>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like. E1, a highly conserved small protein present universally in eukaryotic cells, is part of cascade to attach ubiquitin (Ub) covalently to substrate proteins. This cascade consists of activating (E1), conjugating (E2), and/or ligating (E3) enzymes and then targets them for degradation by the 26S proteasome. E1 activates ubiquitin by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and ubiquitin's C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. A set of novel molecules with a structural similarity to Ub, called Ub-like proteins (Ubls), have similar conjugation cascades. In contrast to ubiquitin-E1, which is a single-chain protein with a weakly conserved two-fold repeat, many of the Ubls-E1are a heterodimer where each subunit corresponds to one half of a single-chain E1. This CD represents the family homologou

Probab=93.55 E-value=0.068 Score=32.02 Aligned_cols=105 Identities=18% Similarity=0.279 Sum_probs=65.1 Q ss_pred EEEEECCCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCC---CCCCCCC--------CCCCCCEEEE-------- Q ss_conf 79997788789999999997799818999449899999997789---8422798--------8178743897-------- Q gi|254781039|r 6 TIFVIGAGAFGTALSSVIASRGLANVTLLGRKEILMQQLEDTRI---NAKALPG--------IKLSPLLNFS-------- 66 (329) Q Consensus 6 kI~ViGaGa~GtAlA~~La~~g~~~V~l~~r~~~~~~~i~~~~~---n~~~lp~--------i~l~~~i~~t-------- 66 (329) T Consensus 1 KVlvvGaGglGce~~k~La~~Gvg~i~iiD~D~Ie~SNLnRQfLf~~~dvGk~Ka~vAa~~l~~~Np~~~I~~~~~~v~~ 80 (234) T cd01484 1 KVLLVGAGGIGCELLKNLALMGFGQIHVIDMDTIDVSNLNRQFLFRPKDIGRPKSEVAAEAVNDRNPNCKVVPYQNKVGP 80 (234) T ss_pred CEEEECCCHHHHHHHHHHHHCCCCEEEEECCCEECCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCC T ss_conf 98999488879999999998399869997599005677013024464426882299999999987899779998055686 Q ss_pred -E--CHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCEE-ECCCCCC Q ss_conf -3--16877555544112217776665555332035685055-2375200 Q gi|254781039|r 67 -S--DHTLLQNADIVLFATSSKGYGEALNFYSNWLKESAEII-ICSKGFE 112 (329) Q Consensus 67 -~--~~~~l~~adiIiiavps~~~~~~l~~i~~~l~~~~~ii-~~sKGi~ 112 (329) T Consensus 81 e~~~~~~f~~~~DvVi~alDN~~aR~~vN~~c~~~--~~PLIegGt~G~~ 128 (234) T cd01484 81 EQDFNDTFFEQFHIIVNALDNIIARRYVNGMLIFL--IVPLIESGTEGFK 128 (234) T ss_pred CCCCCHHHHHHCCEEEECCCCHHHHHHHHHHHHHH--CCCEEEECCCCCE T ss_conf 21057988852999998857888999999999980--9985972024614

HHsearch alignment for GI: 254781039 and conserved domain: cd01484