Query         gi|254781040|ref|YP_003065453.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 143
No_of_seqs    126 out of 1227
Neff          5.6 
Searched_HMMs 33803
Date          Wed Jun  1 22:04:23 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254781040.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3eop_A Thymocyte nuclear prot 100.0       0       0  424.6   8.7  142    1-142     1-173 (176)
  2 >1zce_A Hypothetical protein A 100.0       0       0  414.7  10.5  142    1-142     2-143 (155)
  3 >2ar1_A Hypothetical protein;  100.0       0       0  384.1   8.2  140    1-142    19-172 (172)
  4 >2gbs_A Hypothetical protein R 100.0       0       0  375.3  11.2  141    1-142     1-141 (145)
  5 >2eve_A Hypothetical protein p 100.0       0       0  375.9   9.9  140    1-142     1-155 (157)
  6 >2p5d_A UPF0310 protein mjecl3 100.0 4.4E-35 1.3E-39  230.0   3.5  121    1-134     4-146 (147)
  7 >2hd9_A UPF0310 protein PH1033  97.9 1.6E-05 4.8E-10   53.8   4.7  120    1-135     1-143 (145)
  8 >2kku_A Uncharacterized protei  80.9     2.3 6.9E-05   23.0   4.1   58   41-98     57-147 (161)
  9 >2p1g_A Putative xylanase; str  79.8       2 5.8E-05   23.4   3.5   38   27-64    156-195 (249)
 10 >2b25_A Hypothetical protein;   55.2      13 0.00038   18.6   3.3   27   42-68      9-35  (73)
 11 >2im9_A Hypothetical protein;   54.5     7.8 0.00023   19.9   2.1   17   40-56    237-254 (333)
 12 >2k8s_A Thioredoxin; dimer, st  46.1     8.7 0.00026   19.6   1.3   15   47-61      3-17  (80)
 13 >3h41_A NLP/P60 family protein  42.4      12 0.00036   18.7   1.6   24   41-64     64-89  (127)
 14 >1ztc_A Hypothetical protein T  35.5      22 0.00064   17.2   1.9   27   30-56     54-80  (87)
 15 >2wrg_I Hemagglutinin HA2 chai  34.8      12 0.00036   18.7   0.6   19   35-53     55-76  (77)
 16 >1yel_A AT1G16640; CESG, prote  29.4      44  0.0013   15.4   3.5   29   37-65     70-100 (104)
 17 >3bij_A Uncharacterized protei  26.9      49  0.0015   15.1   2.9   22   36-57     64-85  (285)
 18 >2pwy_A TRNA (adenine-N(1)-)-m  21.8      34   0.001   16.1   0.9   14   43-56      4-17  (64)

No 1  
>>3eop_A Thymocyte nuclear protein 1; protein of unknown function, alternative splicing, nucleus, phosphoprotein; 2.30A {Homo sapiens} (A:)
Probab=100.00  E-value=0  Score=424.59  Aligned_cols=142  Identities=37%  Similarity=0.655  Sum_probs=135.0

Q ss_pred             CCCCEECCCCCC---------CCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC-CCCCEEEEEECCCC
Q ss_conf             974500115886---------67789985868887777765899999998538897899994588-87634888860446
Q gi|254781040|r    1 MAYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GREIVGIFEVITCT   70 (143)
Q Consensus         1 M~yWL~KsEP~~---------~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~-~~~ivgi~~v~~~~   70 (143)
                      |+||||||||++         ||||||.++++++++||||||||||||||+||+||+|||||||| +|+||||++|++++
T Consensus         1 M~YWL~KsEP~~r~~~g~d~~fSidDl~~~~~~~~~WdGVRNyqArn~lR~Mk~GD~~ffYHS~~~~pgIvGiaeV~~~~   80 (176)
T 3eop_A            1 MSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEA   80 (176)
T ss_dssp             -CEEEEEEBSSCCBSSSSBCBCCSHHHHTSGGGEEECCCCCCHHHHHHHHHCCTTCEEEEEECCSSSCEEEEEEEEEEEE
T ss_pred             CCEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCEEEEEEEEEEEC
T ss_conf             96022522788765567656365999986568898778815399999998654678899985378886368999999714


Q ss_pred             CCCCCC-------------CCCCCEEEEECHHHCCCCCCCCHHHHHCCC--------CCCCCCCCCCCCCCEEECCHHHH
Q ss_conf             667764-------------456722798503221079975888984082--------01146010057455011689999
Q gi|254781040|r   71 YPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP--------RLSSMILIVSSRLSVQPVTTDEY  129 (143)
Q Consensus        71 y~d~t~-------------~~~p~W~~VdVk~~~~l~~pVsL~~lK~~~--------~L~~m~Llk~~RLSV~PVt~~ew  129 (143)
                      |||+|+             +++|+|+||||+|+++|++||+|++||+++        +|++|.|+||+||||+|||++||
T Consensus        81 ypD~ta~dp~s~YyD~ks~~e~prW~~VdV~~~~k~~~pv~L~~lK~~~~~~~~~~~aL~~m~L~r~~RLSV~PVt~~ew  160 (176)
T 3eop_A           81 YPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEF  160 (176)
T ss_dssp             EECGGGTCTTSTTCCTTCCTTSCSCEEEEEEEEEEEEEEEEHHHHHHHHHHHHHHTCTTSSCHHHHCTTCSEEEECHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCEECHHHHHHCHHHCCCCCCCCCCCEEEECCCCCEEECCHHHH
T ss_conf             55785546666645876656699779999998043487043999863721113456630158142058552564699999


Q ss_pred             HHHHHHCCCCCCC
Q ss_conf             9999972799989
Q gi|254781040|r  130 LEVCRMGKLSNPP  142 (143)
Q Consensus       130 ~~I~~L~~~~~p~  142 (143)
                      ++||+|+++.+..
T Consensus       161 ~~I~~l~~~~~~~  173 (176)
T 3eop_A          161 DFVLSLEELEHHH  173 (176)
T ss_dssp             HHHHHGGGCC---
T ss_pred             HHHHHHHCCCCCC
T ss_conf             9999987774434


No 2  
>>1zce_A Hypothetical protein ATU2648; alpha-beta protein., structural genomics, PSI, protein structure initiative; 1.30A {Agrobacterium tumefaciens str} (A:)
Probab=100.00  E-value=0  Score=414.67  Aligned_cols=142  Identities=63%  Similarity=1.122  Sum_probs=140.2

Q ss_pred             CCCCEECCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCCEEEEEECCCCCCCCCCCCCC
Q ss_conf             97450011588667789985868887777765899999998538897899994588876348888604466677644567
Q gi|254781040|r    1 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSS   80 (143)
Q Consensus         1 M~yWL~KsEP~~~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~~~~ivgi~~v~~~~y~d~t~~~~p   80 (143)
                      |+||||||||++|||+|+.++++++++||||||||||||||+|++||+||||||||+|+|||+++|++++|+|+|++|+|
T Consensus         2 m~YWLlKsEP~~~S~ddl~~~~~~~t~WdGvrN~qarn~lr~mk~GD~~~fYhS~~~~~IvGiaeV~~~~ypD~t~~d~p   81 (155)
T 1zce_A            2 ANYWLYKSEPFKWSWEXQKAKGETGEEWTGVRNYQARNNXRAXKIGDKGFFYHSNEGLDVVGIVEVCALSHPDSTAEGDL   81 (155)
T ss_dssp             CCEEEEEECTTTSCHHHHHHHGGGCEECCCCCCHHHHHHHHTCCTTCEEEEEETTTTCEEEEEEEEEEEEEECTTSTTCS
T ss_pred             CCEEEEECCCCCCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCEEEEEEECCCCCCCCCCCCC
T ss_conf             86537504898789999986589888656715399999999654788899995078877417886401346777657798


Q ss_pred             CEEEEECHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCEEECCHHHHHHHHHHCCCCCCC
Q ss_conf             22798503221079975888984082011460100574550116899999999972799989
Q gi|254781040|r   81 CWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPP  142 (143)
Q Consensus        81 ~W~~VdVk~~~~l~~pVsL~~lK~~~~L~~m~Llk~~RLSV~PVt~~ew~~I~~L~~~~~p~  142 (143)
                      +|+||||+|+++|++||+|++||+++.|++|.|+||+||||+|||++||++||+||+++.|.
T Consensus        82 ~w~~Vdv~~~~~~~~pv~L~~lK~~p~L~~m~llr~~RLSV~pVt~~ew~~I~~l~~~~~p~  143 (155)
T 1zce_A           82 KWDCVDIRAVCDXPQPVSLKDVKANPKLEKXSLVTSXRLSVQPVTEEEYLEVCRXGGLANPP  143 (155)
T ss_dssp             SCEEEEEEEEEEEEEEEEHHHHHHCGGGTTCHHHHCSSCSEEEECHHHHHHHHHHTTCSSCC
T ss_pred             CEEEEEEEECCCCCCEEEHHHHHCCCCHHHCCCHHCCCCCEEECCHHHHHHHHHHCCCCCCC
T ss_conf             75899778802379711199973587752196323382265966999999999963999998


No 3  
>>2ar1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.60A {Leishmania major} (A:)
Probab=100.00  E-value=0  Score=384.14  Aligned_cols=140  Identities=41%  Similarity=0.664  Sum_probs=133.3

Q ss_pred             CCCCEECCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC-CCCCEEEEEECCCCCCCCCCC--
Q ss_conf             97450011588667789985868887777765899999998538897899994588-876348888604466677644--
Q gi|254781040|r    1 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GREIVGIFEVITCTYPDPTAE--   77 (143)
Q Consensus         1 M~yWL~KsEP~~~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~-~~~ivgi~~v~~~~y~d~t~~--   77 (143)
                      |+||||||||+.|||+|+..++.  +.||||||||||||||+|++||+|||||||| .++|||+++|++++|||+|++  
T Consensus        19 ~~YWL~KsEP~~~si~dl~~~~~--~~WdGvrNyqarn~lr~mk~GD~vlfYhS~~~~~~IvGia~V~~~~~pD~t~~d~   96 (172)
T 2ar1_A           19 IHYWLLKSEPHKFSIDDLAKQKT--SPWDGVRNYAARNNMRAMSVGDKVLFYHSNTKEPGVAGLAEVVRLAYDDFTALDK   96 (172)
T ss_dssp             CCEEEEEECTTTSCHHHHHHHSE--EECCCCCCHHHHHHHHHCCTTCEEEEEECSSSSCEEEEEEEEEEEEEECGGGGCT
T ss_pred             CCEEEEECCCCCCCHHHHHCCCC--CCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCCEEEEEEEEECCCCCCCCCCC
T ss_conf             54567613888689999814588--7777803299999998576888899997378887147999983024566765577


Q ss_pred             -----------CCCCEEEEECHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCEEECCHHHHHHHHHHCCCCCCC
Q ss_conf             -----------56722798503221079975888984082011460100574550116899999999972799989
Q gi|254781040|r   78 -----------QSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPP  142 (143)
Q Consensus        78 -----------~~p~W~~VdVk~~~~l~~pVsL~~lK~~~~L~~m~Llk~~RLSV~PVt~~ew~~I~~L~~~~~p~  142 (143)
                                 ++|+|++|||+|+++|++||+|++||+++.|++|.|+||+||||+|||++||++|++|++..+|+
T Consensus        97 ~~~y~Dpks~~~~p~w~~V~v~~~~~l~~pV~L~~LK~~~~l~~m~llr~~RLSv~pVt~~e~~~I~~L~~~~~p~  172 (172)
T 2ar1_A           97 TSEYFDPKATKEKNPWKMVDVKFVARWDTVLTLHELKSRRELQKMALFTQRRLSVQPVSASEYAYILRMNEEQQRK  172 (172)
T ss_dssp             TSTTCCTTCCSSCCCCEEEEEEEEEEEEEEEEHHHHTTCGGGTTCHHHHCSSCSEEEECHHHHHHHHHHHHHHTC-
T ss_pred             CCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCHHHHHCCCCCCCCCEEECCCCCEEECCHHHHHHHHHHHCCCCCC
T ss_conf             7651475455678876899998700148862799986596712294420486775655999999999976645579


No 4  
>>2gbs_A Hypothetical protein RPA0253; alpha-beta, RPR3, NESG, structural genomics, COG2947, PSI, protein structure initiative; NMR {Rhodopseudomonas palustris CGA009} (A:)
Probab=100.00  E-value=0  Score=375.33  Aligned_cols=141  Identities=57%  Similarity=0.951  Sum_probs=137.1

Q ss_pred             CCCCEECCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCCEEEEEECCCCCCCCCCCCCC
Q ss_conf             97450011588667789985868887777765899999998538897899994588876348888604466677644567
Q gi|254781040|r    1 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSS   80 (143)
Q Consensus         1 M~yWL~KsEP~~~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~~~~ivgi~~v~~~~y~d~t~~~~p   80 (143)
                      |+||||||||+.|||+|+.+++++++.||||||||||||||+||+||+||||||||+++|||+++|++++|+|+|+ .+|
T Consensus         1 M~YWl~kseP~~~si~d~~~~~~~~t~W~Gvrn~~ar~~lr~mk~GD~vlfYhS~~~~gIvGi~eV~~~~~~d~t~-~d~   79 (145)
T 2gbs_A            1 VAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFYYHSNEGKEIVGIAEIIREAYPDPTD-ASG   79 (145)
T ss_dssp             CCEEEEEECTTTSCHHHHHTTTTTCEECCCCCCHHHHHHHHHCCTTCEEEEEETTTTCEEEEEEEEEEEEEECTTC-TTS
T ss_pred             CCEEEECCCCCCCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCEEEEEEECCCCCCCCC-CCC
T ss_conf             9505102489878999998768988867771549999999975047888998638888735775410025667666-666


Q ss_pred             CEEEEECHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCEEECCHHHHHHHHHHCCCCCCC
Q ss_conf             22798503221079975888984082011460100574550116899999999972799989
Q gi|254781040|r   81 CWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPP  142 (143)
Q Consensus        81 ~W~~VdVk~~~~l~~pVsL~~lK~~~~L~~m~Llk~~RLSV~PVt~~ew~~I~~L~~~~~p~  142 (143)
                      +|++|||+|+++|++||+|++||.+++|++|.|+|++||||+|||++||++||+|+++.++.
T Consensus        80 ~~~~V~v~~~~~l~~pi~L~~LK~~~~L~~m~l~r~~rlSv~pVt~~e~~~I~~L~~~~~~~  141 (145)
T 2gbs_A           80 KFVCVDIKADKPLKTPVTLAAVKAEPRLADMALMKYSRLSVQPVTAEEWKLVCKMGGLLEHH  141 (145)
T ss_dssp             CSEEEEEEEEEEEEEEEEHHHHHHCTTGGGSHHHHCTTCSSEEECHHHHHHHHHHTTCCCCT
T ss_pred             CCEEEECCCCCCCCCCEEHHHHHCCCCCCCCCEEECCCCCEEECCHHHHHHHHHHCCCCHHC
T ss_conf             84566654366044540199961476513586000387662207999999999862955101


No 5  
>>2eve_A Hypothetical protein pspto5229; alpha-beta protein, structural genomics, PSI, protein structure initiative; HET: MPO; 1.60A {Pseudomonas syringae PV} (A:)
Probab=100.00  E-value=0  Score=375.89  Aligned_cols=140  Identities=39%  Similarity=0.636  Sum_probs=132.0

Q ss_pred             CCCCEECCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC-CCCCEEEEEECCCCCCCCCC---
Q ss_conf             97450011588667789985868887777765899999998538897899994588-87634888860446667764---
Q gi|254781040|r    1 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GREIVGIFEVITCTYPDPTA---   76 (143)
Q Consensus         1 M~yWL~KsEP~~~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~-~~~ivgi~~v~~~~y~d~t~---   76 (143)
                      .+||||||||+.|||+|+.+++.  ++||||||||||||||+|++||+|||||||| .++|||+++|++++|||+|+   
T Consensus         1 ~aYWLlKseP~~~si~dl~~~~~--~~WdGvrn~qarn~lr~mk~GD~vlfYhS~~~~~~IvGiaeV~~~~~pD~t~~d~   78 (157)
T 2eve_A            1 XAYWLXKSEPDEFSISDLQRLGK--ARWDGVRNYQARNFLRTXAEGDEFFFYHSSCPEPGIAGIGKIVKTAYPDPTALDP   78 (157)
T ss_dssp             -CEEEEEECTTTSCHHHHHHHSE--EEECCCCCHHHHHHHHHCCTTCEEEEEECSSSSCEEEEEEEEEEEEEECGGGGCT
T ss_pred             CCCCCEECCCCCCCHHHHHHCCC--CCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCEEEEEEEEEECCCCCCCCCCC
T ss_conf             96001204888589999986499--8766717799999998644788899996689987057999998724357865468


Q ss_pred             ----------CCCCCEEEEECHHHCCCCCCCCHHHHHCCCCCCCCCCCC-CCCCCEEECCHHHHHHHHHHCCCCCCC
Q ss_conf             ----------456722798503221079975888984082011460100-574550116899999999972799989
Q gi|254781040|r   77 ----------EQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKLSNPP  142 (143)
Q Consensus        77 ----------~~~p~W~~VdVk~~~~l~~pVsL~~lK~~~~L~~m~Llk-~~RLSV~PVt~~ew~~I~~L~~~~~p~  142 (143)
                                .++|+|+||||+|+++|++||+|++||+++.|++|.|+| ++||||+|||++||++||+|++..+|.
T Consensus        79 ~~~y~d~ks~~~~p~w~~V~v~~~~~~~~pv~L~~LK~~~~L~~m~llr~~~RLSV~pvt~~e~~~I~~l~~~~~~~  155 (157)
T 2eve_A           79 DSHYHDAKATTEKNPWSALDIGFVDIFKNVLGLGYLKQQSQLEQLPLVQKGSRLSVXPVTAEQWAAILALRLEHHHH  155 (157)
T ss_dssp             TSTTCCTTCCSSCCCCEEEEEEEEEEEEEEEEHHHHHTCGGGTTCGGGSTTCCCSEEEECHHHHHHHHHHHC-----
T ss_pred             CCCEECCCCCCCCCCEEEEEEEECCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHCCC
T ss_conf             74244155556789735999886111588636999852926143832025786675566999999999876545425


No 6  
>>2p5d_A UPF0310 protein mjecl36; NPPSFA, national project on protein structural and functional analyses; 1.70A {Methanocaldococcus jannaschii} (A:)
Probab=100.00  E-value=4.4e-35  Score=230.03  Aligned_cols=121  Identities=20%  Similarity=0.372  Sum_probs=104.5

Q ss_pred             CCCCEECCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC------CCCCEEEEEECCCCCCCC
Q ss_conf             97450011588667789985868887777765899999998538897899994588------876348888604466677
Q gi|254781040|r    1 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK------GREIVGIFEVITCTYPDP   74 (143)
Q Consensus         1 M~yWL~KsEP~~~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~------~~~ivgi~~v~~~~y~d~   74 (143)
                      |+|||+|+||+.|++.. +.  ..++.||||||||||     ||+||++|||||+.      .++|||+++|++++|+|+
T Consensus         4 ~~YWL~k~ep~~~~~~~-~~--~~~~~~~gvrn~~ar-----mk~GD~~~fY~s~~~~~~~~~~~ivgi~~V~~~~~~D~   75 (147)
T 2p5d_A            4 MAYWLCITNEDNWKVIK-EK--KIWGVAERYKNTINK-----VKVGDKLIIYEIQRSGKDYKPPYIRGVYEVVSEVYKDS   75 (147)
T ss_dssp             CCEEEEEECHHHHHHHH-HH--CEEEECGGGHHHHTT-----CCTTCEEEEEECCBCSTTCBCCEEEEEEEECSCCEECC
T ss_pred             HHHEEECCCHHHHHHHH-HC--CEEECCCCCHHHHHH-----CCCCCEEEEEECCCCCCCCCCCEEEEEEEEECCEEECC
T ss_conf             43120107899999999-78--988625766407865-----78987799996465688766526999999956516326


Q ss_pred             CCC--------CCCCEEEEECHHHCCCCCCCCHHHHHCCCCCCCCCCCC-CCCCCE-------EECCHHHHHHHHH
Q ss_conf             644--------56722798503221079975888984082011460100-574550-------1168999999999
Q gi|254781040|r   75 TAE--------QSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIV-SSRLSV-------QPVTTDEYLEVCR  134 (143)
Q Consensus        75 t~~--------~~p~W~~VdVk~~~~l~~pVsL~~lK~~~~L~~m~Llk-~~RLSV-------~PVt~~ew~~I~~  134 (143)
                      |+.        ++++|++|+|+++.+|++||+|.+|+     ++|.+++ ++|||+       +|||+++|++|+.
T Consensus        76 t~~~~d~~~~~~~~~~~~v~v~~~~~~~~pv~l~~l~-----~~l~~i~~~~rls~~~r~~~~~pV~~~d~~~I~~  146 (147)
T 2p5d_A           76 SKIFKPTPRNPNEKFPYRVKLKEIKVFEPPINFKELI-----PKLKFITNKKRWSGHLMGKAMREIPEEDYKLIVG  146 (147)
T ss_dssp             CCCSCCBTTBTTCCCCEEEEEEEEEEEEEEEEHHHHG-----GGCTTCCCSSSCCC--CCCSEEEECHHHHHHHHT
T ss_pred             CCCCCCCCCCCCCEEEEEEEEEEEEECCCCCCHHHHH-----HHHHHHCCCCCCHHHHHCCCCCCCCHHHHHHHHC
T ss_conf             7566552114686677998714531036861277778-----7888612830074887358773569888888744


No 7  
>>2hd9_A UPF0310 protein PH1033; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: CIT; 1.35A {Pyrococcus horikoshii OT3} (A:)
Probab=97.89  E-value=1.6e-05  Score=53.76  Aligned_cols=120  Identities=21%  Similarity=0.402  Sum_probs=78.4

Q ss_pred             CCCCEECCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC--C------CCCEEEEEECCCCCC
Q ss_conf             97450011588667789985868887777765899999998538897899994588--8------763488886044666
Q gi|254781040|r    1 MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK--G------REIVGIFEVITCTYP   72 (143)
Q Consensus         1 M~yWL~KsEP~~~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~--~------~~ivgi~~v~~~~y~   72 (143)
                      |+|||.=+..+-+-+--  ..|-    | || +.-.+|-++.||+||..+||-+..  +      ..++|+++|+++.|.
T Consensus         1 m~yWl~v~s~e~~~~~~--~~g~----~-~v-~~gk~~~l~rikpGD~li~Y~~~~~~~~~~~~~q~f~Ai~~V~~e~yq   72 (145)
T 2hd9_A            1 MTYWICITNRENWEVIK--RHNV----W-GV-PKKHKNTLSRVKPGDKLVIYVRQEKDKEGNLLEPKIVGIYEVTSEPYV   72 (145)
T ss_dssp             CCEEEEEECHHHHHHHH--HHCE----E-EE-CGGGHHHHTTCCTTCEEEEEECCEECTTCCEECCEEEEEEEECSCCEE
T ss_pred             CCEEEECCCHHHHHHHH--HCCE----E-EC-CCCCHHHHHHCCCCCEEEEEECCCCCCCCCCCCCEEEEEEEEECCCEE
T ss_conf             92488607999999999--6888----8-52-576553786178888799995542468886456279999999043300


Q ss_pred             CCCC-------CCCCCEEEEECHHHCCCCCCCCHHHHHCCCCCCCCCCCCCC-------CCC-EEECCHHHHHHHHHH
Q ss_conf             7764-------45672279850322107997588898408201146010057-------455-011689999999997
Q gi|254781040|r   73 DPTA-------EQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSS-------RLS-VQPVTTDEYLEVCRM  135 (143)
Q Consensus        73 d~t~-------~~~p~W~~VdVk~~~~l~~pVsL~~lK~~~~L~~m~Llk~~-------RLS-V~PVt~~ew~~I~~L  135 (143)
                      |.+.       .+.-.=+-++|+++.....|+.       +.+..|..++..       |-+ ..||+++-++.|.+.
T Consensus        73 ~~~~i~~~~~~~~~~~P~R~~v~~~~~~evpi~-------pL~~~L~fi~~k~~Wg~~~r~~g~~~I~~~D~~lI~~~  143 (145)
T 2hd9_A           73 DFSRIFKPHRGGKETYPYRVKIKPIKIGEINFK-------PLINDLKFIKNKKRWSMHFFGKAMRELPEEDYKLIEKL  143 (145)
T ss_dssp             CCCCCSCCTTSSCCCCCEEEEEEEEEEEEEESG-------GGGGGCTTCCCSTTGGGGTTTCSEEEECHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCEEEEEEEEEEEEECCCCHH-------HHHHHHHHCCCCHHHHHHHHCCCCEECCHHHHHHHHHH
T ss_conf             266246654468753678999567651540278-------97866655028400106765486533699999999997


No 8  
>>2kku_A Uncharacterized protein; alpha/beta protein, structural genomics, PSI-2, protein structure initiative; NMR {Archaeoglobus fulgidus} (A:)
Probab=80.89  E-value=2.3  Score=22.99  Aligned_cols=58  Identities=17%  Similarity=0.385  Sum_probs=40.3

Q ss_pred             HHCCCCCEEEEEECCCCCCCEEEEEECCCCCCCCC---------------------------------CCCCCCEEEEEC
Q ss_conf             85388978999945888763488886044666776---------------------------------445672279850
Q gi|254781040|r   41 RKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPT---------------------------------AEQSSCWECVDI   87 (143)
Q Consensus        41 r~Mk~GD~~~fYHS~~~~~ivgi~~v~~~~y~d~t---------------------------------~~~~p~W~~VdV   87 (143)
                      +..+.|-.++||-|....|.||-|+|-+-...+..                                 ....-.|.+..+
T Consensus        57 k~l~pGmkviFYaS~Ed~G~~GEA~Ik~V~~~~~~~ei~ekygd~vFLT~EE~k~Y~kd~~rw~~r~~~~rkrpwmvl~L  136 (161)
T 2kku_A           57 KELKPGMKFVFYQSHEDTGFVGEARIKRVVLSENPMQFFETFGDRVFLTKDELKEYMKSQERWGRRRESKKKKLWMAIEL  136 (161)
T ss_dssp             TTCCTTEEEEECCCSTTCBCCEEEEEEEEEEESCTHHHHHHTSTTBSSCHHHHHHHHHHHHHTSSCCCCSSCCCEEEEEE
T ss_pred             HHHCCCCEEEEEEECCCCCEEEEEEEEEEEECCCHHHHHHHHCCEEEECHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEE
T ss_conf             76188848999972133550524899998850798999998386055179999999875232476566666785699994


Q ss_pred             HHHCCCCCCCC
Q ss_conf             32210799758
Q gi|254781040|r   88 CAVCSMPCPVS   98 (143)
Q Consensus        88 k~~~~l~~pVs   98 (143)
                      +-+++.+++|-
T Consensus       137 e~IrKY~rvvK  147 (161)
T 2kku_A          137 EDVKKYDKPIK  147 (161)
T ss_dssp             EEEEECCSCBC
T ss_pred             CCCHHCCCCCC
T ss_conf             25000676578


No 9  
>>2p1g_A Putative xylanase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.80A {Bacteroides fragilis YCH46} (A:)
Probab=79.82  E-value=2  Score=23.43  Aligned_cols=38  Identities=13%  Similarity=0.097  Sum_probs=28.8

Q ss_pred             CCCCCCCHHHHHHHHHCCCCCEEEEEECCCCC--CCEEEE
Q ss_conf             77776589999999853889789999458887--634888
Q gi|254781040|r   27 AWTGVRNYQARNNMRKMRVGDKGFFYHSNKGR--EIVGIF   64 (143)
Q Consensus        27 ~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~~~--~ivgi~   64 (143)
                      .+.+-|+...+-..-+++.||++||+..+.+.  .=|||+
T Consensus       156 i~~~pr~~~~q~~~~~~~pGDLvff~~~~~~~~i~HVgIy  195 (249)
T 2p1g_A          156 VHYLPKDKLEPDGLPWIKNGDIIALTTNTPGLDVSHMGIA  195 (249)
T ss_dssp             EECEEGGGCCTTCCTTSCTTCEEEEEECSTTCSEEEEEEE
T ss_pred             EEECCHHHHHHHHHHHCCCCCEEEEEECCCCCEEEEEEEE
T ss_conf             7868689963988841788788999936899805667899


No 10 
>>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural genomics consortium, SGC; HET: SAM; 2.50A {Homo sapiens} (A:1-73)
Probab=55.15  E-value=13  Score=18.59  Aligned_cols=27  Identities=7%  Similarity=0.129  Sum_probs=19.0

Q ss_pred             HCCCCCEEEEEECCCCCCCEEEEEECC
Q ss_conf             538897899994588876348888604
Q gi|254781040|r   42 KMRVGDKGFFYHSNKGREIVGIFEVIT   68 (143)
Q Consensus        42 ~Mk~GD~~~fYHS~~~~~ivgi~~v~~   68 (143)
                      -|+.||+|++|+++..-.++-.+++.+
T Consensus         9 ~i~eGD~Vll~~~~k~~~~~~~~~l~~   35 (73)
T 2b25_A            9 PFQAGELILAETGEGETKFKKLFRLNN   35 (73)
T ss_dssp             CCCTTCEEEEEC----CCCEEEEECCS
T ss_pred             CCCCCCEEEEEECCCCEEEEEEEEECC
T ss_conf             888998899992788626887799558


No 11 
>>2im9_A Hypothetical protein; structural genomics, PSI-2, protein structure initiative; 1.67A {Legionella pneumophila subsp} (A:)
Probab=54.50  E-value=7.8  Score=19.86  Aligned_cols=17  Identities=12%  Similarity=-0.031  Sum_probs=13.9

Q ss_pred             HH-HCCCCCEEEEEECCC
Q ss_conf             98-538897899994588
Q gi|254781040|r   40 MR-KMRVGDKGFFYHSNK   56 (143)
Q Consensus        40 lr-~Mk~GD~~~fYHS~~   56 (143)
                      .+ +++.||++||+.++.
T Consensus       237 ~~~~LkpGDLIff~t~~~  254 (333)
T 2im9_A          237 LFSQIPNGAVIEIIRPNW  254 (333)
T ss_dssp             HHTTSCTTCEEEEEEEEE
T ss_pred             HHHCCCCCCEEEEEECCC
T ss_conf             984289988899990675


No 12 
>>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} (A:)
Probab=46.12  E-value=8.7  Score=19.60  Aligned_cols=15  Identities=27%  Similarity=0.450  Sum_probs=11.2

Q ss_pred             CEEEEEECCCCCCCE
Q ss_conf             789999458887634
Q gi|254781040|r   47 DKGFFYHSNKGREIV   61 (143)
Q Consensus        47 D~~~fYHS~~~~~iv   61 (143)
                      -.+.|||.+|+--+-
T Consensus         3 skaiFYHAGCpVCVs   17 (80)
T 2k8s_A            3 SKAIFYHAGCPVCVS   17 (80)
T ss_dssp             EEEEEEECSCHHHHH
T ss_pred             CEEEEEECCCCEEEE
T ss_conf             514898479974610


No 13 
>>3h41_A NLP/P60 family protein; NP_979181.1, NLPC/P60 family protein, structural genomics, joint center for structural genomics, JCSG; HET: DGL PG4; 1.79A {Bacillus cereus atcc 10987} (A:185-311)
Probab=42.43  E-value=12  Score=18.71  Aligned_cols=24  Identities=25%  Similarity=0.443  Sum_probs=16.7

Q ss_pred             HHCCCCCEEEEEECCC--CCCCEEEE
Q ss_conf             8538897899994588--87634888
Q gi|254781040|r   41 RKMRVGDKGFFYHSNK--GREIVGIF   64 (143)
Q Consensus        41 r~Mk~GD~~~fYHS~~--~~~ivgi~   64 (143)
                      .++++||++||.....  ...-|||.
T Consensus        64 ~~~~pGDliff~~~~~~~~~~HVgiy   89 (127)
T 3h41_A           64 EHLQKGDLIFFAHDQGKGSVHHVAXY   89 (127)
T ss_dssp             GGCCTTCEEEEEHHHHTSCEEEEEEE
T ss_pred             HCCCCCCEEEEECCCCCCCCEEEEEE
T ss_conf             00899888998178889997599999


No 14 
>>1ztc_A Hypothetical protein TM0894; structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE; 2.10A {Thermotoga maritima} (A:135-221)
Probab=35.46  E-value=22  Score=17.22  Aligned_cols=27  Identities=22%  Similarity=0.219  Sum_probs=24.7

Q ss_pred             CCCCHHHHHHHHHCCCCCEEEEEECCC
Q ss_conf             765899999998538897899994588
Q gi|254781040|r   30 GVRNYQARNNMRKMRVGDKGFFYHSNK   56 (143)
Q Consensus        30 GVRNyqArn~lr~Mk~GD~~~fYHS~~   56 (143)
                      |-||-+|.+|+|....-|...|=|-..
T Consensus        54 g~r~de~~~fv~~v~k~D~lVFtHD~p   80 (87)
T 1ztc_A           54 GYGSVQVKNFLDRVGRIDLLVFPHDAP   80 (87)
T ss_dssp             TCSCHHHHHHHHHHCCCSEEECSSSCC
T ss_pred             CCCHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             840999999998776199899199987


No 15 
>>2wrg_I Hemagglutinin HA2 chain; viral protein, envelope protein, glycoprotein, lipoprotein; HET: NAG SIA GAL; 3.00A {Influenza a virus} PDB: 2wrh_I* (I:67-143)
Probab=34.81  E-value=12  Score=18.69  Aligned_cols=19  Identities=26%  Similarity=0.817  Sum_probs=15.1

Q ss_pred             HHHHHHH--HCCCCCEEE-EEE
Q ss_conf             9999998--538897899-994
Q gi|254781040|r   35 QARNNMR--KMRVGDKGF-FYH   53 (143)
Q Consensus        35 qArn~lr--~Mk~GD~~~-fYH   53 (143)
                      +.|..||  ++-.|..|| |||
T Consensus        55 kvr~qLr~NA~e~GnGCFe~~H   76 (77)
T 2wrg_I           55 KVKSQLKNNAKEIGNGCFEFYH   76 (77)
T ss_dssp             HHHHHHGGGEEECSSSEEEESS
T ss_pred             HHHHHHHHHHHHHCCCHHHHHH
T ss_conf             9999974115662776303342


No 16 
>>1yel_A AT1G16640; CESG, protein structure initiative, structural genomics, center for eukaryotic structural genomics, unknown function; NMR {Arabidopsis thaliana} (A:)
Probab=29.40  E-value=44  Score=15.38  Aligned_cols=29  Identities=17%  Similarity=0.129  Sum_probs=19.9

Q ss_pred             HHHHHH--CCCCCEEEEEECCCCCCCEEEEE
Q ss_conf             999985--38897899994588876348888
Q gi|254781040|r   37 RNNMRK--MRVGDKGFFYHSNKGREIVGIFE   65 (143)
Q Consensus        37 rn~lr~--Mk~GD~~~fYHS~~~~~ivgi~~   65 (143)
                      +.|-++  .+.||.|+|++.....--|.|.+
T Consensus        70 ~~Fv~~n~L~~GD~~~F~~~~~~~~~V~I~~  100 (104)
T 1yel_A           70 ENFVKDNNLEDGKYLQFIYDRDRTFYVIIYG  100 (104)
T ss_dssp             HHHHHHHTCCTTCEEEEEECSSSEEEEEEEC
T ss_pred             HHHHHHCCCCCCEEEEEEECCCCEEEEEEEC
T ss_conf             8999975985363899999789789999978


No 17 
>>3bij_A Uncharacterized protein GSU0716; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.50A {Geobacter sulfurreducens pca} (A:)
Probab=26.85  E-value=49  Score=15.11  Aligned_cols=22  Identities=18%  Similarity=0.185  Sum_probs=17.1

Q ss_pred             HHHHHHHCCCCCEEEEEECCCC
Q ss_conf             9999985388978999945888
Q gi|254781040|r   36 ARNNMRKMRVGDKGFFYHSNKG   57 (143)
Q Consensus        36 Arn~lr~Mk~GD~~~fYHS~~~   57 (143)
                      -+.+.+..+.||.+|||-|+-+
T Consensus        64 l~~l~~~~~~~D~~~~yfsGHG   85 (285)
T 3bij_A           64 IGKAAKALGKGDIFXLSYSGHG   85 (285)
T ss_dssp             HHHHHHHCCTTCEEEEEEESCE
T ss_pred             HHHHHHHCCCCCEEEEEEECCC
T ss_conf             9999986657987999993475


No 18 
>>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus HB27} (A:1-64)
Probab=21.75  E-value=34  Score=16.07  Aligned_cols=14  Identities=7%  Similarity=-0.083  Sum_probs=12.1

Q ss_pred             CCCCCEEEEEECCC
Q ss_conf             38897899994588
Q gi|254781040|r   43 MRVGDKGFFYHSNK   56 (143)
Q Consensus        43 Mk~GD~~~fYHS~~   56 (143)
                      ++.||+|++|++..
T Consensus         4 i~~GD~Vil~~~~~   17 (64)
T 2pwy_A            4 MAWPGPLLLKDRKG   17 (64)
T ss_dssp             ----CCEEEECTTC
T ss_pred             CCCCCCEEEEECCC
T ss_conf             66687589996899


Done!