 VPIGSYAELINGELWLRALVGAPDGSQMVRGERRGLPQDAEMLG 287


>gi|89093768|ref|ZP_01166714.1| porphobilinogen deaminase [Oceanospirillum sp. MED92]
 gi|89081898|gb|EAR61124.1| porphobilinogen deaminase [Oceanospirillum sp. MED92]
          Length = 313

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 177/305 (58%), Gaps = 4/305 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR SPLAL  A   ++ L   H  P  N+ ++ +++KGD+I +  L ++GGKGL
Sbjct: 3   RTIRIATRKSPLALWQAEYVKAELERHH--PGINVELLGMTSKGDKILDAPLAKVGGKGL 60

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E+ +++GE D AVHS KD+P +  +GL ++   PRE   D F+S+T  S+++L  
Sbjct: 61  FVKELEEAMLAGEADIAVHSMKDVPMEFPEGLGLAVICPREQPTDAFVSNTYNSIEELPE 120

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +V+GTSSLRR+A +   R D+ +   RG + TRL KL++ +  AI+LA AG+ RL+  +
Sbjct: 121 GAVVGTSSLRREAQIREKRPDLQIKWLRGNVNTRLRKLDDGEYDAIILASAGLIRLEMPE 180

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  +++E   P+ GQGA+ IE   ++ +  EL+K ++ ++T   V+ ERA    L+G 
Sbjct: 181 RIRSEISVEFSLPAGGQGAVGIECRTDDHELLELLKPLHDQETAWRVSAERAMNRRLEGG 240

Query: 244 CKSAIAGFAYCK--GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISN 301
           C+  IA +A      S LY  G+V   DG +       G    A  +G   A  +     
Sbjct: 241 CQVPIACYATLNDDNSELYLRGLVAKPDGTLILRDEERGTPEQAEQLGITLADRLLAAGA 300

Query: 302 KNVFN 306
           K++ +
Sbjct: 301 KSILD 305


>gi|254522867|ref|ZP_05134922.1| porphobilinogen deaminase [Stenotrophomonas sp. SKA14]
 gi|219720458|gb|EED38983.1| porphobilinogen deaminase [Stenotrophomonas sp. SKA14]
          Length = 303

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 152/267 (56%), Gaps = 3/267 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +      L   H  P  ++ ++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   VRIATRKSPLALWQSEHVADRLRQAH--PGLHVELVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D F+S+   SL+ L + +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDAPFALPAMLTRHDPADGFVSNLYASLEALPIGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ ++D RG + TRL KL+N    AI+LA AG++RL   + I
Sbjct: 122 RVGTSSLRRQAQLRALRPDLELLDLRGNVNTRLAKLDNGGYDAIVLAVAGLERLGLGQRI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L    + P+P QGA+ +E    N +   L   ++   T   V  ERA    L GSC 
Sbjct: 182 VARLQPPQWLPAPAQGAVAVECDGGNARLMALFAGLDDASTRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGK 271
             +A  A  +G  L+  G+V  ASDG+
Sbjct: 242 VPVAAIAQWQGDDLHLQGLVGSASDGR 268


>gi|189423573|ref|YP_001950750.1| porphobilinogen deaminase [Geobacter lovleyi SZ]
 gi|238058916|sp|B3E2H7|HEM3_GEOLS RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|189419832|gb|ACD94230.1| porphobilinogen deaminase [Geobacter lovleyi SZ]
          Length = 312

 Score =  189 bits (481), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 115/306 (37%), Positives = 172/306 (56%), Gaps = 3/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  K  RIGTR S LAL  A  T+S L    + P   + ++ + T GD+I +  L ++GG
Sbjct: 1   MAPKRLRIGTRASQLALWQANWTKSELE--ARYPGIQVELVKIKTMGDKILDVPLAQVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +EIE+ ++ GEID AVHS KD+PT+  +GL +     RED RD FIS    +  +
Sbjct: 59  KGLFVKEIEEAMLRGEIDLAVHSMKDVPTEFPEGLGLVVTTKREDPRDAFISDKV-TFSE 117

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + IGTS+LRR+A LL+ R D+ ++  RG +ETR+ KL  +   A++LA AG+ RL 
Sbjct: 118 LRQGARIGTSALRRQAQLLKARPDLEMVIIRGNVETRIRKLKEDNLDAVILAAAGLNRLG 177

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
              V+ E+L+ +   P+ GQGA+ +E  +++    E +  +NH DT  +V  ERA L   
Sbjct: 178 FTDVVTELLDTDFSIPAIGQGALGLECRLDDNATIEALAFLNHADTAAAVAAERALLKRC 237

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  IA      G TL   G + + DGK       +G+  DA+ +G + A  +    
Sbjct: 238 EGGCQVPIAAHGTVSGDTLTLVGFIASVDGKQTVRDRISGSTADAVKLGTELADRLLAAG 297

Query: 301 NKNVFN 306
            K +  
Sbjct: 298 GKAILE 303


>gi|254447439|ref|ZP_05060905.1| porphobilinogen deaminase [gamma proteobacterium HTCC5015]
 gi|198262782|gb|EDY87061.1| porphobilinogen deaminase [gamma proteobacterium HTCC5015]
          Length = 313

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 167/293 (56%), Gaps = 4/293 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  RI TR SPLAL  A E  ++ +  H  P  +I ++ ++TKGD+I +  L +IGGKGL
Sbjct: 2   KTLRIATRQSPLALWQA-EDVAAKLKAH-YPDLDIELVKMTTKGDKILDTPLAKIGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMP--TKLLKGLQISAYLPREDIRDVFISHTAQSLKDL 121
           F +E+E  ++ G  D AVHS KD+P  ++  +GL +S  L RED RD F+S+   SL +L
Sbjct: 60  FIKELEVGMLEGRADIAVHSMKDVPVDSEFPEGLHLSVILEREDPRDAFVSNRYNSLDEL 119

Query: 122 ALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKK 181
              +V+GT+SLRR+  +L     +     RG + TRL KL++ +  AI+LA AG+ RL  
Sbjct: 120 PEGAVVGTASLRRQCQVLGRYPHLKTAVLRGSVGTRLGKLDDGQFDAIVLASAGLMRLGL 179

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           E+ I   L  E   P+ GQGA+ IE   ++ +  +L+  +   DT   +  ERA  A L 
Sbjct: 180 EERITAKLPPEISLPAIGQGAVGIECRKDDTELNKLLAPLADRDTTTRLKAERALNARLQ 239

Query: 242 GSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           G C+  IAG+A  +G  L   G+V A DG   +   R G R  A +IG   A+
Sbjct: 240 GGCQVPIAGYAELEGDQLSMRGLVGAPDGSKLYTSERRGPRDQAADIGLAVAE 292


>gi|330876446|gb|EGH10595.1| porphobilinogen deaminase [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 313

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 165/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLEIRFLRGNVNTRLAKLDGGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVQVAEAL 294


>gi|313496556|gb|ADR57922.1| HemC [Pseudomonas putida BIRD-1]
          Length = 313

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 154/265 (58%), Gaps = 2/265 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H      + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAHT--GLQVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFDSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHVDTADRVMAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIV 265
           +G C+  IA +A  +G  L+  G+V
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLV 263


>gi|289434836|ref|YP_003464708.1| hypothetical protein lse_1471 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289171080|emb|CBH27622.1| hemC [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 309

 Score =  189 bits (481), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 169/297 (56%), Gaps = 7/297 (2%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+   +G+R S LAL  +    + L + +  P  +  I  + TKGDRI + TL+++GGKG
Sbjct: 2   KRKIIVGSRRSKLALTQSGWVIARLKENY--PEIDFEIKEIVTKGDRILDVTLSKVGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF  E+E+ L  G ID AVHS KD+P+ + +GL I A   RE   D F+ +T +S  DL 
Sbjct: 60  LFVSEVEQALSDGAIDFAVHSMKDVPSSIKEGLTIGAIPKRESALDCFVFNTVESFHDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             +VIGTSSLRR A +LR R D  +   RG I+TRL KL++    AI+LA AG+ R   L
Sbjct: 120 TAAVIGTSSLRRAAQILRQRPDFVIKPIRGNIDTRLQKLHDENFDAIILAKAGLSRMGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           +   +  E ++ E   P+ GQGA+ IE   N+ +  +++  I+HE+T   V  ER FL +
Sbjct: 180 ENTTLKLEDISPELCLPAVGQGALAIECRENDKQICDMLASIHHEETGICVEAERVFLKK 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           L+G C+  IAGFA      + F G+V  +DG       R G   + + IG   A+ +
Sbjct: 240 LNGGCEIPIAGFATKTAGQIKFKGLVGNADGSTILSAERTGE--NPMTIGNQVAEAL 294


>gi|328945742|gb|EGG39893.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK1087]
          Length = 306

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 112/308 (36%), Positives = 169/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKALH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  +I+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLTFKPLRGNIDTRIKKLEEGEYDSIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + ++L+  +  E T   V  ERA LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDKELRQLLATVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA  A  KG       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAALAQKKGQDYQLEAMLAKEDGQCVF-VSLQGQDGQEL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|303229236|ref|ZP_07316032.1| hydroxymethylbilane synthase [Veillonella atypica ACS-134-V-Col7a]
 gi|302516091|gb|EFL58037.1| hydroxymethylbilane synthase [Veillonella atypica ACS-134-V-Col7a]
          Length = 312

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 106/301 (35%), Positives = 170/301 (56%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  +   +S L  ++  P   + ++  +TKGDRI ++ L E+GGKGLFT
Sbjct: 5   IRIGTRKSALALWQSEYVKSELQRLY--PGITVELVHFNTKGDRILDKPLAEVGGKGLFT 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            E+E  + +G+ID AVHS KDMPT+L  GL + A   RE   D  +S   ++L  L   +
Sbjct: 63  AELEAAMHAGDIDIAVHSLKDMPTELPDGLTLGAISKREVPFDALVSPKYKTLDQLPEGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            IGTSSLRR+A LL  R D+ +   RG ++TRL K+       ++LA AG+KRL  +  I
Sbjct: 123 RIGTSSLRRQAQLLHRRPDLQIEVIRGNVQTRLGKIETEGLDGVVLAQAGLKRLGLDDRI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++   ++  P+ GQGA+ IE   ++ +  E++  I+ E T  +V  ER+FL +L+G C+
Sbjct: 183 TQVFTADEMIPAVGQGALAIECRSDDTEMLEILSKIDDEPTRLAVEGERSFLNQLNGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +  +   +   L    ++ + DGK  +E   +G     + +G++ A+ +     K++ 
Sbjct: 243 VPMGVYGTVEKGQLILKALIASLDGKTVYEGELSGPAKKGVMLGKNLAKALYEEGGKHIV 302

Query: 306 N 306
            
Sbjct: 303 E 303


>gi|324993558|gb|EGC25478.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK405]
 gi|324995130|gb|EGC27042.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK678]
 gi|327458927|gb|EGF05275.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK1057]
 gi|327461831|gb|EGF08162.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK1]
          Length = 306

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 112/308 (36%), Positives = 168/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKKLH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLAFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + ++L+  +  E T   V  ER  LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRQLLATVQDEKTAAEVAVERVVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA FA   G       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAAFAQKNGQDYQLEAMLAKEDGQCVF-VSLKGQDGQQL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|90023307|ref|YP_529134.1| hydroxymethylbilane synthase [Saccharophagus degradans 2-40]
 gi|89952907|gb|ABD82922.1| hydroxymethylbilane synthase [Saccharophagus degradans 2-40]
          Length = 308

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 111/295 (37%), Positives = 174/295 (58%), Gaps = 6/295 (2%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  RI TR S LAL  A + ++ L  ++  P   + + PL ++GD+I +  L ++GGKGL
Sbjct: 2   KKIRIATRKSELALWQANDVKAKLEALY--PSLEVELFPLVSRGDKILDVPLAKVGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L++ E D AVHS KD+P +  +GL+++  L RED RD ++S   ++L  L  
Sbjct: 60  FVKELEHALLADEADIAVHSMKDVPMEFPEGLELAVILEREDPRDAWVSAGYENLDALPA 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
             V+GTSSLRR++ +L  R DI+V   RG + TRL KL+  +  AI+LA AG+KRLK   
Sbjct: 120 GGVVGTSSLRRQSQILARRPDITVKFLRGNVNTRLAKLDAGEYDAIILAAAGLKRLKFGD 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L+ E+  P+ GQGA+ IE    + +  +L++ ++H  T + V  ERA    L+G 
Sbjct: 180 RIRSYLSPEESLPAGGQGAVGIECRSADSETLKLLQALHHTITAEQVLAERAMNRRLEGG 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGK--IFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  I  FA  + + L+  G+V   DG   I+ E++  G   D   +G + A+ +
Sbjct: 240 CQVPIGCFAVHQNNQLWLRGLVADPDGSKVIYDEMT--GAAADGEKMGVELAEKL 292


>gi|194367302|ref|YP_002029912.1| porphobilinogen deaminase [Stenotrophomonas maltophilia R551-3]
 gi|238059002|sp|B4SJT8|HEM3_STRM5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|194350106|gb|ACF53229.1| porphobilinogen deaminase [Stenotrophomonas maltophilia R551-3]
          Length = 303

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 153/267 (57%), Gaps = 3/267 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +      L   H  P  ++ ++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   VRIATRKSPLALWQSEHVADRLRQAH--PGLHVELVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L +   + A L R D  D F+S+   SL  L + +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDEPFALPAMLTRHDPADGFVSNLYASLDALPIGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ ++D RG + TRL KL+N    AI+LA AG++RL   + I
Sbjct: 122 RVGTSSLRRQAQLRALRPDLQLLDLRGNVNTRLAKLDNGGYDAIVLAVAGLERLGLGERI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L    + P+P QGA+ +E   +N +   L   ++   T   V  ERA    L GSC 
Sbjct: 182 VARLQPPQWLPAPAQGAVAVECDGSNARLMALFAGLDDAATRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGK 271
             +A  A  +G  L+  G+V  ASDG+
Sbjct: 242 VPVAAIAQWQGQDLHLQGLVGSASDGR 268


>gi|242278118|ref|YP_002990247.1| porphobilinogen deaminase [Desulfovibrio salexigens DSM 2638]
 gi|259647794|sp|C6BYB7|HEM3_DESAD RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|242121012|gb|ACS78708.1| porphobilinogen deaminase [Desulfovibrio salexigens DSM 2638]
          Length = 308

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 110/299 (36%), Positives = 165/299 (55%), Gaps = 2/299 (0%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           I TR S LAL  A      L + +  P   + ++ + TKGD+I +  L ++GGKGLF +E
Sbjct: 6   IATRGSKLALWQANHISDLLREEY--PGIEVQLLKIKTKGDKILDVPLAKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L+ G  D AVHS KD+PT+L +GL++    PRE   D  +S    SLKDL   +V+
Sbjct: 64  IEEALLDGRADLAVHSMKDVPTELPEGLEVGIIPPREAETDTLLSVKYDSLKDLPAGAVV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSSLRR++ +L  R D+ +   RG ++TR+ KL N +  AI++A AG+ RLK      E
Sbjct: 124 GTSSLRRQSQVLALRDDLKIESLRGNLDTRVGKLLNGEFDAIVVATAGLNRLKLSAPKSE 183

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
           IL    F P+  QGA+ IE  + + + Q+++  ++ E T   V  ER FL  LDG C+  
Sbjct: 184 ILGPPTFLPAVAQGALGIEYRIEDTEIQDILAFLHDEMTARQVKAERGFLTGLDGGCQVP 243

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
           IA ++  +   +   G V   DG     + + G   DA +IG   A+ +     K + +
Sbjct: 244 IAAWSQLESDQVKLTGFVADIDGSSPIRMEKTGPAEDAWDIGLALAEEVLAAGAKEILD 302


>gi|224370660|ref|YP_002604824.1| HemC [Desulfobacterium autotrophicum HRM2]
 gi|223693377|gb|ACN16660.1| HemC [Desulfobacterium autotrophicum HRM2]
          Length = 325

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 160/294 (54%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           KK  +IGTR S LAL  A   +  + D  + P   + I+ + T GD I +R L+ +GGKG
Sbjct: 20  KKTIKIGTRGSKLALWQANHVKDRIED--QFPETEVEIMTIKTTGDMIVDRPLSMVGGKG 77

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIEK L+   ID AVHS KDMP +L  GL I A   RE+  DV IS+   SL DL 
Sbjct: 78  LFVKEIEKALLESTIDMAVHSMKDMPGELPPGLVIGAVPARENPFDVLISNNNLSLADLP 137

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             + IGTSSLRR + +   R DI     RG ++TRL KL   +  A LLA AG+ RL  +
Sbjct: 138 KGARIGTSSLRRASQIKHARPDIETASIRGNLDTRLKKLAAGEFDATLLAAAGLIRLGMK 197

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            VI +  +     P+ GQGA+CIE+   +     ++  +NH +T   V+ ERAFL  LDG
Sbjct: 198 TVITQYFDETIMIPAVGQGALCIESRQEDLDIAPVLAFLNHGETHTVVSGERAFLRRLDG 257

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           SC   +A F   +   +   G+V + DG+   + +  G   D    G   A+ +
Sbjct: 258 SCHIPVACFGRLEDHRVILTGLVASEDGRTILKETVAGTPEDPQKAGIALAETL 311


>gi|148545465|ref|YP_001265567.1| porphobilinogen deaminase [Pseudomonas putida F1]
 gi|167008818|sp|A5VWX3|HEM3_PSEP1 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|148509523|gb|ABQ76383.1| hydroxymethylbilane synthase [Pseudomonas putida F1]
          Length = 313

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 154/265 (58%), Gaps = 2/265 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H      + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAHT--GLQVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFDSLET 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHVDTADRVIAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIV 265
           +G C+  IA +A  +G  L+  G+V
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLV 263


>gi|323353345|ref|ZP_08087878.1| hydroxymethylbilane synthase [Streptococcus sanguinis VMC66]
 gi|322121291|gb|EFX93054.1| hydroxymethylbilane synthase [Streptococcus sanguinis VMC66]
          Length = 306

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 114/309 (36%), Positives = 170/309 (55%), Gaps = 14/309 (4%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKAIH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L +L 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQTLANLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLTFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + + L+  +  E T   V  ERA LA+
Sbjct: 180 DQSRLHIQTLETSLCLPAISQGALAVECREEDEELRSLLAAVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGK-IFHEVSRNGNRCDAINIGRDAAQYIRF 298
           ++  C   IA FA   G       ++   DG+ IF  VS  G     +     A Q +R 
Sbjct: 240 MNADCTFPIAAFAQKNGQGYQLEAMLAKEDGQCIF--VSLQGQDGQEL-----AEQAVRQ 292

Query: 299 ISNKNVFNF 307
           +++K     
Sbjct: 293 LADKGAVGM 301


>gi|165976435|ref|YP_001652028.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|190150336|ref|YP_001968861.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303251057|ref|ZP_07337243.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303253601|ref|ZP_07339739.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307245920|ref|ZP_07528003.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307248006|ref|ZP_07530035.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307252646|ref|ZP_07534539.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307257056|ref|ZP_07538831.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307259334|ref|ZP_07541061.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307261494|ref|ZP_07543163.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307263677|ref|ZP_07545286.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|165876536|gb|ABY69584.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|189915467|gb|ACE61719.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302647521|gb|EFL77739.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302650067|gb|EFL80237.1| porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306853139|gb|EFM85361.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306855404|gb|EFM87578.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306859891|gb|EFM91911.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306864427|gb|EFM96335.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306866570|gb|EFM98431.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306868777|gb|EFN00585.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306870990|gb|EFN02725.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 314

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 162/294 (55%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR SPLAL  A   +  L    + P  ++ ++ + TKGD I +  L +IGGKG
Sbjct: 7   KDTLRIATRQSPLALWQANFVKDELE--KRFPELSVELVTMVTKGDVILDTPLAKIGGKG 64

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L 
Sbjct: 65  LFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDELP 124

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL   
Sbjct: 125 AGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGMP 184

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +++E   P+ GQGA+ IET V++ +    +  +NH  T   V  ERA    L G
Sbjct: 185 ERIRSFISVEQSLPAAGQGAVGIETRVDDERVLNYLATLNHNPTACCVIAERAMNTRLQG 244

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  I GFA   G+ +    +V A DG      S   +R +A  +G   A+ +
Sbjct: 245 GCQVPIGGFATLNGNEITLNALVGALDGSNIIRASGVADRENAEQLGISVAEQL 298


>gi|288553611|ref|YP_003425546.1| porphobilinogen deaminase [Bacillus pseudofirmus OF4]
 gi|288544771|gb|ADC48654.1| porphobilinogen deaminase [Bacillus pseudofirmus OF4]
          Length = 310

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 116/301 (38%), Positives = 173/301 (57%), Gaps = 6/301 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           IG+R S LAL       + L    K  P+N  +  + TKGDRI + TL+++GGKGLF +E
Sbjct: 6   IGSRRSNLALTQTDWVINQLK--KKEVPYNFEVKKIVTKGDRILDVTLSKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L + EID AVHS KD+P+ + +G  ++A   RED RD FIS     LKDL   +++
Sbjct: 64  IEQALENKEIDIAVHSMKDVPSVMPEGFSLAAITEREDARDAFISLDHVKLKDLPSGAIV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVIK 186
           GTSSLRR A LL  R D+ V   RG +ETRL KL      AI+LA AG+ RL   E+++ 
Sbjct: 124 GTSSLRRSAQLLAERPDLEVKWIRGNVETRLRKLKEEDFSAIILAAAGLNRLGYSEELVT 183

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E L  E   P+ GQGA+ +E   ++ +  EL++ +N E T  +V  ER FL +++G C+ 
Sbjct: 184 EYLEPEMCVPAVGQGALGLECRSDDQEVIELIQKLNDEATALTVTAERTFLHKMEGGCQV 243

Query: 247 AIAGFAYCK-GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
            IAG+A  +    +    +V + DGK   + +  G   D + +G + ++ +     K + 
Sbjct: 244 PIAGYATMQEDGQVSLTALVGSPDGKTILKDTVVGQ--DPVKVGEEVSERLLEKGAKEIL 301

Query: 306 N 306
           +
Sbjct: 302 D 302


>gi|311693131|gb|ADP96004.1| porphobilinogen deaminase [marine bacterium HP15]
          Length = 313

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 172/308 (55%), Gaps = 7/308 (2%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVI--IPLSTKGDRITNRTLTEI 58
           M K+  RI TR S LAL  A   ++ L  +H     NI +  + + T+GD+I +  L +I
Sbjct: 1   MSKRTLRIATRSSALALWQAEFIKAELERLHD----NITVELVKIKTQGDKILDVPLAKI 56

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLF +E+E+ ++ G  D AVHS KD+P +  +GL + A   RED  D F+S+   ++
Sbjct: 57  GGKGLFVKELEEAMLDGRADLAVHSMKDVPMEFPEGLGLVAICEREDPTDAFVSNHYDNV 116

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
             L   +V+GT+SLRR+A L  +R D+ +   RG + TRL KL+  +  AI+LA +G+KR
Sbjct: 117 DALPHGAVVGTASLRREAQLRAYRPDLEIRVLRGNVNTRLAKLDAGEYEAIVLASSGLKR 176

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L   + I+  L      P+ GQGA+ IE  V++     +++ + H+DTWD V  ERA   
Sbjct: 177 LGFHERIRYCLPDTLSLPAVGQGALGIECRVDDQDLLAMLEPLKHKDTWDRVTAERALNR 236

Query: 239 ELDGSCKSAIAGFAYCK-GSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            L+G C+  IA +A  +   T++  G+V A DG     V     R +   +GR+ A+ + 
Sbjct: 237 RLEGGCQVPIAAYALLEDDDTIWLRGLVGAVDGTQIFRVEGRAPRAEGERLGRELAEDLL 296

Query: 298 FISNKNVF 305
            +    V 
Sbjct: 297 ALGADKVL 304


>gi|307250258|ref|ZP_07532212.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306857699|gb|EFM89801.1| Porphobilinogen deaminase [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
          Length = 314

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 163/294 (55%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR SPLAL  A   +  L    + P  ++ ++ + TKGD I + +L +IGGKG
Sbjct: 7   KDTLRIATRQSPLALWQANFVKDELE--KRFPELSVELVTMVTKGDVILDTSLAKIGGKG 64

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L 
Sbjct: 65  LFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDELP 124

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL   
Sbjct: 125 AGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGMP 184

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  +++E   P+ GQGA+ IET V++ +    +  +NH  T   V  ERA    L G
Sbjct: 185 ERIRSFISVEQSLPAAGQGAVGIETRVDDERVLNYLATLNHNPTACCVIAERAMNTRLQG 244

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  I GF+   G+ +    +V A DG      S   +R +A  +G   A+ +
Sbjct: 245 GCQVPIGGFSTLNGNEITLNALVGALDGSNIIRASGVADRENAEQLGISVAEQL 298


>gi|330965074|gb|EGH65334.1| porphobilinogen deaminase [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 313

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 165/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLEIRFLRGNVNTRLAKLDGGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVHVAEAL 294


>gi|26986930|ref|NP_742355.1| porphobilinogen deaminase [Pseudomonas putida KT2440]
 gi|38258017|sp|Q88RE5|HEM3_PSEPK RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|24981540|gb|AAN65819.1|AE016210_7 porphobilinogen deaminase [Pseudomonas putida KT2440]
          Length = 313

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 154/265 (58%), Gaps = 2/265 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H      + ++P+ ++GD++ +  L +IGG
Sbjct: 1   MSTREIRIATRKSALALWQAEYVKARLEQAHT--GLQVTLVPMVSRGDKLLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTFDSLEA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT D V  ERA    L
Sbjct: 179 FEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHVDTADRVIAERALNKRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIV 265
           +G C+  IA +A  +G  L+  G+V
Sbjct: 239 NGGCQVPIACYAVLEGDQLWLRGLV 263


>gi|330985679|gb|EGH83782.1| porphobilinogen deaminase [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 313

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 165/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+ ++  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDASEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FENRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGSVLLHAEARAPQTSAQALGVQVAEAL 294


>gi|299535618|ref|ZP_07048939.1| porphobilinogen deaminase [Lysinibacillus fusiformis ZC1]
 gi|298728818|gb|EFI69372.1| porphobilinogen deaminase [Lysinibacillus fusiformis ZC1]
          Length = 310

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 116/301 (38%), Positives = 161/301 (53%), Gaps = 8/301 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           +G+R S LAL       + L       P    +  + TKGD+I +  L+++GGKGLF +E
Sbjct: 6   VGSRRSKLALTQTNWFINELKAAGV--PFEFEVKEIVTKGDQILDVQLSKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L   EID AVHS KDMP  L  GL I    PRED RD FIS       DL   +V+
Sbjct: 64  IEQALYDKEIDFAVHSMKDMPAVLPDGLVIGCIPPREDARDAFISKGHVKFADLPAGAVV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVIK 186
           GTSSLRR A LL  R DI +   RG ++TRL KL   +  AI+LA AG+KRL   + V+ 
Sbjct: 124 GTSSLRRSAQLLTVRPDIEIKWIRGNVDTRLAKLETEEYDAIILAAAGLKRLGWSDDVVT 183

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E L +E   P+  QG++ IE   ++ +    +  +    TW   + ERAFLA +DG C+ 
Sbjct: 184 EFLPVEQCLPAVAQGSLGIECRADDAELLAELGKLTDSFTWQEAHAERAFLAAMDGGCQV 243

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
            IAG+A   G  +   G+V A D  +  + +  G   DA  IG + A     ++ +  F+
Sbjct: 244 PIAGYATSIGEEITLTGLVAAPDASVVFKETVVGT--DAQKIGEELAA---ILTEQGAFD 298

Query: 307 F 307
            
Sbjct: 299 L 299


>gi|269103733|ref|ZP_06156430.1| porphobilinogen deaminase [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163631|gb|EEZ42127.1| porphobilinogen deaminase [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 294

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 100/262 (38%), Positives = 157/262 (59%), Gaps = 3/262 (1%)

Query: 29  DVHKIPPHNIV-IIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDM 87
           ++ K  P  +V ++P+ TKGD I +  L ++GGKGLF +E+E  ++ G  D AVHS KD+
Sbjct: 10  ELEKAHPGLVVELVPMVTKGDVILDTPLAKVGGKGLFVKELEVAMLEGRADIAVHSMKDV 69

Query: 88  PTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLRRKALLLRWRSDISV 147
           P +  +GL +     RED RD F+S+   SL++L   S++GTSSLRR+  L   R D+ V
Sbjct: 70  PVEFPQGLGLVTICEREDPRDAFVSNRYNSLEELPQGSIVGTSSLRRQCQLRSQRPDLIV 129

Query: 148 IDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIET 207
            D RG + TRL KL++ +  AI+LA AG+KRLK +  I+  +  E   P+ GQGA+ IE 
Sbjct: 130 KDLRGNVNTRLRKLDDGEYDAIILACAGLKRLKMDDRIRAAIAPETSLPAVGQGAVGIEC 189

Query: 208 HVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLA 267
            +++ + ++L+  +NH++T   V CERA    L G C+  I  +A  +G  ++   +V  
Sbjct: 190 RLDDTRVRDLLAALNHQETATRVLCERAMNNRLQGGCQVPIGSYAELQGDQIWLRALVGE 249

Query: 268 SDGK--IFHEVSRNGNRCDAIN 287
            DG   +  E+S + N  +A+ 
Sbjct: 250 PDGSQIVRGEISGSANDAEALG 271


>gi|291485230|dbj|BAI86305.1| porphobilinogen deaminase [Bacillus subtilis subsp. natto BEST195]
          Length = 314

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 120/303 (39%), Positives = 169/303 (55%), Gaps = 13/303 (4%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIV-IIPLSTKGDRITNRTLTEIGGKG 62
           +  ++G+R S LA+     T+  +  + +I P  +  I  + TKGDRI + TL+++GGKG
Sbjct: 3   RTIKVGSRRSKLAMTQ---TKWVIQKLKEINPSFVFEIKEIVTKGDRIVDVTLSKVGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +EIE+ L++ EID AVHS KDMP  L +GL I     RED RD  IS     L ++ 
Sbjct: 60  LFVKEIEQALLNEEIDMAVHSMKDMPAVLPEGLVIGCIPEREDPRDALISKNRVKLSEMK 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-K 181
             +VIGTSSLRR A LL  R D+++   RG I+TRL KL      AI+LA AG+ R+  K
Sbjct: 120 EGAVIGTSSLRRSAQLLIERPDLTIKWIRGNIDTRLQKLETEDYDAIILAAAGLSRMGWK 179

Query: 182 EKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELD 241
           + V+ E L  E   P+ GQGA+ IE   ++ +   L      E T  +V  ERAFL  ++
Sbjct: 180 QDVVTEFLEPERCLPAVGQGALAIECRESDEELLALFSQFTDEYTKRTVLAERAFLNAME 239

Query: 242 GSCKSAIAGFAYCKGS-TLYFYGIVLASDGKIFHEVSRNGN-------RCDAINIGRDAA 293
           G C+  IAG++   G   +   G+V + DGKI  + +  GN       RC A+   R A 
Sbjct: 240 GGCQVPIAGYSVLNGQDEIEMTGLVASPDGKIIFKETVTGNDPEEVGKRCAALMADRGAK 299

Query: 294 QYI 296
             I
Sbjct: 300 DLI 302


>gi|260888475|ref|ZP_05899738.1| hydroxymethylbilane synthase [Selenomonas sputigena ATCC 35185]
 gi|330838215|ref|YP_004412795.1| Porphobilinogen deaminase [Selenomonas sputigena ATCC 35185]
 gi|260861672|gb|EEX76172.1| hydroxymethylbilane synthase [Selenomonas sputigena ATCC 35185]
 gi|329745979|gb|AEB99335.1| Porphobilinogen deaminase [Selenomonas sputigena ATCC 35185]
          Length = 311

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 173/306 (56%), Gaps = 2/306 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+K    IGTR S LAL  A    + L +  + P  ++V   ++TKGDR+ +  L +IGG
Sbjct: 1   MKKDTIVIGTRSSKLALWQADYVEAKLRE--RYPELHVVQKRMTTKGDRVLDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E+ +++GEID AVHS KDMPT+L +GL ++A   R D  D  +S   Q+L +
Sbjct: 59  KGLFTKELEQAMLAGEIDLAVHSLKDMPTELPEGLMLAAVTERFDPGDAVVSPRYQTLAN 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+A LL  R D+ ++  RG + TRL KL      AI+LA AG+KRL 
Sbjct: 119 LPQGAKVGTSSLRRRAQLLAKRPDLEIVSLRGNVNTRLKKLEEENFDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I EIL  E   P+ GQGA+ IE   ++     L+  ++   T  +   ERAFLA +
Sbjct: 179 FHDRITEILPREICLPAVGQGALAIEARADDEATLSLIAFLDDAATRAAARAERAFLARV 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFIS 300
           +G C+  +  +A      L    ++ + DG+  +   + G+  DA  IGR  A+ +  + 
Sbjct: 239 EGGCQVPVGVYAEAADEALEMEAVIASIDGERLYRKKKAGSALDAEKIGRALAEELLAMG 298

Query: 301 NKNVFN 306
            K +  
Sbjct: 299 GKEILQ 304


>gi|301155139|emb|CBW14603.1| hydroxymethylbilane synthase [Haemophilus parainfluenzae T3T1]
          Length = 310

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 156/267 (58%), Gaps = 2/267 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  +I TR SPLAL  A   +  L   H  P  ++ ++P+ TKGD I +  L +IGGKGL
Sbjct: 5   KTLKIATRQSPLALWQANFVKDQLEKFH--PTLSVELVPMVTKGDVILDSPLAKIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+    D AVHS KD+P +  +GL +S    RED RD F+S+T +SL +L  
Sbjct: 63  FVKELENALLEKRADIAVHSMKDVPMEFPEGLGLSVICKREDPRDAFVSNTYRSLDELPQ 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +++GTSSLRR+  L + R D+ +   RG + TRL+KL+N++  AI+LA AG+ RL   +
Sbjct: 123 GAIVGTSSLRRQCQLKQLRPDLDIRSLRGNVGTRLSKLDNSEYDAIILASAGLIRLGLAE 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I   + +E   P+ GQGA+ IE  V++ + + L+  ++   T   V  ERA    L G 
Sbjct: 183 RIASFIEVEQSLPAAGQGAVGIECRVDDEEVKALLAPLSDATTTTCVLAERAMNTRLQGG 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDG 270
           C+  I G+A  +   ++   +V  +DG
Sbjct: 243 CQVPIGGYAIEQNGEIFLRALVGEADG 269


>gi|295399407|ref|ZP_06809389.1| porphobilinogen deaminase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312110034|ref|YP_003988350.1| porphobilinogen deaminase [Geobacillus sp. Y4.1MC1]
 gi|294978873|gb|EFG54469.1| porphobilinogen deaminase [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311215135|gb|ADP73739.1| porphobilinogen deaminase [Geobacillus sp. Y4.1MC1]
          Length = 310

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 115/291 (39%), Positives = 167/291 (57%), Gaps = 6/291 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           +G+R S LAL         L  +    P    +  + TKGD+I + TL+++GGKGLF +E
Sbjct: 6   VGSRRSKLALTQTNWVIEQLRQLG--APFEFEVKEIVTKGDKILDVTLSKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE  +++ EID AVHS KDMP  L  GL I    PRED RDV IS   ++  DL   +V+
Sbjct: 64  IEHAMLNNEIDMAVHSMKDMPAVLPDGLIIGCVPPREDHRDVLISKNKETFADLPSGAVV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KEKVIK 186
           GTSSLRR A LL  R D+++   RG I+TRL KL      AI+LA AG+ R+     VI 
Sbjct: 124 GTSSLRRSAQLLAKRPDLTIKWIRGNIDTRLAKLQTEDYDAIVLAAAGLVRMGWASDVIT 183

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E L  +   P+ GQGA+ +E   ++ + +E ++ +N  DT  +V  ERAFL +L+G C+ 
Sbjct: 184 EYLATDVCLPAVGQGALAVECRESDEELREWLQKLNDIDTERAVYAERAFLRQLEGGCQV 243

Query: 247 AIAGFAYCKGST-LYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            IAG+A+      +    +V + DGK  ++ + +G+  D  N+G  AA  +
Sbjct: 244 PIAGYAHVNNQNDIVLTALVASPDGKELYKETVSGS--DPENVGTTAADLL 292


>gi|310643595|ref|YP_003948353.1| phosphate abc transporter, atpase subunit [Paenibacillus polymyxa
           SC2]
 gi|309248545|gb|ADO58112.1| Phosphate ABC transporter, ATPase subunit [Paenibacillus polymyxa
           SC2]
          Length = 308

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 110/277 (39%), Positives = 163/277 (58%), Gaps = 4/277 (1%)

Query: 8   IGTRCSPLAL---AHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLF 64
           +G+R S LAL    H  E  ++L   H +     VI  + TKGDRI + TL+++GGKGLF
Sbjct: 6   VGSRQSALALTQTGHVIEDLNALCAEHGLD-LQFVIKKILTKGDRILDVTLSKVGGKGLF 64

Query: 65  TEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALH 124
            +EIE+ +++GEID AVHS KDMP++L +GL   A   RED RD  I+  A+SL+DL   
Sbjct: 65  VKEIEQAMLAGEIDMAVHSMKDMPSELPEGLVNGAVPRREDPRDCLITLGAKSLEDLPSG 124

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + +GTSSLRR + +   R D+ +   RG I++RL KL      AI+LA AG+ R+  +  
Sbjct: 125 AKVGTSSLRRASQIKSMRPDLQLEPVRGNIDSRLKKLETEGFDAIILAAAGLHRMGWKDR 184

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I   +  E   P+ GQGA+ IE   ++ +   L+++ NH+DT  +V  ER FL  L+G C
Sbjct: 185 ITSYIPEEACLPAVGQGALGIECRASDEELLALLRLYNHQDTSATVEAERTFLGVLNGGC 244

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGN 281
           +  I   A   G  +   G+V + DG++  + +  GN
Sbjct: 245 QVPIGAHAVWAGQEISLTGMVGSPDGEVILKETLQGN 281


>gi|149199469|ref|ZP_01876504.1| Prolyl 4-hydroxylase, alpha subunit [Lentisphaera araneosa
           HTCC2155]
 gi|149137404|gb|EDM25822.1| Prolyl 4-hydroxylase, alpha subunit [Lentisphaera araneosa
           HTCC2155]
          Length = 307

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 117/308 (37%), Positives = 174/308 (56%), Gaps = 12/308 (3%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR S LAL  A   +S L++V   P   I +  + T+GD+I + +L +IGGKGLF 
Sbjct: 3   LRIATRGSQLALWQAEHVKSRLLEVD--PSLEIELKIIKTQGDKILDVSLAKIGGKGLFV 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ ++  E D AVHS KD+P +L +GL + A L RED RD F+S+  +SL +L   +
Sbjct: 61  KEIEQAMMDDEADLAVHSMKDVPAELPEGLILQAILEREDPRDAFVSNKYKSLDELPEGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR + L R +  +     RG + TRL KL+++K  AI+LA AG+ RL+    I
Sbjct: 121 VVGTSSLRRASQLYR-QYPVKTELLRGNVNTRLAKLDDDKYDAIILAAAGLIRLEFGDRI 179

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L+ + F PSPGQGA+ IE   ++ +   L+  +NH +T   V  ER F   + GSC+
Sbjct: 180 ADSLDPDKFIPSPGQGAVGIECREDDAELCALLNKLNHTETSIRVKVEREFNLAIGGSCQ 239

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAIN---------IGRDAAQYI 296
                +A   G +      V + DGK ++    +G+  D            I R AA+ I
Sbjct: 240 VPAGCYATIDGDSFELRAFVASPDGKEYYREDMSGDLKDLPGKGTEIANKLIARGAAEII 299

Query: 297 RFISNKNV 304
           + +  K+V
Sbjct: 300 KDLLGKDV 307


>gi|88813066|ref|ZP_01128308.1| porphobilinogen deaminase [Nitrococcus mobilis Nb-231]
 gi|88789699|gb|EAR20824.1| porphobilinogen deaminase [Nitrococcus mobilis Nb-231]
          Length = 309

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 163/294 (55%), Gaps = 2/294 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M ++  RI TR SPLAL  A    + L    + P   + ++ ++T+GDRI +  L  IGG
Sbjct: 1   MSRRRLRIATRKSPLALWQAEHVAAELR--RRYPELEVELVAMTTRGDRILDTPLARIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           K LF +E+E+ +  G  D AVHS KD+P +L +G+ +   L RED  D F+++  Q L  
Sbjct: 59  KALFVKELERGIWEGRADIAVHSIKDVPAELPEGMHLPVVLEREDPCDAFVANLYQDLAA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L + + +GT+SLRR+  L   R D+ V   RG ++TRL KL + K  AI+LA AG++RL 
Sbjct: 119 LPIGARVGTASLRRECQLRAQRPDLRVGTLRGNVQTRLAKLESGKFDAIVLAAAGLRRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L  E   P+ GQGA+ IE   ++ +  EL+  + H  ++  +  ERA  A L
Sbjct: 179 LAERIRCTLTPEQSLPAVGQGALGIECRSDDREINELIAPLTHSPSYLRITAERAVNARL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
           +GSC+  IA FA   GS ++   +V + DG         G     +++G   A+
Sbjct: 239 EGSCQVPIAAFAVLDGSNIWLRALVGSRDGSCVLRGEIRGPAGTGVSLGGQLAE 292


>gi|255658552|ref|ZP_05403961.1| hydroxymethylbilane synthase [Mitsuokella multacida DSM 20544]
 gi|260849356|gb|EEX69363.1| hydroxymethylbilane synthase [Mitsuokella multacida DSM 20544]
          Length = 315

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 113/290 (38%), Positives = 166/290 (57%), Gaps = 3/290 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+     IGTR S LAL  A      L    + P   +    ++TKGD+I +  L +IGG
Sbjct: 1   MKNDTIVIGTRSSKLALWQADYVADCLR--KRYPELRVEKKLMTTKGDKILDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E+ +++G ID AVHS KDMPT++ +GL ISA   R D  D  +S   ++L++
Sbjct: 59  KGLFTKELEQDMLAGGIDIAVHSLKDMPTEVPEGLVISAITERFDPGDAVVSPKYRTLEN 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRRKA LL  R D+ + D RG + TRL KL      AI+LA AG+KRL 
Sbjct: 119 LPQGAKVGTSSLRRKAQLLHARPDLQISDLRGNVNTRLEKLEREHFDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I E+L  E   P+ GQGA+ IET  N+ + + L+  +N E T      ERAFLA +
Sbjct: 179 FADRITEVLPREMVLPAVGQGALAIETRENDREVRNLIAFLNDEATVACARAERAFLARV 238

Query: 241 DGSCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
           +G C+  +  +A  +    L+   ++ + DG   +  +  G+  +A ++G
Sbjct: 239 EGGCQVPVGVYAVPEAEGRLHVEAVIASLDGARLYRDAAVGSAAEAESLG 288


>gi|94969590|ref|YP_591638.1| porphobilinogen deaminase [Candidatus Koribacter versatilis
           Ellin345]
 gi|123256362|sp|Q1INI6|HEM3_ACIBL RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|94551640|gb|ABF41564.1| hydroxymethylbilane synthase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 311

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 168/291 (57%), Gaps = 6/291 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIG+R S LAL  A    + L +      H + +  + T GD+I +  L ++G KG+FT
Sbjct: 4   LRIGSRGSQLALWQANHISALLRERG----HEVELEIIKTTGDKILDVALAKVGTKGMFT 59

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L +G++D AVHS KD+PT+L +G +++A   RE+ RDVF+S    S+  L   +
Sbjct: 60  KEIEEALAAGKVDVAVHSLKDLPTELPQGFELAAVTKRENPRDVFLSVKYDSISGLPQGA 119

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A +   R D+ +   RG ++TR+ KL   +  AI+LA+AG+ RL K +++
Sbjct: 120 KVGTSSLRRQAQIKAIRPDLEIFPLRGNVDTRVRKLEQGEYDAIILAFAGLNRLGKTQLV 179

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
           KEI++ +   P+ GQGA+ IE  + + + +E++  +N  D   +   ERA L +L G C+
Sbjct: 180 KEIISEDVMCPAAGQGALGIEIRLGDTRMREILSFLNDYDARATTTAERALLNQLGGGCQ 239

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
             I  FA  K   ++   I    DG      S++G   D  ++G +  + +
Sbjct: 240 VPIGAFAEVKDGQVHLTAICARPDGSEILRESKSG--ADPAHLGEEVGKTL 288


>gi|88861269|ref|ZP_01135901.1| porphobilinogen deaminase [Pseudoalteromonas tunicata D2]
 gi|88816750|gb|EAR26573.1| porphobilinogen deaminase [Pseudoalteromonas tunicata D2]
          Length = 312

 Score =  188 bits (478), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 165/288 (57%), Gaps = 2/288 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR S LAL  A   ++ L ++H  P   + ++P+ST+GD+I +  L +IGGKGLF 
Sbjct: 8   LRIATRKSALALWQAEFVKAQL-EIHH-PGIQVELVPMSTQGDKILDTPLAKIGGKGLFV 65

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E+ ++ G  D AVHS KD+P +  +GL+++    RED RD F+S+  +++++L   +
Sbjct: 66  KELEQAMLEGRADIAVHSMKDVPVEFPEGLELNTICEREDPRDAFVSNRFKTIEELPQGA 125

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRR+  +   R D+ + D RG + TRL KL+  +  AI+LA AG+ RL+  + I
Sbjct: 126 VVGTSSLRRQCQIRALRPDLEIRDLRGNVNTRLAKLDEGQYDAIILAAAGLIRLEMPQRI 185

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              +  E   P+ GQGA+ IE   ++   ++L+  + H +T   V  ERA    L+G C+
Sbjct: 186 ASFIEPEQSLPANGQGAVGIECRSDDITTKQLLAALEHTETRIRVLAERAMNRRLEGGCQ 245

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
             I  FA   G  +   G+V A DG         G   DA  +G + A
Sbjct: 246 VPIGAFAQVSGEHITIRGLVGAIDGSEILRDQVQGLCADAEQLGVELA 293


>gi|190575960|ref|YP_001973805.1| porphobilinogen deaminase [Stenotrophomonas maltophilia K279a]
 gi|229846305|sp|B2FI06|HEM3_STRMK RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|190013882|emb|CAQ47520.1| putative porphobilinogen deaminase [Stenotrophomonas maltophilia
           K279a]
          Length = 303

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 151/267 (56%), Gaps = 3/267 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  +      L   H  P  ++ ++P+ST+GD + +R+L  IGGKGLF 
Sbjct: 4   VRIATRKSPLALWQSEHVADRLRQAH--PGLHVELVPMSTRGDEVLDRSLAAIGGKGLFL 61

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +E+E  ++ GE DCAVHS KD+P +L     + A L R D  D F+S+   SL  L + +
Sbjct: 62  KELELAMLRGEADCAVHSLKDVPMELDPPFALPAMLTRHDPADGFVSNLYASLDALPIGA 121

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A L   R D+ ++D RG + TRL KL+N    AI+LA AG++RL   + I
Sbjct: 122 RVGTSSLRRQAQLRALRPDLELLDLRGNVNTRLAKLDNGGYDAIVLAVAGLERLGLGERI 181

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L    + P+P QGA+ +E    N +   L   ++   T   V  ERA    L GSC 
Sbjct: 182 VARLQPPQWLPAPAQGAVAVECDGGNARLMALFAPLDDAATRACVEAERAMNRALHGSCH 241

Query: 246 SAIAGFAYCKGSTLYFYGIV-LASDGK 271
             +A  A  +G  L+  G+V  ASDG+
Sbjct: 242 VPVAAIAQWQGDDLHLQGLVGSASDGR 268


>gi|315634981|ref|ZP_07890262.1| hydroxymethylbilane synthase [Aggregatibacter segnis ATCC 33393]
 gi|315476243|gb|EFU66994.1| hydroxymethylbilane synthase [Aggregatibacter segnis ATCC 33393]
          Length = 346

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 157/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M KK  +I TR SPLAL  A   ++ L  ++  P  +I ++ + TKGD I +  L +IGG
Sbjct: 39  MFKKTLKIATRQSPLALWQANFVKARLQQLY--PDLSIELVTMVTKGDVILDSPLAKIGG 96

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L++ E D AVHS KD+P +  +GL +S    RED RD F+S+T ++L +
Sbjct: 97  KGLFVKELENALLNNEADIAVHSMKDVPMQFPEGLGLSVICKREDPRDAFVSNTYRTLAE 156

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+ RL 
Sbjct: 157 LPPGAIVGTSSLRRQCQLKALRPDLEIRSLRGNVGTRLSKLDNGDFDAIILASAGLIRLG 216

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   + +E   P+ GQGA+ IE   N+ + ++L+  +   +T   V  ERA    L
Sbjct: 217 LADRITSFIEVEQSLPAAGQGAVGIECRTNDEQVKQLLAPLADVETTYCVLAERAMNNRL 276

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            G C+  I G+A  + S L    +V + DG
Sbjct: 277 QGGCQVPIGGYAVLRESMLNLRALVGSVDG 306


>gi|269798482|ref|YP_003312382.1| porphobilinogen deaminase [Veillonella parvula DSM 2008]
 gi|282849932|ref|ZP_06259315.1| hydroxymethylbilane synthase [Veillonella parvula ATCC 17745]
 gi|269095111|gb|ACZ25102.1| porphobilinogen deaminase [Veillonella parvula DSM 2008]
 gi|282580369|gb|EFB85769.1| hydroxymethylbilane synthase [Veillonella parvula ATCC 17745]
          Length = 312

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 107/301 (35%), Positives = 169/301 (56%), Gaps = 2/301 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A    + L  ++  P   + ++  +TKGDRI  + L ++GGKGLFT
Sbjct: 5   IRIGTRKSALALWQAEHISAELQRLY--PNITVELVHFNTKGDRILEKPLAQVGGKGLFT 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            E+E+ + +G+ID AVHS KDMPT+L +GL + A   RE   D  +S   ++L  L   +
Sbjct: 63  AELEEAMHAGDIDIAVHSLKDMPTELPEGLTLGAISAREVPYDALVSPVYKTLDKLPQGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A LL  R D+ V   RG ++TRL+K+   K   ++LA AG+KRL  E  I
Sbjct: 123 RVGTSSLRRQAQLLHVRPDLKVEVIRGNVQTRLSKIETEKLDGVILAQAGLKRLGLEDQI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++   ++  P+ GQGA+ IE   ++ +  +++  IN E T  +V  ER+FL +L+G C+
Sbjct: 183 TQVFKADEMIPAVGQGALAIECRADDTEMLDMLDPINDEATRYAVEGERSFLRQLNGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVF 305
             +          L    ++ + DGK  +E   +G       +G++ A+ +     K + 
Sbjct: 243 VPMGVHGTINKGQLTLKAMIASLDGKTVYEGEISGPAKKGEILGKNLAKALYEEGGKRIV 302

Query: 306 N 306
           +
Sbjct: 303 D 303


>gi|332360583|gb|EGJ38393.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK1056]
          Length = 306

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 112/308 (36%), Positives = 168/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKAIH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L +L 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQTLANLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLAFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + + L+  +  E T   V  ERA LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRSLLATVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA FA   G       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAAFAQKNGQNYQLEAMLAKEDGQCVF-VSLQGQDGQQL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|331018514|gb|EGH98570.1| porphobilinogen deaminase [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 313

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 166/296 (56%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T +SL  
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFESLDA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  + +AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYNAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   +  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRLIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G++         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGRVLLHADARAPQTSAQALGVQVAEAL 294


>gi|326796191|ref|YP_004314011.1| porphobilinogen deaminase [Marinomonas mediterranea MMB-1]
 gi|326546955|gb|ADZ92175.1| Porphobilinogen deaminase [Marinomonas mediterranea MMB-1]
          Length = 308

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 108/269 (40%), Positives = 157/269 (58%), Gaps = 2/269 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K    I TR S LAL  A   +  L  ++  P   + ++ ++TKGD+I +  L++IGGKG
Sbjct: 2   KDKIVIATRESKLALWQANTVKKQLETLY--PNLTVELLGMTTKGDQILDSPLSKIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+ G  D AVHS KD+P    KGL ++    RED  D F+S+   SL +L 
Sbjct: 60  LFVKELESALLDGRADIAVHSMKDVPMAFPKGLGLAVICEREDPSDAFVSNKYSSLDELP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             SV+GTSSLRR   + + R D+ +   RG + TRL KL+NN+  AI+LA AG+ RL+ E
Sbjct: 120 KGSVLGTSSLRRACQIQQHRPDLKIESLRGNVGTRLGKLDNNEYDAIILATAGLIRLELE 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             IK  L+     P+ GQGA+ IE   N+    EL+  + H+DT+  V  ERA    L+G
Sbjct: 180 DRIKSRLSDTYCLPAGGQGAMGIECRDNDKDILELLAPLQHQDTYYRVTAERAVNKRLNG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGK 271
            C++ IA FA      ++  G+V ++DG+
Sbjct: 240 GCQAPIACFATLSDGEIWLRGLVGSTDGQ 268


>gi|24211767|sp|Q9CK24|HEM3_PASMU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
          Length = 309

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 109/296 (36%), Positives = 164/296 (55%), Gaps = 3/296 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  RI TR SPLAL  A   ++ L  +H      + ++P+ TKGD I +  L +IGG
Sbjct: 2   MTRKSLRIATRQSPLALWQANYVKACLEKIHA--GLVVELVPMVTKGDVILDTPLAKIGG 59

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L+ GE D AVHS KD+P +   GL +S    RED RD F+S++ ++L +
Sbjct: 60  KGLFVKELEQALLKGEADIAVHSMKDVPMQFPAGLMLSTICQREDPRDAFVSNSYRTLME 119

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL KL+N    AI+LA AG+ RL 
Sbjct: 120 LPAGAVVGTSSLRRQCQLKQLRPDLHIHSLRGNVGTRLAKLDNGDYDAIILAAAGLIRLG 179

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           +++ I  ++++    P+ GQGA+ IE      + + L+  +   +T   V  ERA    L
Sbjct: 180 QQQRITSLIDVTQCLPAVGQGAVGIECR-QEAEIELLLAPLADPETTACVLAERAMNRHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            G C+  IAG+A  +   L+   +V   DG             DA  +G   A+ +
Sbjct: 239 QGGCQVPIAGYAIIEEGQLFLRALVGEVDGSSILRAEGRSAVADAETLGIQVAEKL 294


>gi|212633296|ref|YP_002309821.1| porphobilinogen deaminase [Shewanella piezotolerans WP3]
 gi|212554780|gb|ACJ27234.1| Porphobilinogen deaminase [Shewanella piezotolerans WP3]
          Length = 294

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 153/270 (56%)

Query: 37  NIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQ 96
            + ++P+STKGD I +  L ++GGKGLF +E+E  ++    D AVHS KD+P    +GL 
Sbjct: 19  TVELLPMSTKGDIILDTPLAKVGGKGLFVKELEVAMLEDRADIAVHSMKDVPVDFPEGLG 78

Query: 97  ISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIET 156
           +     RED RD F+S+   S+ +L   +V+GTSSLRR+  +   R D+ + D RG + T
Sbjct: 79  LEVICEREDPRDAFVSNNFSSINELPQGAVVGTSSLRRQCQIRAARPDLQIKDLRGNVGT 138

Query: 157 RLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQE 216
           RL KL+     AI+LA AG+KRLK E+ I   ++ ED  P+ GQGA+ IE   ++ + + 
Sbjct: 139 RLAKLDAGNYDAIILAAAGLKRLKLEERITSFISAEDSLPANGQGAVGIECRTDDARVKA 198

Query: 217 LVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEV 276
           L+  + H +T   V  ERA    L+G C+  I  +A   G TL   G+V   DG    E 
Sbjct: 199 LLAPLEHLETRQRVIAERAMNTRLEGGCQVPIGAYAEIDGDTLSLRGLVGNPDGSQVIEA 258

Query: 277 SRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
           + +GN+ DA  +G   A+ +     K + +
Sbjct: 259 ATSGNKNDAEQLGVALAEELLSKGAKTILD 288


>gi|15603677|ref|NP_246751.1| porphobilinogen deaminase [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12722234|gb|AAK03896.1| Pbg [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 312

 Score =  188 bits (478), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 109/296 (36%), Positives = 164/296 (55%), Gaps = 3/296 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M +K  RI TR SPLAL  A   ++ L  +H      + ++P+ TKGD I +  L +IGG
Sbjct: 5   MTRKSLRIATRQSPLALWQANYVKACLEKIHA--GLVVELVPMVTKGDVILDTPLAKIGG 62

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ L+ GE D AVHS KD+P +   GL +S    RED RD F+S++ ++L +
Sbjct: 63  KGLFVKELEQALLKGEADIAVHSMKDVPMQFPAGLMLSTICQREDPRDAFVSNSYRTLME 122

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L + R D+ +   RG + TRL KL+N    AI+LA AG+ RL 
Sbjct: 123 LPAGAVVGTSSLRRQCQLKQLRPDLHIHSLRGNVGTRLAKLDNGDYDAIILAAAGLIRLG 182

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
           +++ I  ++++    P+ GQGA+ IE      + + L+  +   +T   V  ERA    L
Sbjct: 183 QQQRITSLIDVTQCLPAVGQGAVGIECR-QEAEIELLLAPLADPETTACVLAERAMNRHL 241

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            G C+  IAG+A  +   L+   +V   DG             DA  +G   A+ +
Sbjct: 242 QGGCQVPIAGYAIIEEGQLFLRALVGEVDGSSILRAEGRSAVADAETLGIQVAEKL 297


>gi|317498182|ref|ZP_07956483.1| porphobilinogen deaminase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316894537|gb|EFV16718.1| porphobilinogen deaminase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 312

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 114/303 (37%), Positives = 163/303 (53%), Gaps = 5/303 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
           + IG+R S LAL      +  L   +  P H   I  + TKGD+I N+ L +IGGKGLF 
Sbjct: 3   YIIGSRGSRLALIQTKYVQEKLAKAY--PEHTFEIQIIKTKGDKIQNKPLDKIGGKGLFV 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+K+ISGEI   VHS KDMP+   KGL  +    RED RDV I  TA+ L +L   +
Sbjct: 61  KEIEEKIISGEIHMGVHSMKDMPSTPAKGLVFTKVWKREDPRDVLILRTAKHLSELREGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           VI T S RR   LL+ R D+ +I+ RG ++TRL K+   +   I+LA AG+KRL  E VI
Sbjct: 121 VIATGSKRRAFQLLKLRPDLQIINIRGNVDTRLRKMEEQQLDGIVLAAAGLKRLGMEDVI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L  ED   +P QGA+ +E   +  + Q+++ V   E+T + V  ER FL ++ GSC 
Sbjct: 181 TQYLAPEDMISAPAQGALALEVREDQKELQKMLDVFCDEETMNEVCAERNFLEQMGGSCH 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN-V 304
           +               Y +    DG         G  C  I + + A + I+  + +N +
Sbjct: 241 TPAGARCQKTDQGYELYAMFGNEDGSKQAYTKVYGT-CPEI-LAQTAVKNIKKTAGRNRI 298

Query: 305 FNF 307
           FN+
Sbjct: 299 FNW 301


>gi|313633107|gb|EFS00005.1| porphobilinogen deaminase [Listeria seeligeri FSL N1-067]
          Length = 309

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 168/297 (56%), Gaps = 7/297 (2%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+   +G+R S LAL  +    + L + +  P  +  I  + TKGDRI + TL+++GGKG
Sbjct: 2   KRKIIVGSRRSKLALTQSGWVIARLKENY--PEIDFEIKEIVTKGDRILDVTLSKVGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF  E+E+ L  G ID AVHS KD+P+ + +GL I A   RE   D F+ +T  S  DL 
Sbjct: 60  LFVSEVEQALSDGAIDFAVHSMKDVPSSIKEGLTIGAIPKRESALDCFVFNTVGSFHDLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             +VIGTSSLRR A +LR R D  +   RG I+TRL KL++    AI+LA AG+ R   L
Sbjct: 120 TAAVIGTSSLRRAAQILRQRPDFVIKPIRGNIDTRLQKLHDENFDAIILAKAGLSRMGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
           +   +  E ++ E   P+ GQGA+ IE   N+ +  +++  I+HE+T   V  ER FL +
Sbjct: 180 ENTTLKLEDISPELCLPAVGQGALAIECRENDKQICDMLASIHHEETGICVEAERVFLKK 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           L+G C+  IAGFA      + F G+V  +DG       R G   + + IG   A+ +
Sbjct: 240 LNGGCEIPIAGFATKTAGQIKFKGLVGNADGSTILSAERTGE--NPMTIGNQVAEAL 294


>gi|257485539|ref|ZP_05639580.1| porphobilinogen deaminase [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331011831|gb|EGH91887.1| porphobilinogen deaminase [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 313

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 164/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FENRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPAGSVLLHAEARAPQTSAQALGVQVAEAL 294


>gi|66043333|ref|YP_233174.1| porphobilinogen deaminase [Pseudomonas syringae pv. syringae B728a]
 gi|289677629|ref|ZP_06498519.1| porphobilinogen deaminase [Pseudomonas syringae pv. syringae FF5]
 gi|302187597|ref|ZP_07264270.1| porphobilinogen deaminase [Pseudomonas syringae pv. syringae 642]
 gi|75504025|sp|Q500N6|HEM3_PSEU2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|63254040|gb|AAY35136.1| Porphobilinogen deaminase [Pseudomonas syringae pv. syringae B728a]
 gi|330901069|gb|EGH32488.1| porphobilinogen deaminase [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330952274|gb|EGH52534.1| porphobilinogen deaminase [Pseudomonas syringae Cit 7]
 gi|330970393|gb|EGH70459.1| porphobilinogen deaminase [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 313

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 163/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLENNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGSVLLHADARAPQTSAQALGVQVAEAL 294


>gi|289625848|ref|ZP_06458802.1| porphobilinogen deaminase [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646420|ref|ZP_06477763.1| porphobilinogen deaminase [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298484668|ref|ZP_07002771.1| Porphobilinogen deaminase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160808|gb|EFI01826.1| Porphobilinogen deaminase [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320326724|gb|EFW82769.1| porphobilinogen deaminase [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331302|gb|EFW87245.1| porphobilinogen deaminase [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330867941|gb|EGH02650.1| porphobilinogen deaminase [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330881670|gb|EGH15819.1| porphobilinogen deaminase [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 313

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 164/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FENRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPAGSVLLHAEARAPQTSAQALGVQVAEAL 294


>gi|254490211|ref|ZP_05103401.1| porphobilinogen deaminase [Methylophaga thiooxidans DMS010]
 gi|224464558|gb|EEF80817.1| porphobilinogen deaminase [Methylophaga thiooxydans DMS010]
          Length = 309

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 164/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K+  RI TR SPLA+  A   + SL+ +H  P   + ++ + T+GD I +  L ++GG
Sbjct: 1   MSKRTVRIATRNSPLAVWQAEFVKDSLLALH--PDLTVELVKMKTQGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E+ ++ G  D AVHS KD+P +  +GL +     RED  D F+S+  Q++ D
Sbjct: 59  KGLFVKELEQGMLDGRADIAVHSMKDVPVEFPEGLHLPVICKREDPHDAFVSNHYQTIDD 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRR+      R D+ V+  RG + TRL KL+  +  AI+LA AG+KRL 
Sbjct: 119 LPHGARLGTSSLRRECQARTHRPDLEVLPLRGNVNTRLRKLDEGQFDAIILAMAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            +  I+  L  E   P+ GQGA+ IET +++ +   L+  ++   T   +  ERA    L
Sbjct: 179 FDDRIRSALTPEQSLPAIGQGALGIETRIDDDEMNALIAPLHCPQTAIVLTAERALNRRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            G C+  IAG+A  +G  ++  G+V   DG         G   DA  +G   A+ +
Sbjct: 239 SGGCQVPIAGYAMLEGDEVWLRGLVGRPDGTNTLYADVRGAAKDADKLGVQIAETL 294


>gi|303247619|ref|ZP_07333890.1| porphobilinogen deaminase [Desulfovibrio fructosovorans JJ]
 gi|302491099|gb|EFL50993.1| porphobilinogen deaminase [Desulfovibrio fructosovorans JJ]
          Length = 310

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 166/300 (55%), Gaps = 4/300 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           I TR S LAL  A    + L + H  P   + ++P+ TKGDRI +  L ++GGKGLF +E
Sbjct: 7   IATRGSKLALWQANHVAARLKEAH--PGLAVDLLPIKTKGDRILDVPLAKVGGKGLFVKE 64

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L+ G  D AVHS KD+P +   GL +     RED  D+ +S     L  L   + +
Sbjct: 65  IEEALLDGRADLAVHSMKDVPAEQPAGLVVGITPKREDPCDMLLSVAYDGLDALPEGAKV 124

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSSLRRKA L   R D++++D RG ++TR+ KL +    AI++A AG+ RL       E
Sbjct: 125 GTSSLRRKAQLTALRPDLAIVDLRGNLDTRVGKLTDGLFDAIVVARAGLNRLGLSAPKSE 184

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
            L    F P+  QGA+ IE   ++ +   ++   +H ++ D+V  ERAFL  L+G C+  
Sbjct: 185 RLCPPRFLPAAAQGALGIEYRFDDRETAAMLAFFDHPESRDAVAAERAFLGRLEGGCQVP 244

Query: 248 IAGFAYCKGSTLYFYGIVLASD-GKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
           IA  A   G+ +   G+V   D G+ F +V+  G R DA+ +G+  A  +  +  + + +
Sbjct: 245 IAAHAVIDGNLISIDGLVADPDTGRTFRDVA-TGKRDDAVELGKKLADSVLAMGARAILD 303


>gi|70733286|ref|YP_263060.1| porphobilinogen deaminase [Pseudomonas fluorescens Pf-5]
 gi|123734674|sp|Q4K3X3|HEM3_PSEF5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|68347585|gb|AAY95191.1| porphobilinogen deaminase [Pseudomonas fluorescens Pf-5]
          Length = 313

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 165/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L + H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLQEAH--PGLVVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+  + D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLENQADIAVHSMKDVPMDFPEGLGLFCICEREDPRDAFVSNTYASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPEGSVVGTSSLRRQAQLLTRRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++H DT   V  ERA    L
Sbjct: 179 FEDRISSSISVDDSLPAGGQGAVGIECRSADIEIHALLAPLHHADTASRVTAERALNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G +       G R  A  +G   A  +
Sbjct: 239 NGGCQVPIACYAVLEGEQIWLRGLVGEPSGGLLLSAEARGPRASAAELGVQVADAL 294


>gi|330976469|gb|EGH76521.1| porphobilinogen deaminase [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 313

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 163/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLIVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL  
Sbjct: 59  KGLFVKELETALLENNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDQ 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDDVWLRGLVGDPSGSVLLHADARAPQTSAQALGVQVAEAL 294


>gi|322514003|ref|ZP_08067077.1| hydroxymethylbilane synthase [Actinobacillus ureae ATCC 25976]
 gi|322120153|gb|EFX92114.1| hydroxymethylbilane synthase [Actinobacillus ureae ATCC 25976]
          Length = 309

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 159/294 (54%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   RI TR SPLAL  A   +  L    + P   + ++ + TKGD I +  L +IGGKG
Sbjct: 2   KDILRIATRQSPLALWQANFVKKELE--KRFPELQVELVTMVTKGDIILDTPLAKIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+  Q+L +L 
Sbjct: 60  LFVKELELALLEKRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNKYQNLDELP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  L+     + V   RG + TRL+KL+N +  AI+LA AG+ RL   
Sbjct: 120 AGAVVGTSSLRRQCQLMAKYPHLEVKSLRGNVGTRLSKLDNGEYEAIILASAGLIRLGMP 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  + +E   P+ GQGA+ IET VN+ +    +  +NH  T   V  ERA    L G
Sbjct: 180 ERIRSFIAVEQSLPAAGQGAVGIETRVNDERVLNYLASLNHNPTACCVMAERAMNTRLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  I GFA   G+ +    +V A DG      S   +  DA  +G   A+ +
Sbjct: 240 GCQVPIGGFATLNGNEITLNALVGALDGSTIIRASGVADIEDAEQLGISVAEQL 293


>gi|194017264|ref|ZP_03055876.1| porphobilinogen deaminase [Bacillus pumilus ATCC 7061]
 gi|194011132|gb|EDW20702.1| porphobilinogen deaminase [Bacillus pumilus ATCC 7061]
          Length = 311

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 172/286 (60%), Gaps = 4/286 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  ++G+R S LA+         L +++  P ++  I  + TKGD+I + TL+++GGKGL
Sbjct: 2   RTIKVGSRRSKLAITQTKWVIQKLSELN--PSYSFEIKEIVTKGDQILDVTLSKVGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +EIE+ +++ +ID AVHS KDMP  L +GL I     RED+RD  IS     L +L  
Sbjct: 60  FVKEIEQAMLNHDIDMAVHSMKDMPAALPEGLVIGCIPEREDVRDALISKDHLRLHELPK 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +++GTSSLRR A LL+ R D+++   RG I+TRL KL N +  AI+LA AG+ R+   K
Sbjct: 120 GAIVGTSSLRRSAQLLQERPDLNIKWIRGNIDTRLEKLKNEEYDAIILAAAGLSRMGWSK 179

Query: 184 -VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V+ E L+ E   P+ GQGA+ IE   ++ +  +L+    +E T  +V  ERAFL ++DG
Sbjct: 180 EVVSEFLSPETCLPAVGQGALSIECRGDDEELLQLLAQFTNEYTKKTVLAERAFLKQMDG 239

Query: 243 SCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAIN 287
           SC+  IAG+A   +   +   G+V ++DG      + +G+  +AI 
Sbjct: 240 SCQVPIAGYATINERDEIELTGLVASADGHTIIRETVSGSDPEAIG 285


>gi|210621716|ref|ZP_03292765.1| hypothetical protein CLOHIR_00710 [Clostridium hiranonis DSM 13275]
 gi|210154598|gb|EEA85604.1| hypothetical protein CLOHIR_00710 [Clostridium hiranonis DSM 13275]
          Length = 299

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/292 (36%), Positives = 164/292 (56%), Gaps = 3/292 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            R+GTR S LAL         L +  K P     +  + TKGD+I + +L +IG KGLF 
Sbjct: 3   IRVGTRGSNLALIQTNWAIDRLKE--KFPEVEFEVKIIKTKGDKILHLSLDKIGDKGLFV 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLALH 124
           +EIE +L+ GEID AVHS KDMP ++++GL+ +A   RED RDV I      S  +L + 
Sbjct: 61  KEIESQLLEGEIDLAVHSMKDMPAEVVEGLKFAAVPKREDPRDVIILREGLNSFDELPIG 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
           + IGT S RRK  LLR R D++++  RG IETR++K+ +     I+LA +G+ R   E+ 
Sbjct: 121 ATIGTGSKRRKYQLLRKRPDLNIVPIRGNIETRISKIESENLDGIVLAASGVIRADLEEK 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSC 244
           I E L ++   P+P QGA+ +E   N+ + ++++  I  E +    + ER++LA +DGSC
Sbjct: 181 ITEFLPVDLMIPAPAQGALALEIRENDEELEKMIDAIKDEISQIQTDAERSYLAGIDGSC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
              +  +    G  L   GI    DG+     S  G+R +   +G + A+ +
Sbjct: 241 HIPMGAYCEVDGEKLTLTGIFGDEDGEKITVASLEGDRDNPKELGSNLAKLV 292


>gi|34101365|gb|AAQ57734.1| porphobilinogen deaminase [Chromobacterium violaceum ATCC 12472]
          Length = 295

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/263 (39%), Positives = 152/263 (57%), Gaps = 1/263 (0%)

Query: 35  PH-NIVIIPLSTKGDRITNRTLTEIGGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLK 93
           PH  + I+ ++T+GD+I ++TL++IGGKGLF +E+E+ L+ G  D AVHS KD+P  L  
Sbjct: 16  PHLTVEILGMTTQGDQILDKTLSKIGGKGLFVKELEQALMDGRADLAVHSLKDVPMTLPD 75

Query: 94  GLQISAYLPREDIRDVFISHTAQSLKDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGK 153
           G  ++A   RED RD F+S+  Q L +L   SV+GTSSLRR+A L      ++V   RG 
Sbjct: 76  GFALAAVCEREDPRDAFVSNRYQHLSELPAGSVVGTSSLRREAQLRARFPQLAVKPLRGN 135

Query: 154 IETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPK 213
           ++TRL KL++ +  AI+LA AG+KRL   + I+  L   +  P+ GQGA+ IE   +   
Sbjct: 136 VQTRLKKLDDGEFDAIILAAAGLKRLGLAERIQGELAPSESLPAAGQGALGIEIRADRAD 195

Query: 214 AQELVKVINHEDTWDSVNCERAFLAELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIF 273
              L+  +NH DT      ERA   EL GSC+  +  FA     TL   G+V   DG + 
Sbjct: 196 LSALLAPLNHPDTRACTAAERALAKELGGSCQVPLGAFATLADGTLTLGGLVAHPDGSVV 255

Query: 274 HEVSRNGNRCDAINIGRDAAQYI 296
              S +G    A  +GR  A+ +
Sbjct: 256 LTASASGPADYADALGRAVAKKL 278


>gi|16079867|ref|NP_390693.1| porphobilinogen deaminase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|238054381|sp|P16616|HEM3_BACSU RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|143037|gb|AAA22512.1| porphobilinogen deaminase [Bacillus subtilis]
 gi|2635280|emb|CAB14775.1| porphobilinogen deaminase (hydroxymethylbilane synthase) [Bacillus
           subtilis subsp. subtilis str. 168]
          Length = 314

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 166/302 (54%), Gaps = 11/302 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  ++G+R S LA+         L +++  P     I  + TKGDRI + TL+++GGKGL
Sbjct: 3   RTIKVGSRRSKLAMTQTKWVIQKLKEIN--PSFAFEIKEIVTKGDRIVDVTLSKVGGKGL 60

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +EIE+ L++ EID AVHS KDMP  L +GL I     RED RD  IS     L ++  
Sbjct: 61  FVKEIEQALLNEEIDMAVHSMKDMPAVLPEGLVIGCIPEREDPRDALISKNRVKLSEMKK 120

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KE 182
            +VIGTSSLRR A LL  R D+++   RG I+TRL KL      AI+LA AG+ R+  K+
Sbjct: 121 GAVIGTSSLRRSAQLLIERPDLTIKWIRGNIDTRLQKLETEDYDAIILAAAGLSRMGWKQ 180

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V+ E L  E   P+ GQGA+ IE   ++ +   L      E T  +V  ERAFL  ++G
Sbjct: 181 DVVTEFLEPERCLPAVGQGALAIECRESDEELLALFSQFTDEYTKRTVLAERAFLNAMEG 240

Query: 243 SCKSAIAGFAYCKGS-TLYFYGIVLASDGKIFHEVSRNGN-------RCDAINIGRDAAQ 294
            C+  IAG++   G   +   G+V + DGKI  + +  GN       RC A+   + A  
Sbjct: 241 GCQVPIAGYSVLNGQDEIEMTGLVASPDGKIIFKETVTGNDPEEVGKRCAALMADKGAKD 300

Query: 295 YI 296
            I
Sbjct: 301 LI 302


>gi|71738146|ref|YP_272379.1| porphobilinogen deaminase [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71558699|gb|AAZ37910.1| porphobilinogen deaminase [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 328

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/296 (36%), Positives = 164/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 16  MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 73

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 74  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 133

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 134 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 193

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 194 FENRITSAISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 253

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G   A+ +
Sbjct: 254 NGGCQVPIACYAVLEGDDVWLRGLVGDPAGSVLLHAEARAPQTSAQALGVQVAEAL 309


>gi|157693217|ref|YP_001487679.1| porphobilinogen deaminase [Bacillus pumilus SAFR-032]
 gi|167008811|sp|A8FFV2|HEM3_BACP2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|157681975|gb|ABV63119.1| hydroxymethylbilane synthase [Bacillus pumilus SAFR-032]
          Length = 311

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 171/286 (59%), Gaps = 4/286 (1%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  ++G+R S LA+         L +++  P ++  I  + TKGD+I + TL+++GGKGL
Sbjct: 2   RTIKVGSRRSKLAITQTKWVIQKLSELN--PSYSFEIKEIVTKGDQILDVTLSKVGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +EIE+ +++ +ID AVHS KDMP  L +GL I     RED+RD  IS     L +L  
Sbjct: 60  FVKEIEQAMLNHDIDMAVHSMKDMPAALPEGLVIGCIPEREDVRDALISKDHLHLHELPK 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +++GTSSLRR A LL+ R D+++   RG I+TRL KL N +  AI+LA AG+ R+   K
Sbjct: 120 GAIVGTSSLRRSAQLLQERPDLNIKWIRGNIDTRLEKLKNEEYDAIILAAAGLSRMGWSK 179

Query: 184 -VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V+ E L+ E   P+ GQGA+ IE   ++ +  +L+    +E T  +V  ERAFL ++DG
Sbjct: 180 EVVSEFLSPETCLPAVGQGALSIECRGDDEELLQLLAQFTNEYTKKTVLAERAFLKQMDG 239

Query: 243 SCKSAIAGFAYC-KGSTLYFYGIVLASDGKIFHEVSRNGNRCDAIN 287
           SC+  IAG+A   +   +   G+V ++DG      + +G   +AI 
Sbjct: 240 SCQVPIAGYATMNERDEIELTGLVASADGHTIIRETVSGTDPEAIG 285


>gi|330957337|gb|EGH57597.1| porphobilinogen deaminase [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 313

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/296 (36%), Positives = 164/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLIVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P     GL +     RED RD F+S+T  SL+ 
Sbjct: 59  KGLFVKELETALLENNADIAVHSMKDVPMDFPPGLGLFCICEREDPRDAFVSNTFDSLET 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSVVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HEDT   V  ER+    L
Sbjct: 179 FEDRITSSISVDDSLPAGGQGAVGIECRSVDAEIHALLAPLHHEDTAVRVIAERSLNKHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +G C+  IA +A  +G  ++  G+V    G +         +  A  +G + A+ +
Sbjct: 239 NGGCQVPIACYAVLEGDNVWLRGLVGDPSGSLLLHAEARAPQTAAQALGVEVAEAL 294


>gi|325294749|ref|YP_004281263.1| Porphobilinogen deaminase [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325065197|gb|ADY73204.1| Porphobilinogen deaminase [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 311

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 175/305 (57%), Gaps = 6/305 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  +   +  +    K P   + +I ++TKGD+I +  L +IG KGLFT
Sbjct: 3   IRIGTRKSKLALWQSEWVKEQIE--KKFPEVEVELIKITTKGDKILDVPLAKIGDKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  ++ GE+D AVHS KD+P+KL +GL++ A+  RED RD  +S    +L  L   +
Sbjct: 61  KEIEDAMLKGEVDIAVHSLKDVPSKLPEGLKLIAFSDREDPRDALLSCGKYTLDTLPEGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRRKA L   R D+ + D RG ++TR+ KL   +  AI+LA AG+KRL  E  I
Sbjct: 121 VVGTSSLRRKAQLRILRPDLEIRDLRGNVDTRIRKLKEEQYDAIILAAAGVKRLGWENEI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVK-VINHEDTWDSVNCERAFLAELDGSC 244
            EIL+ +   PS  QG + IE   ++P+ + +VK  IN  ++  +   ERAFL  ++G C
Sbjct: 181 DEILSSDKMIPSVSQGILGIEGREDDPEIERIVKEAINSRESEIAATVERAFLRTVEGGC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHE---VSRNGNRCDAINIGRDAAQYIRFISN 301
           +  +  +A    + ++    +   +G+ +++   V +  N  +A  +G   A+ +     
Sbjct: 241 QVPLGCYAVVVENRVHVRAFISDLNGRFYYKEEGVFKVENLEEADMVGTGVAERLLSAGG 300

Query: 302 KNVFN 306
           K + +
Sbjct: 301 KKILD 305


>gi|71909286|ref|YP_286873.1| porphobilinogen deaminase [Dechloromonas aromatica RCB]
 gi|123733070|sp|Q479S8|HEM3_DECAR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|71848907|gb|AAZ48403.1| Porphobilinogen deaminase [Dechloromonas aromatica RCB]
          Length = 311

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/290 (37%), Positives = 159/290 (54%), Gaps = 2/290 (0%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           I +R S LA+  A   R  L  ++  P   +VI+ ++TKGD+I +R L EIGGKGLF +E
Sbjct: 9   IASRESRLAMWQAVHVRDRLSSLN--PGAEVVILGMTTKGDQILDRPLAEIGGKGLFIKE 66

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           +E  +  G+   AVHS KD+P  + +G  ++A   RE+ RD F+S+    L DL   +++
Sbjct: 67  LEVAMQEGKAHLAVHSMKDVPMVMPEGFVLAAISARENPRDAFVSNKYNGLDDLPAGAIV 126

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSSLRR+++L      + +   RG ++TRL KL+  +  AI+LA AG+ RL  E  IK 
Sbjct: 127 GTSSLRRESILRAKYPQLVIKSLRGNLDTRLKKLDAGEYDAIILAAAGLIRLGMENRIKS 186

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
           +L  E   P+PGQGA+ IE         ++V  +N  +T   V  ERAF   L GSC+  
Sbjct: 187 VLTAEQSLPAPGQGALGIELIDGAADMADVVAPLNDPETAHCVKAERAFSRALGGSCQVP 246

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           + G+A      L+  G V  +DG+        GN  D   +G   A  +R
Sbjct: 247 LGGYAIIDNGQLWLRGFVATADGQEVVSAELRGNPADDEALGLQLAAELR 296


>gi|152997593|ref|YP_001342428.1| porphobilinogen deaminase [Marinomonas sp. MWYL1]
 gi|150838517|gb|ABR72493.1| porphobilinogen deaminase [Marinomonas sp. MWYL1]
          Length = 326

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/287 (37%), Positives = 165/287 (57%), Gaps = 2/287 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K    I TR S LAL  A   ++ L  ++  P   + ++ ++TKGD+I +  L++IGGKG
Sbjct: 19  KDKIVIATRESQLALWQANNIKAQLESLY--PDMKVELLGMTTKGDQILDSPLSKIGGKG 76

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L  G  D AVHS KD+P    +GL ++    RED  D F+S+  +SL  L 
Sbjct: 77  LFVKELENALTEGLADIAVHSMKDVPMAFPEGLGLAVICEREDPHDAFVSNKVESLDQLP 136

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +++GTSSLRR   L   R D+ + D RG + TRL K+++ +  AI+LA AG+ RL+  
Sbjct: 137 SGAIVGTSSLRRSCQLRMKRPDLIIKDLRGNVNTRLKKMDDGEYDAIILATAGLVRLEML 196

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
             I++ +  E   P+ GQGA+ IE   ++ +   L+  + HE+T   V  ERA    L+G
Sbjct: 197 DRIRQRIPAETSLPAGGQGAMGIECRSDDIQTINLLAPLQHEETAIRVTAERAVNERLNG 256

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
            C++ IA FA  +  TL+  G+V + DGK   E    G++ DA ++G
Sbjct: 257 GCQAPIACFAILENDTLWLRGLVGSPDGKTMIEGEIRGHKDDAKSLG 303


>gi|221310755|ref|ZP_03592602.1| porphobilinogen deaminase [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221315080|ref|ZP_03596885.1| porphobilinogen deaminase [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221319999|ref|ZP_03601293.1| porphobilinogen deaminase [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221324281|ref|ZP_03605575.1| porphobilinogen deaminase [Bacillus subtilis subsp. subtilis str.
           SMY]
          Length = 313

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 118/302 (39%), Positives = 166/302 (54%), Gaps = 11/302 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  ++G+R S LA+         L +++  P     I  + TKGDRI + TL+++GGKGL
Sbjct: 2   RTIKVGSRRSKLAMTQTKWVIQKLKEIN--PSFAFEIKEIVTKGDRIVDVTLSKVGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +EIE+ L++ EID AVHS KDMP  L +GL I     RED RD  IS     L ++  
Sbjct: 60  FVKEIEQALLNEEIDMAVHSMKDMPAVLPEGLVIGCIPEREDPRDALISKNRVKLSEMKK 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KE 182
            +VIGTSSLRR A LL  R D+++   RG I+TRL KL      AI+LA AG+ R+  K+
Sbjct: 120 GAVIGTSSLRRSAQLLIERPDLTIKWIRGNIDTRLQKLETEDYDAIILAAAGLSRMGWKQ 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V+ E L  E   P+ GQGA+ IE   ++ +   L      E T  +V  ERAFL  ++G
Sbjct: 180 DVVTEFLEPERCLPAVGQGALAIECRESDEELLALFSQFTDEYTKRTVLAERAFLNAMEG 239

Query: 243 SCKSAIAGFAYCKGS-TLYFYGIVLASDGKIFHEVSRNGN-------RCDAINIGRDAAQ 294
            C+  IAG++   G   +   G+V + DGKI  + +  GN       RC A+   + A  
Sbjct: 240 GCQVPIAGYSVLNGQDEIEMTGLVASPDGKIIFKETVTGNDPEEVGKRCAALMADKGAKD 299

Query: 295 YI 296
            I
Sbjct: 300 LI 301


>gi|167463591|ref|ZP_02328680.1| porphobilinogen deaminase [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322383221|ref|ZP_08057032.1| porphobilinogen deaminase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321152490|gb|EFX45276.1| porphobilinogen deaminase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 314

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 165/288 (57%), Gaps = 7/288 (2%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIV--IIPLSTKGDRITNRTLTEIGGKGLFT 65
           +GTR S LAL    +    L    +     +   I  + TKGDRI + TL+++GGKGLF 
Sbjct: 6   VGTRQSALALTQTGQVVDELRKRCREAGLQVEFEIRKIVTKGDRILDVTLSKVGGKGLFV 65

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ +++GEID AVHS KDMP +L +GL I A   R+D RD  ++    SL +L   +
Sbjct: 66  KEIEQAMLNGEIDLAVHSMKDMPFELPEGLVIGAIPERQDPRDCILTKGYVSLDELPQGA 125

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           ++GTSSLRR + LL  R D+++   RG I++RL KL +    AI+LA AG+ R+  E+ I
Sbjct: 126 LVGTSSLRRGSQLLHARPDLTIRSVRGNIDSRLRKLESEGFDAIVLASAGLHRMGWEERI 185

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
              L  E   P+ GQGA+CIE    +    +L+K+I H+DT  +V  ERAFL  L+G C+
Sbjct: 186 SGYLPPEQCLPAVGQGALCIECRGGDAFVLDLLKLIQHDDTALAVRAERAFLGRLNGGCQ 245

Query: 246 SAIAGFAYC--KGST---LYFYGIVLASDGKIFHEVSRNGNRCDAINI 288
             +  FA     G T   L    +V + DG    + +R G R + + +
Sbjct: 246 VPLGAFASVDHSGGTEPLLTLTAMVGSPDGSKLLKETRQGTRPEELGL 293


>gi|145300736|ref|YP_001143577.1| porphobilinogen deaminase [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142853508|gb|ABO91829.1| porphobilinogen deaminase [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 315

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 166/297 (55%), Gaps = 4/297 (1%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  +I TR SPLAL  A   +  L  ++  P   + ++P+ST+GD+I +  L ++GG
Sbjct: 7   MAARTLKIATRKSPLALWQANFVKDRLEALY--PELQVELVPMSTQGDKILDTPLAKVGG 64

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+    ++ 
Sbjct: 65  KGLFVKELETAMLEGRADIAVHSMKDVPVEFPEGLGLHTICEREDPRDAFVSNRFSQIEA 124

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +V+GTSSLRR+  L   R D+ + D RG + TRL KL+  +  AI+LA AG+KRL+
Sbjct: 125 LPQGAVVGTSSLRRQCQLRAARPDLVIRDLRGNVNTRLAKLDAGEYDAIILAAAGLKRLE 184

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
               I   +  E   P+ GQGA+ IE  +++ +   L+  + H +T   V  ERA    L
Sbjct: 185 MAHRITAFIEPEQSLPANGQGAVGIECRLDDHELHTLLAPLEHAETRIRVLTERAMNRAL 244

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG-KIFHEVSRNGNRCDAINIGRDAAQYI 296
            G C+  I  +A  +G  ++  G+V + DG ++ H+  R G   D   +G   AQ +
Sbjct: 245 QGGCQVPIGAYALVQGDEVWLRGLVGSPDGSQVIHDEIR-GPLADGEALGHTLAQRL 300


>gi|219871198|ref|YP_002475573.1| porphobilinogen deaminase [Haemophilus parasuis SH0165]
 gi|219691402|gb|ACL32625.1| porphobilinogen deaminase [Haemophilus parasuis SH0165]
          Length = 309

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 164/294 (55%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+  RI TR SPLAL  A   + +L    + P  ++ ++ + TKGD I +  L +IGGKG
Sbjct: 2   KEILRIATRQSPLALWQANFVKDALE--QRFPQLSVELVTMVTKGDIILDTPLAKIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+   +L+ L 
Sbjct: 60  LFVKELELALLENRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNHYANLEALP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  L+     + +   RG + TRL+KL+N +  AI+LA AG+ RL   
Sbjct: 120 AGAVVGTSSLRRQCQLMAKYPHLQIKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGLS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  + +E   P+ GQGA+ IET +N+ +    +  +NH+ T   V  ERA  + L G
Sbjct: 180 ERIRTFIPVETSLPACGQGAVGIETRLNDERVLAYLAELNHQPTAYCVQAERAMNSRLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  I GFA   G  +    +V + DG      S  GN  +A  +G + A+ +
Sbjct: 240 GCQVPIGGFATLTGDEIELNALVGSLDGSTIVRASAKGNIKEAEKLGVEVAEAL 293


>gi|308174513|ref|YP_003921218.1| porphobilinogen deaminase [Bacillus amyloliquefaciens DSM 7]
 gi|307607377|emb|CBI43748.1| porphobilinogen deaminase (hydroxymethylbilane synthase) [Bacillus
           amyloliquefaciens DSM 7]
 gi|328554432|gb|AEB24924.1| porphobilinogen deaminase [Bacillus amyloliquefaciens TA208]
 gi|328912836|gb|AEB64432.1| porphobilinogen deaminase (hydroxymethylbilane synthase) [Bacillus
           amyloliquefaciens LL3]
          Length = 313

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 163/292 (55%), Gaps = 11/292 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  ++G+R S LA+       + L +++  P +N  I  + TKGDRI + TL+++GGKGL
Sbjct: 2   RTIKVGSRRSKLAMTQTKWVINKLKELN--PSYNFEIQEIVTKGDRILDVTLSKVGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +EIE+ L+  EID AVHS KDMP  L +GL I     RED RD  IS   Q L D+  
Sbjct: 60  FVKEIEQALLHQEIDMAVHSMKDMPAVLPEGLVIGCIPKREDPRDALISKGHQKLDDIKE 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KE 182
             +IGTSSLRR A +L  R D+++   RG I+TRL KL      AI+LA AG+ R+  K+
Sbjct: 120 GGIIGTSSLRRSAQILAERPDLTIKWIRGNIDTRLQKLETEDYDAIILAAAGLSRMGWKD 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V+ E L  +   P+ GQGA+ IE   ++ +  +L      E T  +V  ERAFL  ++G
Sbjct: 180 DVVSEFLEPDRCLPAVGQGALAIECRESDEELLKLFAQFTDEYTKRTVAAERAFLHAMEG 239

Query: 243 SCKSAIAGFAYCKG-STLYFYGIVLASDGKIF-------HEVSRNGNRCDAI 286
            C+  IAG+A       +   G+V + DGK         H+    G RC A+
Sbjct: 240 GCQVPIAGYASVNDRDEVELVGLVASPDGKTIYKETAAGHDPEEIGKRCAAM 291


>gi|167767183|ref|ZP_02439236.1| hypothetical protein CLOSS21_01702 [Clostridium sp. SS2/1]
 gi|167711158|gb|EDS21737.1| hypothetical protein CLOSS21_01702 [Clostridium sp. SS2/1]
 gi|291559492|emb|CBL38292.1| porphobilinogen deaminase [butyrate-producing bacterium SSC/2]
          Length = 780

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 106/265 (40%), Positives = 147/265 (55%), Gaps = 2/265 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
           + IG+R S LAL      +  L   +  P H   I  + TKGD+I N+ L +IGGKGLF 
Sbjct: 3   YIIGSRGSRLALIQTKYVQEKLAKAY--PEHTFEIQIIKTKGDKIQNKPLDKIGGKGLFV 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+K+ISGEI   VHS KDMP+   KGL  +    RED RDV I  TA+ L +L   +
Sbjct: 61  KEIEEKIISGEIHMGVHSMKDMPSTPAKGLVFTKVWKREDPRDVLILRTAKHLSELREGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           VI T S RR   LL+ R D+ +I+ RG ++TRL K+   +   I+LA AG+KRL  E VI
Sbjct: 121 VIATGSKRRAFQLLKLRPDLQIINIRGNVDTRLRKMEEQQLDGIVLAAAGLKRLGMEDVI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L  ED   +P QGA+ +E   +  + Q+++ V   E+T + V  ER FL ++ GSC 
Sbjct: 181 TQYLAPEDMISAPAQGALALEVREDQKELQKMLDVFCDEETMNEVCAERNFLEQMGGSCH 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDG 270
           +               Y +    DG
Sbjct: 241 TPAGARCQKTDQGYELYAMFGNEDG 265


>gi|146305321|ref|YP_001185786.1| porphobilinogen deaminase [Pseudomonas mendocina ymp]
 gi|145573522|gb|ABP83054.1| hydroxymethylbilane synthase [Pseudomonas mendocina ymp]
          Length = 312

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 161/293 (54%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGGKGL
Sbjct: 3   REIRIATRKSALALWQAEYVKARLEQAH--PGLLVSLVPMVSRGDKLLDAPLAKIGGKGL 60

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL  L  
Sbjct: 61  FVKELETALLENEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTYDSLDALPA 120

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL  + 
Sbjct: 121 GSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFQD 180

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  ++ ED  P+ GQGA+ IE    + +   L+  ++H +T   V  ERA    L+G 
Sbjct: 181 RIRSSISAEDSLPAGGQGAVGIECRSADAEIHALLAPLHHRETALRVTAERALNKRLNGG 240

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IA +A  +   L+  G+V   DG +           DA  +G   A+ +
Sbjct: 241 CQVPIACYALLENDQLWLRGLVGQPDGGLLLRAEHRAASSDAEALGVRVAEAL 293


>gi|167855158|ref|ZP_02477929.1| porphobilinogen deaminase [Haemophilus parasuis 29755]
 gi|167853703|gb|EDS24946.1| porphobilinogen deaminase [Haemophilus parasuis 29755]
          Length = 309

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 164/294 (55%), Gaps = 2/294 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+  RI TR SPLAL  A   + +L    + P  ++ ++ + TKGD I +  L +IGGKG
Sbjct: 2   KEILRIATRQSPLALWQANFVKDALE--QRFPQLSVELVTMVTKGDIILDTPLAKIGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L+    D AVHS KD+P    +GL ++    RED RD F+S+   +L+ L 
Sbjct: 60  LFVKELELALLKNRADIAVHSMKDVPMTFPEGLGLAVICEREDPRDAFVSNHYANLEALP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +V+GTSSLRR+  L+     + +   RG + TRL+KL+N +  AI+LA AG+ RL   
Sbjct: 120 AGAVVGTSSLRRQCQLMAKYPHLQIKSLRGNVGTRLSKLDNGEYDAIILASAGLIRLGLS 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I+  + +E   P+ GQGA+ IET +N+ +    +  +NH+ T   V  ERA  + L G
Sbjct: 180 ERIRTFIPVETSLPACGQGAVGIETRLNDERVLAYLAELNHQPTAYCVQAERAMNSRLQG 239

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            C+  I GFA   G  +    +V + DG      S  GN  +A  +G + A+ +
Sbjct: 240 GCQVPIGGFATLTGDEIELNALVGSLDGSTIVRASAKGNIKEAEKLGVEVAEAL 293


>gi|89074445|ref|ZP_01160922.1| porphobilinogen deaminase [Photobacterium sp. SKA34]
 gi|89049733|gb|EAR55283.1| porphobilinogen deaminase [Photobacterium sp. SKA34]
          Length = 310

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/270 (37%), Positives = 157/270 (58%), Gaps = 2/270 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR SPLA+  A   ++ +   H  P  ++ ++P+ TKGD I +  L ++GG
Sbjct: 1   MSNQLIRIATRKSPLAMWQAEFVKAEIEQAH--PGISVELVPMITKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  ++ G  D AVHS KD+P +  +GL +     RED RD F+S+   ++ +
Sbjct: 59  KGLFVKELEVAMLEGRADIAVHSMKDVPVEFPEGLGLVTICEREDPRDAFVSNKYNNIDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   +++GTSSLRR+  L   R D+ V D RG + TRL K++  +  AI+LA AG+KRLK
Sbjct: 119 LPQGAIVGTSSLRRQCQLRAQRPDLIVNDLRGNVNTRLRKMDEGQYDAIILACAGLKRLK 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I+  +  E   P+ GQGA+ IE  +++ + ++L+  ++ + T   V CERA    L
Sbjct: 179 MEDRIRSEIAPEVSLPAVGQGAVGIECRLDDTRVRQLLTALSDQATTTRVLCERAMNNHL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            G C+  I  +A  +G  ++   +V   DG
Sbjct: 239 QGGCQVPIGSYAELEGDQVWLRALVGEPDG 268


>gi|311069308|ref|YP_003974231.1| porphobilinogen deaminase [Bacillus atrophaeus 1942]
 gi|310869825|gb|ADP33300.1| porphobilinogen deaminase [Bacillus atrophaeus 1942]
          Length = 313

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/302 (40%), Positives = 168/302 (55%), Gaps = 11/302 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  ++G+R S LA+         L ++   P +   I  + TKGDRI + TL+++GGKGL
Sbjct: 2   RTIKVGSRRSKLAMTQTKWVIKKLEEID--PSYTFEIKEIVTKGDRILDVTLSKVGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +EIE+ L++ +ID AVHS KDMP  L +GL I     RED RD  IS   Q L D+  
Sbjct: 60  FVKEIEQALLNEDIDMAVHSMKDMPASLPEGLTIGCIPKREDPRDALISKRHQKLSDIKE 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK-KE 182
             VIGTSSLRR A LL  R D+++   RG I+TRL+KL      AI+LA AG+ R+  K+
Sbjct: 120 GGVIGTSSLRRSAQLLVERPDLTIKWIRGNIDTRLHKLETEDYDAIILAAAGLSRMGWKD 179

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
            V+ E L  E   P+ GQGA+ IE   ++ +   L      E T  +V  ERAFL  ++G
Sbjct: 180 DVVTEFLEPERCLPAVGQGALAIECRESDEELLRLFSQFTDEYTKRTVLAERAFLNAMEG 239

Query: 243 SCKSAIAGFAYCKGS-TLYFYGIVLASDGK-IFHE-VSRN-----GNRCDAINIGRDAAQ 294
            C+  IAG+A       +   G+V + DGK IF E V+ N     G RC A+   + A  
Sbjct: 240 GCQVPIAGYATINDQDEVQLTGLVASPDGKTIFKEKVAGNDPEEIGKRCAALMSDKGAKA 299

Query: 295 YI 296
            I
Sbjct: 300 LI 301


>gi|42520403|ref|NP_966318.1| porphobilinogen deaminase [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410142|gb|AAS14252.1| porphobilinogen deaminase [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 292

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 161/291 (55%), Gaps = 6/291 (2%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +IGTR S LA+A A E +  L+D    P  +I I+ + T GD+  N  L EIGGKGLF +
Sbjct: 4   KIGTRGSKLAVAQALEAKQKLLD--SFPNLSIEIVKIKTSGDKYANANLAEIGGKGLFIK 61

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE +L+   ID AVHS KDMP     GL I   L R    D FISH   SL+ L   + 
Sbjct: 62  EIETELLENNIDMAVHSLKDMPAFFSGGLTIPCVLERLSSCDAFISHKHNSLESLPQQAT 121

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           I TSS+RRK  LL  R D++++  RG + TR   L N     I+LA AG+ RL+K  +I 
Sbjct: 122 IATSSIRRKVQLLNVRPDLNIVPLRGNVTTR---LQNQSFDGIILAEAGLIRLEKHHLIT 178

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E+L  +    + GQGA+CI+   N+ K  +L++ IN+  ++  V  ER+F+  ++GSC +
Sbjct: 179 EVLPPKVMLSAVGQGAVCIQCRRNDVKIIDLLEKINNNMSFIGVKSERSFMKTVNGSCFT 238

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            +A  A      +     +LAS GK  +   R     DA  +G DA   ++
Sbjct: 239 PLAALAEYVSENMLHLRCMLAS-GKNIYFTERTSFIEDAEKMGMDAGLELK 288


>gi|99034622|ref|ZP_01314577.1| hypothetical protein Wendoof_01000608 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 302

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 114/291 (39%), Positives = 161/291 (55%), Gaps = 6/291 (2%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +IGTR S LA+A A E +  L+D    P  +I I+ + T GD+  N  L EIGGKGLF +
Sbjct: 14  KIGTRGSKLAVAQALEAKQKLLD--SFPNLSIEIVKIKTSGDKYANANLAEIGGKGLFIK 71

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE +L+   ID AVHS KDMP     GL I   L R    D FISH   SL+ L   + 
Sbjct: 72  EIETELLENNIDMAVHSLKDMPAFFSGGLTIPCVLERLSSCDAFISHKHNSLESLPQQAT 131

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           I TSS+RRK  LL  R D++++  RG + TR   L N     I+LA AG+ RL+K  +I 
Sbjct: 132 IATSSIRRKVQLLNVRPDLNIVPLRGNVTTR---LQNQSFDGIILAEAGLIRLEKHHLIT 188

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E+L  +    + GQGA+CI+   N+ K  +L++ IN+  ++  V  ER+F+  ++GSC +
Sbjct: 189 EVLPPKVMLSAVGQGAVCIQCRRNDVKIIDLLEKINNNMSFIGVKSERSFMKTVNGSCFT 248

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            +A  A      +     +LAS GK  +   R     DA  +G DA   ++
Sbjct: 249 PLAALAEYVSENMLHLRCMLAS-GKNIYFTERTSFIEDAEKMGMDAGLELK 298


>gi|327473567|gb|EGF18987.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK408]
          Length = 306

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 167/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKKLH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA-QSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I   A Q+L DL 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFRQAGQTLADLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+ R   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLAFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLNRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + ++L+  +  E T   V  ER  LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRQLLATVQDEKTAAEVAVERVVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA FA   G       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAAFAQKNGQDYQLEAMLAKEDGQCVF-VSLKGQDGQQL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|330501254|ref|YP_004378123.1| porphobilinogen deaminase [Pseudomonas mendocina NK-01]
 gi|328915540|gb|AEB56371.1| porphobilinogen deaminase [Pseudomonas mendocina NK-01]
          Length = 312

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 159/293 (54%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGGKGL
Sbjct: 3   REIRIATRKSALALWQAEYVKARLEQAH--PGLKVSLVPMVSRGDKLLDAPLAKIGGKGL 60

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+  E D AVHS KD+P    +GL +     RED RD F+S+T  SL  L  
Sbjct: 61  FVKELETALLENEADIAVHSMKDVPMDFPEGLGLYCICEREDPRDAFVSNTYDSLDALPA 120

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL    
Sbjct: 121 GSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFAD 180

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  ++ ED  P+ GQGA+ IE    +     L+  ++H +T   V  ERA    L+G 
Sbjct: 181 RIRSSISAEDSLPAGGQGAVGIECRSADSDVHALLAPLHHRETALRVTAERALNKHLNGG 240

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IA +A  +   L+  G+V   DG +           DA  +G   A+ +
Sbjct: 241 CQVPIACYALLEDDQLWLRGLVGQPDGGLLLRAEERAASGDAEALGVRVAEAL 293


>gi|12655813|gb|AAK00605.1|AF221100_2 porphobilinogen deaminase [Selenomonas ruminantium subsp.
           ruminantium]
          Length = 313

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/307 (36%), Positives = 171/307 (55%), Gaps = 3/307 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M+K    IGTR S LAL  A   +  L + +  P   + +  ++TKGD+I +  L +IGG
Sbjct: 1   MKKDTIVIGTRSSKLALWQAEYVKGRLEEEY--PGLKVELKLMTTKGDKILDAPLAKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLFT+E+E  ++SG ID AVHS KDMPT+L +GL ++A   R D  D  +S   ++   
Sbjct: 59  KGLFTKELEMDMLSGGIDLAVHSLKDMPTELPEGLTLAAITKRFDPGDAVVSPKFKTFAA 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   + +GTSSLRRKA LL  R D+++ D RG + TRL KL +    AI+LA AG+KRL 
Sbjct: 119 LPCGAKVGTSSLRRKAQLLHARPDLNICDLRGNVNTRLAKLESENFDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I E+L  +   P+ GQGA+ IET  ++   +E++  +N E T      ERAFL  +
Sbjct: 179 FGERITEVLPRDMVLPAVGQGALAIETREDDADMREMLAFLNDEATVHCAKAERAFLGRV 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLAS-DGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           +G C+  +  +A    +       V+AS DG+  +    +G   +A  +G   A+ +   
Sbjct: 239 EGGCQVPVGVYAVPAANDEIQVEAVIASLDGQRLYRDKLSGKASEAEKLGVTLAEKLLAA 298

Query: 300 SNKNVFN 306
             + +  
Sbjct: 299 GGQKILQ 305


>gi|52424331|ref|YP_087468.1| porphobilinogen deaminase [Mannheimia succiniciproducens MBEL55E]
 gi|61213369|sp|Q65VX7|HEM3_MANSM RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|52306383|gb|AAU36883.1| HemC protein [Mannheimia succiniciproducens MBEL55E]
          Length = 310

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 154/268 (57%), Gaps = 2/268 (0%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K   +I TR SPLAL  A   +  L  ++  P   + ++ + TKGD I +  L +IGGKG
Sbjct: 4   KNHLKIATRQSPLALWQANYVKDRLTALY--PDLQVELVTMVTKGDVILDTPLAKIGGKG 61

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF +E+E  L++ E D AVHS KD+P +  +GL +S    RED RD F+S+  +SL +L 
Sbjct: 62  LFVKELEHALLNHEADIAVHSMKDVPMEFPQGLGLSVICKREDPRDAFVSNKYRSLAELP 121

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +++GTSSLRR+  L   R D+ +   RG + TRL+KL+N    AI+LA AG+ RL   
Sbjct: 122 QGAIVGTSSLRRQCQLKSLRPDLDIRSLRGNVGTRLSKLDNGDYDAIILASAGLIRLGMA 181

Query: 183 KVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDG 242
           + I   +  +   P+ GQGA+ IE  V++   Q L+  + H++T   V  ERA    L G
Sbjct: 182 ERIASFIETDISLPAAGQGAVGIECRVDDELVQSLLAPLAHQETTICVLAERAMNNRLQG 241

Query: 243 SCKSAIAGFAYCKGSTLYFYGIVLASDG 270
            C+  I GFA  K   ++   +V A+DG
Sbjct: 242 GCQVPIGGFAQVKNGEVFLRALVGATDG 269


>gi|327489115|gb|EGF20910.1| hydroxymethylbilane synthase [Streptococcus sanguinis SK1058]
          Length = 306

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 167/308 (54%), Gaps = 12/308 (3%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K  ++GTR S LA+    +    L  +H  P  + V++P +TKGDR+T+ +L EIGGKG+
Sbjct: 2   KVIKVGTRKSKLAMTQTQQLVDQLKKLH--PERDFVLVPYTTKGDRLTHVSLQEIGGKGV 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFI-SHTAQSLKDLA 122
           F +EIE+ L++GEID AVHS KDMP KL +G  + A   RED+RD  I     Q+L +L 
Sbjct: 60  FVKEIERALLAGEIDMAVHSLKDMPAKLAEGCALGAISQREDVRDCLIFLQAGQTLANLP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR---L 179
             ++IGTSS+RR+  L   R D++    RG I+TR+ KL   +  AI+LA AG+KR   L
Sbjct: 120 EGALIGTSSIRRQVQLQAQRPDLAFKPLRGNIDTRIKKLEEGEYDAIVLAMAGLKRLGWL 179

Query: 180 KKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAE 239
            + ++  + L      P+  QGA+ +E    + + + L+  +  E T   V  ERA LA+
Sbjct: 180 DQSRLHIQPLETSLCLPAISQGALAVECREEDEELRSLLAAVQDEKTAAEVAVERAVLAQ 239

Query: 240 LDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFI 299
           ++  C   IA  A  KG       ++   DG+    VS  G     +     A Q +R +
Sbjct: 240 MNADCTFPIAALAQKKGQDYQLEAMLAKEDGQCVF-VSLQGQDGQEL-----AEQAVRQL 293

Query: 300 SNKNVFNF 307
           ++K     
Sbjct: 294 ADKGAVGM 301


>gi|309775730|ref|ZP_07670726.1| hydroxymethylbilane synthase [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916493|gb|EFP62237.1| hydroxymethylbilane synthase [Erysipelotrichaceae bacterium 3_1_53]
          Length = 299

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 156/292 (53%), Gaps = 2/292 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            R+GTR S LALA   E R  L + +  P H   +  +STKGDR  +  L ++  KG+F 
Sbjct: 3   IRMGTRGSALALAQCKEVRDRLQEAY--PQHTFELCVISTKGDRNQHVALDQMKDKGIFV 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE++L+ G ID AVHS KDMP+ L   L  +  L RED RDV +  TA +L+ L  H+
Sbjct: 61  KEIEQQLLEGTIDLAVHSMKDMPSTLDARLCFTKTLLREDARDVLVLRTAPTLEQLPPHA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            I T S RR   LLR R+D+ ++  RG IETRL KL   +   I+LA AG+KRLK +  I
Sbjct: 121 RIATGSKRRSYQLLRQRNDLEIVGIRGNIETRLRKLEEQQLDGIVLAAAGLKRLKLKPYI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            + L      P+  QGA+ IE         +LV  +      + V  ERAFL EL+G C 
Sbjct: 181 TQTLKECIMVPAVAQGALAIEVCKEREDLIQLVNALCDPALDEEVCAERAFLQELNGGCH 240

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
           + +        +T+  Y +    DG    ++  +G R  A+ +   AA  +R
Sbjct: 241 TPLGARCILHDTTVELYAVYGNEDGTRLKQLHVSGAREQAVELAIQAAAVLR 292


>gi|222151551|ref|YP_002560707.1| porphobilinogen deaminase homolog [Macrococcus caseolyticus
           JCSC5402]
 gi|254800255|sp|B9E743|HEM3_MACCJ RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|222120676|dbj|BAH18011.1| porphobilinogen deaminase homolog [Macrococcus caseolyticus
           JCSC5402]
          Length = 307

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 114/290 (39%), Positives = 169/290 (58%), Gaps = 5/290 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           +G+R S LAL  + +    L   H  P   I I  + TKGD+I N  L+++GGKGLF +E
Sbjct: 6   VGSRRSKLALTQSQQFIDQLKRKH--PNLEIEIKEIVTKGDQIVNVQLSKVGGKGLFVKE 63

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L  G ID A+HS KD+P+ L +GL +     RED RD +I+     L +L   S++
Sbjct: 64  IEQALYDGTIDFAIHSLKDVPSVLPEGLTLGCIPVREDARDAYIAKHHIPLHELKPGSIV 123

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK-VIK 186
           GTSSLRR A LL     + +   RG I+TRL KL +    AI+LA AG+ R+  +K ++ 
Sbjct: 124 GTSSLRRGAQLLDQYPHLEIKWIRGNIDTRLAKLRDEDYDAIILAAAGLNRMGWDKSIVT 183

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E LN E   P+ GQGA+ IE   ++ +   L+K ++ E+T      ER FL  +DGSC+ 
Sbjct: 184 EYLNPELMLPAIGQGALGIECRSDDAEVLALLKSVHDEETELCTEAERTFLRLMDGSCQV 243

Query: 247 AIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
            IAG A   G ++ F G++++ DGK  ++V+ +G   + I IG   A+ +
Sbjct: 244 PIAGHATMVGESIEFTGLIMSPDGKEKYKVTHSGG--NPIEIGTQVAKAM 291


>gi|115378196|ref|ZP_01465368.1| porphobilinogen deaminase [Stigmatella aurantiaca DW4/3-1]
 gi|310820650|ref|YP_003953008.1| porphobilinogen deaminase [Stigmatella aurantiaca DW4/3-1]
 gi|115364784|gb|EAU63847.1| porphobilinogen deaminase [Stigmatella aurantiaca DW4/3-1]
 gi|309393722|gb|ADO71181.1| Porphobilinogen deaminase [Stigmatella aurantiaca DW4/3-1]
          Length = 314

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/265 (38%), Positives = 152/265 (57%), Gaps = 2/265 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RI TR SPLAL  A    + L   H  P  ++ ++ ++T+GDR  +  L+ +GGKGLF 
Sbjct: 5   VRIATRQSPLALWQARHVGALLTAQH--PGLSVSLVEMTTEGDRFLSAPLSSVGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ L+ G  D AVHS KDM + L +GL ++A   RED RD F S T  +L  L   +
Sbjct: 63  KEIEQALLDGRADIAVHSLKDMTSVLPEGLMLAAVPVREDPRDAFCSPTGLTLDRLPQGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR  +L  WR D+ ++  RG ++TRL K  +      +LA+AG+KRL  E+ I
Sbjct: 123 RVGTSSLRRSCILRSWRKDLEIVSLRGNVQTRLQKTRDLGLAGTVLAHAGLKRLGLEREI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            E+L+     P+ GQG + I+    + + + L+  +    T  +V  ERA LA+L+G CK
Sbjct: 183 SEVLSPSVSLPAVGQGVLAIQCRTEDAEVRALLGPLEDAVTRVAVTAERALLAKLEGGCK 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDG 270
             +AG A  +   ++  G V   DG
Sbjct: 243 VPLAGHATVEQGRVHLRGFVGRPDG 267


>gi|239905446|ref|YP_002952185.1| porphobilinogen deaminase [Desulfovibrio magneticus RS-1]
 gi|239795310|dbj|BAH74299.1| porphobilinogen deaminase [Desulfovibrio magneticus RS-1]
          Length = 311

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 164/300 (54%), Gaps = 4/300 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           I TR S LAL  A      L   H  P   + ++P+ TKGD I +  L ++GGKGLF +E
Sbjct: 7   IATRGSKLALWQANHVADRLRQTH--PGLAVDLLPIKTKGDIILDVPLAKVGGKGLFVKE 64

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           IE+ L+ G  D AVHS KD+P +   GL +     RED  D  +S    SL  L   + +
Sbjct: 65  IEEALLDGRADLAVHSMKDVPAEQPAGLVVGIVPEREDPCDRLLSVAYDSLAALPQGATV 124

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSSLRRKA LL  R D++++D RG ++TR+ KL + +  AI++A AG+ RL+       
Sbjct: 125 GTSSLRRKAQLLALRPDLAIVDLRGNLDTRVKKLLDGQFDAIIVAAAGLNRLELSAPKAV 184

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
            L   +F P+  QGA+ IE  +++P+   ++   +H ++ D+V  ER FL  L+G C+  
Sbjct: 185 RLGPPEFLPAAAQGALGIEYRLDDPETAAMLAFFDHPESHDAVAAERGFLGHLEGGCQVP 244

Query: 248 IAGFAYCKGSTLYFYGIVLASD-GKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKNVFN 306
           IA  A   G  ++  G+V   + G+ F E + +G R  A  +G   A+ +     K V +
Sbjct: 245 IAAHAVIDGDMIHLEGLVADPETGQTFREAA-SGPRSQATALGVAVAEAVLARGAKAVLD 303


>gi|225630165|ref|YP_002726956.1| porphobilinogen deaminase [Wolbachia sp. wRi]
 gi|254800263|sp|C0R2M3|HEM3_WOLWR RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|225592146|gb|ACN95165.1| porphobilinogen deaminase [Wolbachia sp. wRi]
          Length = 292

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 113/292 (38%), Positives = 164/292 (56%), Gaps = 8/292 (2%)

Query: 7   RIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTE 66
           +IGTR S LA+  A E +  L+D    P  +I I+ + T GD+  N  L EIGGKGLF +
Sbjct: 4   KIGTRGSKLAVVQALEAKQKLLD--SFPNLSIEIVKIKTSGDKYANANLAEIGGKGLFIK 61

Query: 67  EIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSV 126
           EIE +L+   ID AVHS KD+P     GL I   L R    D FISH   SL+ L   + 
Sbjct: 62  EIEAELLENNIDMAVHSLKDVPAFFSWGLTIPCVLERLSPCDAFISHKHNSLESLPQQAT 121

Query: 127 IGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIK 186
           I TS++RRK  LL +R D++++  RG + TR   L N     I+LA AG+ RL+K  +I 
Sbjct: 122 IATSAIRRKVQLLNFRPDLNIVPLRGNVTTR---LQNQSFDGIILAEAGLIRLEKHHLIT 178

Query: 187 EILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKS 246
           E+L  +    + GQGAICI+   N+ K  +L++ IN+  ++  V  ER+F+  ++GSC +
Sbjct: 179 EVLPPKVMLSAVGQGAICIQCRRNDVKIIDLLEKINNNMSFIGVKSERSFMKTVNGSCFT 238

Query: 247 AIAGFA-YCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIR 297
            +A  A Y   + LY   ++  +DGK  +   R     DA  +G DA   ++
Sbjct: 239 PLAALAEYVSENMLYLRCML--ADGKNIYFTERTSFIEDAEKMGMDAGLELK 288


>gi|319789486|ref|YP_004151119.1| porphobilinogen deaminase [Thermovibrio ammonificans HB-1]
 gi|317113988|gb|ADU96478.1| porphobilinogen deaminase [Thermovibrio ammonificans HB-1]
          Length = 311

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 111/305 (36%), Positives = 175/305 (57%), Gaps = 6/305 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  +   ++ +    K P   + ++ ++TKGD+I +  L +IG KGLFT
Sbjct: 3   IRIGTRKSKLALWQSEWVKAQIE--KKFPDVEVELVKITTKGDKILDVPLAKIGDKGLFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE+ ++ GE+D AVHS KD+P+KL KGL++ A+  RED RD  +S    +L+ L   +
Sbjct: 61  KEIEEAMLRGEVDIAVHSLKDVPSKLPKGLKLIAFSDREDPRDALLSCGRYTLETLPEGA 120

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
           V+GTSSLRRKA L   R D+ + D RG ++TR+ KL   +  AI+LA AG+KRL  E+ I
Sbjct: 121 VVGTSSLRRKAQLRILRPDLQIKDLRGNVDTRIRKLKEGQYDAIILAAAGVKRLGWEEEI 180

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVK-VINHEDTWDSVNCERAFLAELDGSC 244
            EIL+ E   PS  QG + IE    + + + +V+  +N  ++  +   ERAFL  ++G C
Sbjct: 181 DEILSPERMIPSVCQGILGIEGREGDSEVERIVREAVNSYESEVAATVERAFLRTVEGGC 240

Query: 245 KSAIAGFAYCKGSTLYFYGIVLASDGKIFHE---VSRNGNRCDAINIGRDAAQYIRFISN 301
           +  +  +A      +     +   +G+ +H+   V R  +  +A +IG   A+ +     
Sbjct: 241 QVPLGCYAVVNEDRILVRAFISDLNGRFYHKEEGVFRFKDLREADSIGVAVAERLLSAGG 300

Query: 302 KNVFN 306
           K +  
Sbjct: 301 KTILE 305


>gi|146280919|ref|YP_001171072.1| porphobilinogen deaminase [Pseudomonas stutzeri A1501]
 gi|145569124|gb|ABP78230.1| porphobilinogen deaminase [Pseudomonas stutzeri A1501]
          Length = 314

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 161/293 (54%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGGKGL
Sbjct: 5   REIRIATRKSALALWQAEYVKARLEASH--PGLKVSLVPMVSRGDKLLDAPLAKIGGKGL 62

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+  E D AVHS KD+P +  +GL +     RED RD F+S+   SL  L  
Sbjct: 63  FVKELETALLENEADIAVHSMKDVPMEFPEGLGLYCICEREDPRDAFVSNRFDSLDALPP 122

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL   +
Sbjct: 123 GSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFGE 182

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  + +++  P+ GQGA+ IE    + +   L+  +NH  T   V  ERA    L+G 
Sbjct: 183 RIRSSIGVDESLPAGGQGAVGIECRTGDSEVHALLACLNHAPTATRVVAERALNKRLNGG 242

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IA +A  +G  L+  G+V   DG +           +A  +G   A+ +
Sbjct: 243 CQVPIACYAVLEGEQLWLRGLVGQPDGTLLLRAEGRAPAAEAEALGVQVAEEL 295


>gi|121595211|ref|YP_987107.1| porphobilinogen deaminase [Acidovorax sp. JS42]
 gi|120607291|gb|ABM43031.1| porphobilinogen deaminase [Acidovorax sp. JS42]
          Length = 320

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 102/254 (40%), Positives = 148/254 (58%), Gaps = 4/254 (1%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           I TR S LAL  A   +S L    +   H + ++ ++T+GD+I +RTL+++GGKGLF +E
Sbjct: 23  IATRESQLALWQAEHVQSLL----RARGHAVALLGMTTRGDQILDRTLSKVGGKGLFVKE 78

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           +E  L  G  D AVHS KD+P +L +G  ++  + RED RD F+S    SL +L   +V+
Sbjct: 79  LEVALEEGRADIAVHSLKDVPMELPQGFALACVMEREDPRDAFVSPGYASLDELPHGAVV 138

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSSLRR+ALL   R D+ +   RG ++TRL KL+  +  AI+LA AG+KRL   + I+ 
Sbjct: 139 GTSSLRRQALLQALRPDLQIEPLRGNVQTRLRKLDEGQYAAIVLAAAGLKRLGLHERIRA 198

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
           +   E   P+ GQGA+ IE   +    +E +  + HE TW +V  ERA    + GSC   
Sbjct: 199 VFTPEQMLPAAGQGALGIEIRGDRHDLREALAPLAHERTWLTVTAERAVSRAMGGSCSMP 258

Query: 248 IAGFAYCKGSTLYF 261
           +A      G TL  
Sbjct: 259 LAAHGQWDGDTLSL 272


>gi|315282478|ref|ZP_07870883.1| porphobilinogen deaminase [Listeria marthii FSL S4-120]
 gi|313613876|gb|EFR87615.1| porphobilinogen deaminase [Listeria marthii FSL S4-120]
          Length = 309

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 115/297 (38%), Positives = 170/297 (57%), Gaps = 11/297 (3%)

Query: 3   KKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKG 62
           K+   +G+R S LAL  +    + L + +  P  +  I  + TKGDRI + TL+++GGKG
Sbjct: 2   KRKIIVGSRRSKLALTQSNWVINKLKENY--PEFDFEIKEIVTKGDRILDVTLSKVGGKG 59

Query: 63  LFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLA 122
           LF  E+E+ L    ID AVHS KD+P+ L +GL I A   RE   D F+ +   SL +L 
Sbjct: 60  LFVSEVEQALSDKAIDFAVHSMKDVPSSLKEGLVIGAIPKRESPLDCFVFNQVSSLDELP 119

Query: 123 LHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKE 182
             +VIGTSSLRR A LL+ R D  +   RG I+TRL KL+     AI+LA AG+ R+   
Sbjct: 120 KGAVIGTSSLRRAAQLLKHRPDFIIKPIRGNIDTRLQKLHAENFDAIILAKAGLSRMG-- 177

Query: 183 KVIKEILNIEDFP-----PSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
            +    L +ED P     P+ GQGA+ IE   ++ + ++++  ++HE+T   V  ER FL
Sbjct: 178 WLENTTLKLEDIPAELCLPAVGQGALAIECRESDQQIRDMLASVHHEETGVCVEAERVFL 237

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQ 294
            +L+G C+  IAGFA   G  ++F G+V  +DG +  E  + G   +  +IG   A+
Sbjct: 238 KKLNGGCEIPIAGFAAKTGDVIHFKGLVGNADGSVILESEQTGT--NPSDIGNQVAE 292


>gi|327479188|gb|AEA82498.1| porphobilinogen deaminase [Pseudomonas stutzeri DSM 4166]
          Length = 312

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 161/293 (54%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L +IGGKGL
Sbjct: 3   REIRIATRKSALALWQAEYVKARLEASH--PGLKVSLVPMVSRGDKLLDAPLAKIGGKGL 60

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  L+  E D AVHS KD+P +  +GL +     RED RD F+S+   SL  L  
Sbjct: 61  FVKELETALLENEADIAVHSMKDVPMEFPEGLGLYCICEREDPRDAFVSNRFDSLDALPP 120

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            SV+GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL   +
Sbjct: 121 GSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLGFGE 180

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  + +++  P+ GQGA+ IE    + +   L+  +NH  T   V  ERA    L+G 
Sbjct: 181 RIRSSIGVDESLPAGGQGAVGIECRTGDSEVHALLACLNHAPTATRVVAERALNKRLNGG 240

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  IA +A  +G  L+  G+V   DG +           +A  +G   A+ +
Sbjct: 241 CQVPIACYAVLEGEQLWLRGLVGQPDGTLLLRAEGRAPAAEAEALGVQVAEEL 293


>gi|293604316|ref|ZP_06686723.1| hydroxymethylbilane synthase [Achromobacter piechaudii ATCC 43553]
 gi|292817193|gb|EFF76267.1| hydroxymethylbilane synthase [Achromobacter piechaudii ATCC 43553]
          Length = 315

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 160/289 (55%), Gaps = 2/289 (0%)

Query: 8   IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFTEE 67
           I TR S LAL  A   R  L  ++  P   + ++ L+T+GD+I +RTL+++GGKGLF +E
Sbjct: 9   IATRASRLALWQAEHVRDRLRTLY--PACAVELLTLTTRGDQILDRTLSKVGGKGLFVKE 66

Query: 68  IEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHSVI 127
           +E  L+ G  D AVHS KD+P  L    ++ A L R D RD F+S+    L DL   +V+
Sbjct: 67  LENALLDGRADLAVHSLKDVPVDLQAPFELCAILDRADPRDAFVSNRYAGLADLPAGAVV 126

Query: 128 GTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVIKE 187
           GTSSLRR++ +      + V   RG ++TRL KL+  +  AI+LA AG++RL  E  I+ 
Sbjct: 127 GTSSLRRESQIRARFPTLVVKPLRGNLDTRLGKLDKGEYDAIVLAAAGLQRLGLESRIRS 186

Query: 188 ILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCKSA 247
           +L+  D  P+ GQGA+ IE   +    +  +  +    T   V  ERA   +L GSC+  
Sbjct: 187 LLDPADSLPAAGQGALGIEIRNDRDDMRAWLAPLISAATTSCVQAERAVSRKLGGSCQVP 246

Query: 248 IAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           +A FA   G TL    +V + DG       R+G   DA  +G  AAQ +
Sbjct: 247 LAAFAEISGDTLSLRALVASPDGVRMVHTRRSGPVADAQALGEAAAQEL 295


>gi|198284968|ref|YP_002221289.1| porphobilinogen deaminase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666388|ref|YP_002427653.1| porphobilinogen deaminase [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|226740625|sp|B7JBH8|HEM3_ACIF2 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|226740626|sp|B5ERN6|HEM3_ACIF5 RecName: Full=Porphobilinogen deaminase; Short=PBG; AltName:
           Full=Hydroxymethylbilane synthase; Short=HMBS; AltName:
           Full=Pre-uroporphyrinogen synthase
 gi|198249489|gb|ACH85082.1| porphobilinogen deaminase [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218518601|gb|ACK79187.1| porphobilinogen deaminase [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 306

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 157/277 (56%), Gaps = 3/277 (1%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR SPLA+  A   R++L+ +H  P   + II ++T GD + +  L  +GGKGLF 
Sbjct: 5   LRIGTRASPLAVWQAEHVRAALLRLH--PGMAVEIITMTTSGDVLLDAPLHALGGKGLFV 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
           +EIE  L    +D AVHS KD+P     GL+I A + RED+RD F+S+T      L   +
Sbjct: 63  KEIEDALQQRRVDVAVHSMKDVPALQPDGLEIVAIMAREDVRDAFVSNTFLHPDALPEGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +G+SSLRR+A LL     + V D RG + TRL +L+     AI+LA AG+KRL     I
Sbjct: 123 RVGSSSLRRRAQLLERYPHLRVEDLRGNVATRLRRLDEGHYDAIILAAAGLKRLGLPDRI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
             +L+I+   P+ GQGAI IE   ++ + +EL+  +   DT + V  ER+    L G C+
Sbjct: 183 THLLDIDRSLPAVGQGAIGIEARSDDRRTRELLAPLADADTQNCVLAERSMNQVLGGDCR 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDG-KIFHEVSRNGN 281
             +A  A  +G  +   G+V   DG ++ H  ++  +
Sbjct: 243 LPVAALARWQGPQMLLRGLVATPDGRRVLHAEAKGSD 279


>gi|313893126|ref|ZP_07826703.1| hydroxymethylbilane synthase [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313442479|gb|EFR60894.1| hydroxymethylbilane synthase [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 305

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/275 (37%), Positives = 158/275 (57%), Gaps = 2/275 (0%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            RIGTR S LAL  A    + L  ++  P   + ++  +TKGDRI  + L ++GGKGLFT
Sbjct: 5   IRIGTRKSALALWQAEHISAELQRLY--PNITVELVHFNTKGDRILEKPLAQVGGKGLFT 62

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLALHS 125
            E+E+ +  G+ID AVHS KDMPT+L +GL + A   RE   D  +S   ++L  L   +
Sbjct: 63  AELEEAMHKGDIDIAVHSLKDMPTELPEGLTLGAISAREVPYDALVSPVYKTLDKLPQGA 122

Query: 126 VIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKVI 185
            +GTSSLRR+A LL  R D+ V   RG ++TRL+K+   K   ++LA AG+KRL  +  I
Sbjct: 123 RVGTSSLRRQAQLLHVRPDLKVEVIRGNVQTRLSKIETEKLDGVILAQAGLKRLGLDDQI 182

Query: 186 KEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGSCK 245
            ++   ++  P+ GQGA+ IE   ++ +  E++  IN E T  +V  ER+FL +L+G C+
Sbjct: 183 TQVFKADEMIPAVGQGALAIECRADDTEMLEMLAPINDEATRYAVEGERSFLRQLNGGCQ 242

Query: 246 SAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNG 280
             +          L    ++ + DGK  +E   +G
Sbjct: 243 VPMGVHGTIDKGQLTLKAMIASLDGKTVYEGEISG 277


>gi|95931480|ref|ZP_01314180.1| porphobilinogen deaminase [Desulfuromonas acetoxidans DSM 684]
 gi|95132465|gb|EAT14164.1| porphobilinogen deaminase [Desulfuromonas acetoxidans DSM 684]
          Length = 313

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 171/292 (58%), Gaps = 8/292 (2%)

Query: 6   FRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGLFT 65
            +IGTR S LAL  A+     L D       +  I+ + T+GD++ + ++ +IG KG+FT
Sbjct: 5   IKIGTRRSKLALWQAYYVEQLLQDAG----MDTEIVEIDTRGDQVLDVSIAKIGSKGVFT 60

Query: 66  EEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQ-SLKDLALH 124
           EE+E +L SG+ID AVHSAKDM ++L +G +I A+  RE + DV +S      L D +  
Sbjct: 61  EELEDQLRSGDIDIAVHSAKDMQSELPEGFEIIAFTIREKVNDVVVSRDKSIRLGDTSRP 120

Query: 125 SVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEKV 184
             IG+SS+RR+A+L  +   +++I+ RG ++TR+ K+++ +  AILLAYAG+ R++   +
Sbjct: 121 LTIGSSSVRRRAILKAYYPHLNIIEMRGNLQTRIGKMDDGQCDAILLAYAGVNRMEYNDL 180

Query: 185 IKEILNIEDFPPSPGQGAICIETHVN-NPKAQELV-KVINHEDTWDSVNCERAFLAELDG 242
           I E L +E F P  GQG++ IE+ +N + K +E + K +NH DT   +  ERAFL  L G
Sbjct: 181 IVETLPLEQFIPPVGQGSVAIESAINLDAKKRETIRKAVNHPDTEFRLLAERAFLKTLKG 240

Query: 243 SCKSAIAGFAYCKG-STLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAA 293
            C       A  +G   L   G +++ DG+   +    G R DA  +G   A
Sbjct: 241 GCSIPAFCMAELEGDDQLKVTGGMISLDGQTLIKNVLTGARSDAEQLGDQMA 292


>gi|332139557|ref|YP_004425295.1| porphobilinogen deaminase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549579|gb|AEA96297.1| porphobilinogen deaminase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 312

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 165/293 (56%), Gaps = 2/293 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           +  RI TR S LAL  A   ++ L++ +  P   + ++P+ST+GD+I +  L +IGGKGL
Sbjct: 8   RTVRIATRKSALALWQAEYVKAKLLEHY--PSMTVELVPMSTQGDKILDTPLAKIGGKGL 65

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +E+E  ++ G  D AVHS KD+P +  +G  + A   RE+  D F+S+   SL  L  
Sbjct: 66  FIKELEIAMLEGRADIAVHSMKDVPVEFPEGFGLHAICERENPFDAFVSNNHDSLDALPE 125

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +++GTSSLRR+  + ++R D+ + D RG + TRL KL+  +  AI+LA AG+ RLK + 
Sbjct: 126 GAIVGTSSLRRQCQIRKYRPDLIIKDLRGNVNTRLAKLDAGEYDAIILASAGLIRLKMQS 185

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
            I+  L  +   P+ GQGA+ IE   ++ +   L++ +NH DT   V  ERA    L+G 
Sbjct: 186 RIRMALPADISLPAVGQGAVGIECRNDDEELIALLQALNHADTHTRVTAERAMNERLEGG 245

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYI 296
           C+  I  FA      L   G+V   DG      S   +R  A ++G + A+ +
Sbjct: 246 CQVPIGSFATLDNDVLTLTGMVGKPDGSELLFASATASREKAKDMGIEVAEAL 298


>gi|332284596|ref|YP_004416507.1| porphobilinogen deaminase [Pusillimonas sp. T7-7]
 gi|330428549|gb|AEC19883.1| porphobilinogen deaminase [Pusillimonas sp. T7-7]
          Length = 315

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 160/291 (54%), Gaps = 4/291 (1%)

Query: 1   MEKKPFR--IGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEI 58
           M + P +  I TR S LAL  A   R  L  ++  P   + ++ ++T+GD+I +R+L+++
Sbjct: 1   MSEAPAKLVIATRASRLALWQAEHVRDRLQTLY--PQCQVSLLTMTTRGDQILDRSLSKV 58

Query: 59  GGKGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSL 118
           GGKGLF +E+E  L+ G  D AVHS KD+P  +     +S  L R+D RD F+S+   SL
Sbjct: 59  GGKGLFVKELETALLDGRADLAVHSLKDVPVDMQSPFALSVILERDDPRDAFVSNDYSSL 118

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKR 178
            DL   SV+GTSSLRR+A + +    + V   RG ++TRL KL+     AI+LA AG++R
Sbjct: 119 DDLPAGSVVGTSSLRREAQIRQRYPQLQVQPLRGNLDTRLGKLDRGDYAAIILASAGLRR 178

Query: 179 LKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLA 238
           L  E  I+  LN E   P+ GQGA+ IE   +    Q  +  ++  DT      ERA   
Sbjct: 179 LGLEARIRSHLNPEQSLPAAGQGALGIEILESRSDMQTWLAPLSDPDTTACALAERAVSR 238

Query: 239 ELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIG 289
            L GSC+  +A FA   G+TL   G+V   DG        +G+   A  +G
Sbjct: 239 VLGGSCQVPLAAFAQRDGNTLMVRGLVAEPDGSRIIRAQVSGDVSQAEELG 289


>gi|226326699|ref|ZP_03802217.1| hypothetical protein PROPEN_00552 [Proteus penneri ATCC 35198]
 gi|225204920|gb|EEG87274.1| hypothetical protein PROPEN_00552 [Proteus penneri ATCC 35198]
          Length = 291

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 153/271 (56%), Gaps = 2/271 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M K   RI TR SPLA+  A   +  L   H  P   + ++P+ TKGD I +  L ++GG
Sbjct: 1   MSKSTIRIATRQSPLAMWQALYVKEQLQLTH--PGLVVELVPMVTKGDIILDTPLAKVGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+   +L++
Sbjct: 59  KGLFVKELELALLESRADIAVHSMKDVPIDFPEGLGLVTICEREDPRDAFVSNHYNALEE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+  L   R D+ + D RG + TRL+KL+N    AI+LA AG+KRL 
Sbjct: 119 LPAGSIVGTSSLRRQCQLKAQRPDLIIRDLRGNVGTRLSKLDNGDYDAIILAVAGLKRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
             + I+  L+ E   P+ GQGA+ I   +N+ + + L   +NH  T   V  +RA    L
Sbjct: 179 LNERIRTPLSAEQSLPAVGQGAVGIGRQLNDNETRHLFDALNHSPTAILVKIKRAMNTRL 238

Query: 241 DGSCKSAIAGFAYCKGSTLYFYGIVLASDGK 271
           +G C+  I  +A  +   + F  +V + DG+
Sbjct: 239 EGGCQVPIGTYAIWQDDKILFGALVGSPDGE 269


>gi|323699104|ref|ZP_08111016.1| porphobilinogen deaminase [Desulfovibrio sp. ND132]
 gi|323459036|gb|EGB14901.1| porphobilinogen deaminase [Desulfovibrio desulfuricans ND132]
          Length = 310

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 112/303 (36%), Positives = 163/303 (53%), Gaps = 2/303 (0%)

Query: 4   KPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGKGL 63
           K   I TR S LAL  A   +  L   H  P  ++ ++ + TKGD+I +  L ++GGKGL
Sbjct: 2   KKLTIATRGSALALWQANHIKDRLEAEH--PGLSVDLLKIKTKGDKILDVPLAKVGGKGL 59

Query: 64  FTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKDLAL 123
           F +EIE+ L+ G    AVHS KD+PT+L  GL++     RE+  D  +S     L  L  
Sbjct: 60  FVKEIEEALLDGRAQLAVHSMKDVPTELPDGLEVGIIPEREEATDSLLSVKYDGLAGLPE 119

Query: 124 HSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLKKEK 183
            +V+GTSSLRR++ L   R D+ +   RG ++TRLNKL N +  AI+LA AG+KRL    
Sbjct: 120 GAVVGTSSLRRQSQLCALRPDLKIETLRGNLDTRLNKLLNGEYDAIVLATAGLKRLAMSA 179

Query: 184 VIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAELDGS 243
             +EIL+  +F P+  QGA+ IE    + + ++L+  ++H  T   V  ER FL  LDG 
Sbjct: 180 PKQEILSPPEFLPAVAQGALGIEFRSADTEVRDLLAFLDHAPTKHQVLAERGFLTGLDGG 239

Query: 244 CKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSRNGNRCDAINIGRDAAQYIRFISNKN 303
           C+  IA ++  +G TL   G V   DG         GN   A ++G   A  +     K 
Sbjct: 240 CQVPIAAWSVIEGETLRLTGYVAEVDGSTPIRRMVEGNVAHAWDLGMILAGQVLEAGGKA 299

Query: 304 VFN 306
           + +
Sbjct: 300 ILD 302


>gi|330890195|gb|EGH22856.1| porphobilinogen deaminase [Pseudomonas syringae pv. mori str.
           301020]
          Length = 313

 Score =  186 bits (471), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 106/296 (35%), Positives = 163/296 (55%), Gaps = 2/296 (0%)

Query: 1   MEKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGG 60
           M  +  RI TR S LAL  A   ++ L   H  P   + ++P+ ++GD++ +  L++IGG
Sbjct: 1   MSSREIRIATRKSALALWQAEYVKARLEQAH--PGLLVTLVPMVSRGDKLLDSPLSKIGG 58

Query: 61  KGLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTAQSLKD 120
           KGLF +E+E  L+    D AVHS KD+P    +GL +     RED RD F+S+T  SL +
Sbjct: 59  KGLFVKELETALLEDNADIAVHSMKDVPMDFPQGLGLFCICEREDPRDAFVSNTFASLDE 118

Query: 121 LALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLNNNKAHAILLAYAGIKRLK 180
           L   S++GTSSLRR+A LL  R D+ +   RG + TRL KL+  +  AI+LA AG+ RL 
Sbjct: 119 LPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGEYDAIILAAAGLIRLG 178

Query: 181 KEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFLAEL 240
            E  I   ++++D  P+ GQGA+ IE    + +   L+  ++HED    V  ER+