PSIBLAST alignment of GI: 254781037 and protein with PDB id: 3ecr

>gi|208435725|pdb|3ECR|A Chain A, Structure Of Human Porphobilinogen Deaminase Length = 364
>gi|208435726|pdb|3ECR|B Chain B, Structure Of Human Porphobilinogen Deaminase Length = 364
 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 107/338 (31%), Positives = 158/338 (46%), Gaps = 35/338 (10%)

Query: 2   EKKPFRIGTRCSPLALAHAFETRSSLMDVHKIPPHNIVIIPLSTKGDRITNRTLTEIGGK 61
           + +  R+GTR S LA        ++L   +  P     II +ST GD+I +  L++IG K
Sbjct: 20  KMRVIRVGTRKSQLARIQTDSVVATLKASY--PGLQFEIIAMSTTGDKILDTALSKIGEK 77

Query: 62  GLFTEEIEKKLISGEIDCAVHSAKDMPTKLLKGLQISAYLPREDIRDVFISHTA---QSL 118
            LFT+E+E  L   E+D  VHS KD+PT L  G  I A   RE+  D  + H     ++L
Sbjct: 78  SLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTL 137

Query: 119 KDLALHSVIGTSSLRRKALLLRWRSDISVIDFRGKIETRLNKLN-NNKAHAILLAYAGIK 177
           + L   SV+GTSSLRR A L R    +     RG + TRL KL+   +  AI+LA AG++
Sbjct: 138 ETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQ 197

Query: 178 RLKKEKVIKEILNIEDFPPSPGQGAICIETHVNNPKAQELVKVINHEDTWDSVNCERAFL 237
           R+     + +IL+ E+   + GQGA+ +E    +    +LV V++  +T      ERAFL
Sbjct: 198 RMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFL 257

Query: 238 AELDGSCKSAIAGFAYCKGSTLYFYGIVLASDGKIFHEVSR-----------NGNRCD-- 284
             L+G C   +A     K   LY  G V + DG    + +            +G   D  
Sbjct: 258 RHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQ 317

Query: 285 ----------------AINIGRDAAQYIRFISNKNVFN 306
                           A N+G   A  +     KN+ +
Sbjct: 318 LVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILD 355