HHsearch alignment for GI: 254781039 and conserved domain: COG0373

>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism].
Probab=97.52  E-value=0.00018  Score=48.83  Aligned_cols=73  Identities=25%  Similarity=0.357  Sum_probs=58.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECHHHHHHHHHHHCCCC
Q ss_conf             87799977887899999999977998189994498999999977898422798817874389731687755554411221
Q gi|254781039|r    4 YSTIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRINAKALPGIKLSPLLNFSSDHTLLQNADIVLFATS   83 (329)
Q Consensus         4 ~~kI~ViGaGa~GtAlA~~La~~g~~~V~l~~r~~~~~~~i~~~~~n~~~lp~i~l~~~i~~t~~~~~l~~adiIiiavp   83 (329)
T Consensus       178 ~~~vlvIGAGem~~lva~~L~~~g~~~i~IaNRT~erA~~La~~~~-~~---------~~~l~el~~~l~~~DvVissTs  247 (414)
T COG0373         178 DKKVLVIGAGEMGELVAKHLAEKGVKKITIANRTLERAEELAKKLG-AE---------AVALEELLEALAEADVVISSTS  247 (414)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCHHHHHHHHHHHC-CE---------EECHHHHHHHHHHCCEEEEECC
T ss_conf             6769998651899999999985898779997587899999999838-70---------2218778876520799999069


Q ss_pred             HHH
Q ss_conf             777
Q gi|254781039|r   84 SKG   86 (329)
Q Consensus        84 s~~   86 (329)
T Consensus       248 a~~  250 (414)
T COG0373         248 APH  250 (414)
T ss_pred             CCC
T ss_conf             985