BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781040|ref|YP_003065453.1| hypothetical protein
CLIBASIA_04710 [Candidatus Liberibacter asiaticus str. psy62]
         (143 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781040|ref|YP_003065453.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040717|gb|ACT57513.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 143

 Score =  300 bits (767), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 143/143 (100%), Positives = 143/143 (100%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI
Sbjct: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS
Sbjct: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVTTDEYLEVCRMGKLSNPPL
Sbjct: 121 VQPVTTDEYLEVCRMGKLSNPPL 143


>gi|315122379|ref|YP_004062868.1| hypothetical protein CKC_03155 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495781|gb|ADR52380.1| hypothetical protein CKC_03155 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 148

 Score =  249 bits (637), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 126/143 (88%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  WSWKMQQDKG +GEAWTGVRNYQARNNMRKMR+GDKGFFYHSNKGREI
Sbjct: 1   MAYWLVKSEPCVWSWKMQQDKGSIGEAWTGVRNYQARNNMRKMRIGDKGFFYHSNKGREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGIFEVIT TYPDPT E  S WECVDI +VCSMPCPVSL+AIK N +LS M L+  SRLS
Sbjct: 61  VGIFEVITGTYPDPTVEGYSPWECVDIRSVCSMPCPVSLVAIKGNLQLSKMALVTFSRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPV  DEYLEVCRMGKLS+PPL
Sbjct: 121 VQPVKLDEYLEVCRMGKLSSPPL 143


>gi|325294017|ref|YP_004279881.1| hypothetical protein AGROH133_08872 [Agrobacterium sp. H13-3]
 gi|325061870|gb|ADY65561.1| hypothetical protein AGROH133_08872 [Agrobacterium sp. H13-3]
          Length = 147

 Score =  209 bits (532), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 96/140 (68%), Positives = 111/140 (79%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL KSEP +WSW+MQ+ KG  GE WTGVRNYQARNNMR M++GDKGFFYHSN+G ++VG
Sbjct: 4   YWLYKSEPFKWSWEMQKAKGEAGEEWTGVRNYQARNNMRAMKIGDKGFFYHSNEGLDVVG 63

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           I EV   ++PD TAE    W+CVDI AVC MP PVSL  +KANP+L  M L+ S RLSVQ
Sbjct: 64  IVEVCALSHPDSTAEGDLKWDCVDIRAVCDMPKPVSLKDVKANPKLEKMSLVTSMRLSVQ 123

Query: 123 PVTTDEYLEVCRMGKLSNPP 142
           PVT +EYLEVCRMG LSNPP
Sbjct: 124 PVTEEEYLEVCRMGGLSNPP 143


>gi|222087472|ref|YP_002546009.1| hypothetical protein Arad_4351 [Agrobacterium radiobacter K84]
 gi|221724920|gb|ACM28076.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 143

 Score =  208 bits (529), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 98/143 (68%), Positives = 111/143 (77%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEPS WSW+ Q+D G  G AWTGVRNY ARNNMR M++GDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPSSWSWQQQKDAGSEGTAWTGVRNYLARNNMRTMQIGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TA+    W+CVDI AV  MP PVSL  IKANP+LS M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDATAKDDPRWDCVDIRAVRDMPKPVSLKDIKANPKLSQMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT DEYLEVCRMG+L NPP+
Sbjct: 121 VQPVTDDEYLEVCRMGELDNPPV 143


>gi|15889904|ref|NP_355585.1| hypothetical protein Atu2648 [Agrobacterium tumefaciens str. C58]
 gi|15157855|gb|AAK88370.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 147

 Score =  208 bits (529), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 95/140 (67%), Positives = 111/140 (79%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL KSEP +WSW+MQ+ KG  GE WTGVRNYQARNNMR M++GDKGFFYHSN+G ++VG
Sbjct: 4   YWLYKSEPFKWSWEMQKAKGETGEEWTGVRNYQARNNMRAMKIGDKGFFYHSNEGLDVVG 63

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           I EV   ++PD TAE    W+CVDI AVC MP PVSL  +KANP+L  M L+ S RLSVQ
Sbjct: 64  IVEVCALSHPDSTAEGDLKWDCVDIRAVCDMPQPVSLKDVKANPKLEKMSLVTSMRLSVQ 123

Query: 123 PVTTDEYLEVCRMGKLSNPP 142
           PVT +EYLEVCRMG L+NPP
Sbjct: 124 PVTEEEYLEVCRMGGLANPP 143


>gi|15966828|ref|NP_387181.1| hypothetical protein SMc03227 [Sinorhizobium meliloti 1021]
 gi|307301656|ref|ZP_07581415.1| protein of unknown function DUF55 [Sinorhizobium meliloti BL225C]
 gi|307316320|ref|ZP_07595764.1| protein of unknown function DUF55 [Sinorhizobium meliloti AK83]
 gi|15076100|emb|CAC47654.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306898160|gb|EFN28902.1| protein of unknown function DUF55 [Sinorhizobium meliloti AK83]
 gi|306903354|gb|EFN33943.1| protein of unknown function DUF55 [Sinorhizobium meliloti BL225C]
          Length = 143

 Score =  202 bits (514), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 111/142 (78%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP++WSW+MQ+D G  G  WTGVRNY ARNNMR M++GDKGFFYHSN+G EI
Sbjct: 1   MAFWLYKSEPAKWSWQMQKDAGEKGTEWTGVRNYLARNNMRAMKIGDKGFFYHSNEGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE  + W+CVDI AV  +P PVSL  IK NP+L+ M L+ S RLS
Sbjct: 61  VGITEVCALSHPDSTAEGDARWDCVDIRAVMDIPRPVSLKEIKENPKLAKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE++EVCRMG L NPP
Sbjct: 121 VQPVTDDEWIEVCRMGGLDNPP 142


>gi|222150051|ref|YP_002551008.1| hypothetical protein Avi_4141 [Agrobacterium vitis S4]
 gi|221737033|gb|ACM37996.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 143

 Score =  200 bits (509), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 91/143 (63%), Positives = 109/143 (76%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP +WSW MQ+D G  G  WTGVRNY ARNNMR M+VGDKG FYHSN+G E+
Sbjct: 1   MAFWLYKSEPFKWSWAMQKDAGEAGTEWTGVRNYLARNNMRAMQVGDKGLFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE  + W+CVDI AV  MP PV+L  +KANP+L+ M L+ S RLS
Sbjct: 61  VGITEVCALSHPDSTAEGDARWDCVDIRAVRDMPKPVTLKDVKANPKLAQMALVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT +EY E+CRMG L NPP+
Sbjct: 121 VQPVTEEEYFEICRMGGLENPPV 143


>gi|227823728|ref|YP_002827701.1| hypothetical protein NGR_c32150 [Sinorhizobium fredii NGR234]
 gi|227342730|gb|ACP26948.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 143

 Score =  200 bits (508), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 110/142 (77%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP++WSW+MQ+D G  G  WTGVRNY ARNNMR M++GDKGFFYHSN+G EI
Sbjct: 1   MAHWLYKSEPNKWSWQMQKDAGEKGTEWTGVRNYLARNNMRAMKIGDKGFFYHSNEGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE  + W+CVDI AV  +P PVSL  IK NP L+ M L+ S RLS
Sbjct: 61  VGITEVCALSHPDSTAEGDARWDCVDIRAVRDIPRPVSLKEIKENPTLAKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE++EVCRMG L NPP
Sbjct: 121 VQPVTEDEWIEVCRMGGLDNPP 142


>gi|163757404|ref|ZP_02164493.1| hypothetical protein HPDFL43_18377 [Hoeflea phototrophica DFL-43]
 gi|162284906|gb|EDQ35188.1| hypothetical protein HPDFL43_18377 [Hoeflea phototrophica DFL-43]
          Length = 142

 Score =  199 bits (506), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W G+RNYQARNNMR M++G+KGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWDMQKAKGSEGEQWDGIRNYQARNNMRAMKLGEKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AVC MP PV+L  +KANP+L+ M L+ S RLS
Sbjct: 61  VGIVEVSALIHPDTTTDDPR-WECVDIRAVCDMPKPVTLKDVKANPKLAEMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT  EYLEVCRMG L NPP
Sbjct: 120 VQPVTEAEYLEVCRMGGLDNPP 141


>gi|150398159|ref|YP_001328626.1| hypothetical protein Smed_2962 [Sinorhizobium medicae WSM419]
 gi|150029674|gb|ABR61791.1| protein of unknown function DUF55 [Sinorhizobium medicae WSM419]
          Length = 143

 Score =  199 bits (505), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP++WSW+MQ+D G  G  WTGVRNY ARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAFWLYKSEPAKWSWQMQKDAGEKGTEWTGVRNYLARNNMRAMKIGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE  + W+CVDI AV  MP PV+L  IK NPRL++M L+ S RLS
Sbjct: 61  VGITEVCALSHPDTTAEGDARWDCVDIRAVMDMPRPVTLKEIKENPRLATMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE++EVCRMG L   P
Sbjct: 121 VQPVTEDEWVEVCRMGGLDTSP 142


>gi|292490246|ref|YP_003525685.1| hypothetical protein Nhal_0077 [Nitrosococcus halophilus Nc4]
 gi|291578841|gb|ADE13298.1| protein of unknown function DUF55 [Nitrosococcus halophilus Nc4]
          Length = 141

 Score =  197 bits (500), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M+YWL KSEPS+WSW+ Q+ KG  GE W GVRNYQARNNMR M++GDKGFFYHSNKG E+
Sbjct: 1   MSYWLFKSEPSKWSWEDQKKKGAAGEEWDGVRNYQARNNMRAMKLGDKGFFYHSNKGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T E    WECVD+ A+C MP PVSL  IKANP+L+ M L+ S+RLS
Sbjct: 61  VGIIEVCKPAHPDSTTEDPR-WECVDVRALCDMPKPVSLRKIKANPKLAKMALVTSARLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L   P
Sbjct: 120 VQPVTEDEWREVCRMGGLDPAP 141


>gi|240851349|ref|YP_002972752.1| hypothetical protein Bgr_19720 [Bartonella grahamii as4aup]
 gi|240268472|gb|ACS52060.1| hypothetical protein Bgr_19720 [Bartonella grahamii as4aup]
          Length = 144

 Score =  195 bits (495), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 108/143 (75%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPHKWSWEMQKKKGADGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T+     WECVDI A+C MP PVSL  IKANP+L++M+L+ +SRLS
Sbjct: 61  VGIVEICAEAHPDSTSSDPR-WECVDIRALCDMPTPVSLKQIKANPKLANMVLVKASRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT DE+ EVC MG L    L
Sbjct: 120 VQPVTEDEWKEVCLMGNLKREML 142


>gi|163869278|ref|YP_001610534.1| hypothetical protein Btr_2586 [Bartonella tribocorum CIP 105476]
 gi|161018981|emb|CAK02539.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 142

 Score =  195 bits (495), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 108/143 (75%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPHKWSWEMQKKKGAGGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T+     WECVDI A+C MP PVSL  IKANP+L++M+L+ +SRLS
Sbjct: 61  VGIVEICAEAHPDSTSSDPR-WECVDIRALCDMPTPVSLKQIKANPKLANMVLVNASRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT DE+ EVC MG L    L
Sbjct: 120 VQPVTEDEWKEVCLMGNLKKEML 142


>gi|66361456|pdb|1ZCE|A Chain A, X-Ray Crystal Structure Of Protein Atu2648 From
           Agrobacteriu Tumefaciens. Northeast Structural Genomics
           Consortium Targe
          Length = 155

 Score =  194 bits (494), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 89/140 (63%), Positives = 105/140 (75%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL KSEP +WSW+ Q+ KG  GE WTGVRNYQARNN R  ++GDKGFFYHSN+G ++VG
Sbjct: 4   YWLYKSEPFKWSWEXQKAKGETGEEWTGVRNYQARNNXRAXKIGDKGFFYHSNEGLDVVG 63

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           I EV   ++PD TAE    W+CVDI AVC  P PVSL  +KANP+L    L+ S RLSVQ
Sbjct: 64  IVEVCALSHPDSTAEGDLKWDCVDIRAVCDXPQPVSLKDVKANPKLEKXSLVTSXRLSVQ 123

Query: 123 PVTTDEYLEVCRMGKLSNPP 142
           PVT +EYLEVCR G L+NPP
Sbjct: 124 PVTEEEYLEVCRXGGLANPP 143


>gi|254717958|ref|ZP_05179769.1| hypothetical protein Bru83_00130 [Brucella sp. 83/13]
 gi|265982901|ref|ZP_06095636.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306838954|ref|ZP_07471778.1| Hypothetical protein BROD_1789 [Brucella sp. NF 2653]
 gi|264661493|gb|EEZ31754.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405957|gb|EFM62212.1| Hypothetical protein BROD_1789 [Brucella sp. NF 2653]
          Length = 142

 Score =  194 bits (492), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 90/139 (64%), Positives = 106/139 (76%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ +G  GE W GVRNYQARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWEMQKARGEKGEQWDGVRNYQARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AVC MP PV+L  +KANP+L  M L+ S RLS
Sbjct: 61  VGIVEVCALAHPDSTTDDPR-WECVDIKAVCDMPKPVTLKDVKANPKLQDMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE++EVCRMG L 
Sbjct: 120 VQPVTEDEWIEVCRMGGLD 138


>gi|190893749|ref|YP_001980291.1| hypothetical protein RHECIAT_CH0004184 [Rhizobium etli CIAT 652]
 gi|190699028|gb|ACE93113.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 143

 Score =  193 bits (490), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 105/142 (73%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VGDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TA+    W+CVDI AV  MP PV+L  IKAN +LS M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSTAKGDPKWDCVDIRAVMDMPKPVTLKDIKANEKLSKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|306844861|ref|ZP_07477444.1| Hypothetical protein BIBO1_1541 [Brucella sp. BO1]
 gi|306274793|gb|EFM56574.1| Hypothetical protein BIBO1_1541 [Brucella sp. BO1]
          Length = 142

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/139 (64%), Positives = 105/139 (75%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ +G  GE W GVRNYQARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWEMQKTRGEKGEQWDGVRNYQARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  MP PV+L  +KANPRL  M L+ S RLS
Sbjct: 61  VGIVEVCALAHPDSTTDDPR-WECVDIKAVRDMPKPVTLKDVKANPRLQDMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE++EVCRMG L 
Sbjct: 120 VQPVTEDEWIEVCRMGGLD 138


>gi|327188885|gb|EGE56077.1| hypothetical protein RHECNPAF_750037 [Rhizobium etli CNPAF512]
          Length = 143

 Score =  192 bits (487), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 92/142 (64%), Positives = 104/142 (73%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VGDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TA+    W+CVDI AV  MP PV+L  IKAN  LS M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSTAKGDPKWDCVDIRAVMDMPKPVTLKDIKANETLSKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|86359481|ref|YP_471373.1| hypothetical protein RHE_CH03900 [Rhizobium etli CFN 42]
 gi|86283583|gb|ABC92646.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 143

 Score =  191 bits (486), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 89/142 (62%), Positives = 105/142 (73%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VG+KGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGEKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TA+    W+CVDI AV  MP PV+L  +KAN +L+ M L+ S RLS
Sbjct: 61  VGIVEVAALSHPDSTAKGDPKWDCVDIRAVMDMPKPVTLKDVKANAKLAKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|17986456|ref|NP_539090.1| hypothetical protein BMEI0172 [Brucella melitensis bv. 1 str. 16M]
 gi|23502743|ref|NP_698870.1| hypothetical protein BR1891 [Brucella suis 1330]
 gi|62290748|ref|YP_222541.1| hypothetical protein BruAb1_1868 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700659|ref|YP_415233.1| hypothetical protein BAB1_1891 [Brucella melitensis biovar Abortus
           2308]
 gi|148560503|ref|YP_001259716.1| hypothetical protein BOV_1819 [Brucella ovis ATCC 25840]
 gi|161619808|ref|YP_001593695.1| hypothetical protein BCAN_A1934 [Brucella canis ATCC 23365]
 gi|163843915|ref|YP_001628319.1| hypothetical protein BSUIS_A1731 [Brucella suis ATCC 23445]
 gi|189024961|ref|YP_001935729.1| hypothetical protein BAbS19_I17730 [Brucella abortus S19]
 gi|225628092|ref|ZP_03786127.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225853328|ref|YP_002733561.1| hypothetical protein BMEA_A1944 [Brucella melitensis ATCC 23457]
 gi|237816254|ref|ZP_04595247.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254690036|ref|ZP_05153290.1| hypothetical protein Babob68_07676 [Brucella abortus bv. 6 str.
           870]
 gi|254694525|ref|ZP_05156353.1| hypothetical protein Babob3T_07674 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696150|ref|ZP_05157978.1| hypothetical protein Babob28_00162 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700535|ref|ZP_05162363.1| hypothetical protein Bsuib55_06736 [Brucella suis bv. 5 str. 513]
 gi|254704906|ref|ZP_05166734.1| hypothetical protein Bsuib36_13505 [Brucella suis bv. 3 str. 686]
 gi|254707579|ref|ZP_05169407.1| hypothetical protein BpinM_11556 [Brucella pinnipedialis
           M163/99/10]
 gi|254708884|ref|ZP_05170695.1| hypothetical protein BpinB_01208 [Brucella pinnipedialis B2/94]
 gi|254713692|ref|ZP_05175503.1| hypothetical protein BcetM6_10115 [Brucella ceti M644/93/1]
 gi|254715957|ref|ZP_05177768.1| hypothetical protein BcetM_05902 [Brucella ceti M13/05/1]
 gi|254731068|ref|ZP_05189646.1| hypothetical protein Babob42_07706 [Brucella abortus bv. 4 str.
           292]
 gi|256030410|ref|ZP_05444024.1| hypothetical protein BpinM2_07140 [Brucella pinnipedialis
           M292/94/1]
 gi|256045500|ref|ZP_05448383.1| hypothetical protein Bmelb1R_13431 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059868|ref|ZP_05450055.1| hypothetical protein Bneo5_05887 [Brucella neotomae 5K33]
 gi|256112226|ref|ZP_05453147.1| hypothetical protein Bmelb3E_05992 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158393|ref|ZP_05456291.1| hypothetical protein BcetM4_06030 [Brucella ceti M490/95/1]
 gi|256253812|ref|ZP_05459348.1| hypothetical protein BcetB_05872 [Brucella ceti B1/94]
 gi|256258290|ref|ZP_05463826.1| hypothetical protein Babob9C_13288 [Brucella abortus bv. 9 str.
           C68]
 gi|256263185|ref|ZP_05465717.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256370292|ref|YP_003107803.1| hypothetical protein BMI_I1912 [Brucella microti CCM 4915]
 gi|260169319|ref|ZP_05756130.1| hypothetical protein BruF5_13365 [Brucella sp. F5/99]
 gi|260546011|ref|ZP_05821751.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260562809|ref|ZP_05833295.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567620|ref|ZP_05838090.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260755572|ref|ZP_05867920.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758795|ref|ZP_05871143.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760519|ref|ZP_05872862.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884596|ref|ZP_05896210.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214843|ref|ZP_05929124.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261217720|ref|ZP_05932001.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261220945|ref|ZP_05935226.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315066|ref|ZP_05954263.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316377|ref|ZP_05955574.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321432|ref|ZP_05960629.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261323838|ref|ZP_05963035.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751039|ref|ZP_05994748.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755600|ref|ZP_05999309.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758832|ref|ZP_06002541.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265987449|ref|ZP_06100006.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991922|ref|ZP_06104479.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993653|ref|ZP_06106210.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996905|ref|ZP_06109462.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294851129|ref|ZP_06791802.1| hypothetical protein BAZG_00028 [Brucella sp. NVSL 07-0026]
 gi|297247134|ref|ZP_06930852.1| hypothetical protein BAYG_00027 [Brucella abortus bv. 5 str. B3196]
 gi|306842955|ref|ZP_07475589.1| Hypothetical protein BIBO2_2729 [Brucella sp. BO2]
 gi|17982053|gb|AAL51354.1| hypothetical protein BMEI0172 [Brucella melitensis bv. 1 str. 16M]
 gi|23348760|gb|AAN30785.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196880|gb|AAX75180.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616760|emb|CAJ11847.1| Family of unknown function DUF589 [Brucella melitensis biovar
           Abortus 2308]
 gi|148371760|gb|ABQ61739.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|161336619|gb|ABX62924.1| protein of unknown function DUF55 [Brucella canis ATCC 23365]
 gi|163674638|gb|ABY38749.1| protein of unknown function DUF55 [Brucella suis ATCC 23445]
 gi|189020533|gb|ACD73255.1| Family of unknown function DUF589 [Brucella abortus S19]
 gi|225616917|gb|EEH13964.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225641693|gb|ACO01607.1| protein of unknown function DUF55 [Brucella melitensis ATCC 23457]
 gi|237788321|gb|EEP62536.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|256000455|gb|ACU48854.1| hypothetical protein BMI_I1912 [Brucella microti CCM 4915]
 gi|260096118|gb|EEW79994.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260152825|gb|EEW87917.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260157138|gb|EEW92218.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260669113|gb|EEX56053.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260670951|gb|EEX57772.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675680|gb|EEX62501.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874124|gb|EEX81193.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916450|gb|EEX83311.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919529|gb|EEX86182.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260922809|gb|EEX89377.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294122|gb|EEX97618.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295600|gb|EEX99096.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261299818|gb|EEY03315.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261304092|gb|EEY07589.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261738816|gb|EEY26812.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261740792|gb|EEY28718.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261745353|gb|EEY33279.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262551373|gb|EEZ07363.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262764634|gb|EEZ10555.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002988|gb|EEZ15281.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093107|gb|EEZ17242.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659646|gb|EEZ29907.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294819718|gb|EFG36717.1| hypothetical protein BAZG_00028 [Brucella sp. NVSL 07-0026]
 gi|297174303|gb|EFH33650.1| hypothetical protein BAYG_00027 [Brucella abortus bv. 5 str. B3196]
 gi|306286883|gb|EFM58408.1| Hypothetical protein BIBO2_2729 [Brucella sp. BO2]
 gi|326409892|gb|ADZ66957.1| Family of unknown function DUF589 [Brucella melitensis M28]
 gi|326539605|gb|ADZ87820.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 142

 Score =  191 bits (485), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 90/139 (64%), Positives = 105/139 (75%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ +G  GE W GVRNYQARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWEMQKARGEKGEQWDGVRNYQARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  MP PV+L  +KANPRL  M L+ S RLS
Sbjct: 61  VGIVEVCALAHPDSTTDDPR-WECVDIKAVRDMPKPVTLKDVKANPRLQDMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE++EVCRMG L 
Sbjct: 120 VQPVTEDEWIEVCRMGGLD 138


>gi|218509366|ref|ZP_03507244.1| hypothetical protein RetlB5_18569 [Rhizobium etli Brasil 5]
          Length = 142

 Score =  191 bits (484), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 104/142 (73%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VGDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD +A+    W+CVDI AV  MP PV+L  IKAN  LS M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSSAKGDPKWDCVDIRAVMDMPKPVTLKDIKANETLSKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|49474783|ref|YP_032825.1| hypothetical protein BQ13020 [Bartonella quintana str. Toulouse]
 gi|49240287|emb|CAF26761.1| hypothetical protein BQ13020 [Bartonella quintana str. Toulouse]
          Length = 142

 Score =  190 bits (483), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 92/138 (66%), Positives = 103/138 (74%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPYKWSWNMQKQKGADGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T      WECVDI A+  MP PVSL  IKANP+L +M+L+ +SRLS
Sbjct: 61  VGIVEVCAEVHPDSTTSDPQ-WECVDIRALFDMPTPVSLKQIKANPKLKNMVLVNASRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+ EVC MG L
Sbjct: 120 VQPVTKDEWREVCLMGNL 137


>gi|319409421|emb|CBI83067.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 144

 Score =  190 bits (483), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 92/138 (66%), Positives = 102/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPQKWSWAMQKQKGAHGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T      WECVDI A+C MP PVSL  IKANP+L +M L+ + RLS
Sbjct: 61  VGIVEVCAQAHPDSTTSDPR-WECVDIRALCDMPNPVSLKQIKANPKLKNMALVKTMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+ EVC MG L
Sbjct: 120 VQPVTEDEWKEVCSMGGL 137


>gi|121601905|ref|YP_988399.1| hypothetical protein BARBAKC583_0060 [Bartonella bacilliformis
           KC583]
 gi|120614082|gb|ABM44683.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 142

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 90/139 (64%), Positives = 104/139 (74%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPDKWSWTMQKKKGLDGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+   T+PD T      WECVDI A+C MP PVSL  IKANP+L++M L+ + RLS
Sbjct: 61  VGIVEICAETHPDSTTSDPR-WECVDIRAICDMPNPVSLKQIKANPKLNTMTLVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT +E+ E+C MG L 
Sbjct: 120 VQPVTEEEWKEICAMGGLQ 138


>gi|116254220|ref|YP_770058.1| hypothetical protein RL4491 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|241206700|ref|YP_002977796.1| hypothetical protein Rleg_4016 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|115258868|emb|CAK09976.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|240860590|gb|ACS58257.1| protein of unknown function DUF55 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 143

 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 106/142 (74%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M++GDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGEKGTEWTGVRNYLARNNMRAMQIGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD +A+    W+CVDI AV  +P PV+L  +KA+ +L+ M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSSAKGDPKWDCVDIRAVMDVPKPVTLKDVKASEKLAKMALVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT +EYLEVCRMG L NPP
Sbjct: 121 VQPVTEEEYLEVCRMGGLDNPP 142


>gi|319899473|ref|YP_004159570.1| hypothetical protein BARCL_1337 [Bartonella clarridgeiae 73]
 gi|319403441|emb|CBI77009.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 142

 Score =  188 bits (477), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 104/138 (75%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSN+G EI
Sbjct: 1   MAYWLFKSEPHKWSWDMQKQKGVYGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNQGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T+  S  WECVDI A+C +P PVSL  IKANP+L +MIL+ + RLS
Sbjct: 61  VGIVEVCAEAHPDSTSFDSR-WECVDIRAICDIPNPVSLKQIKANPKLKNMILVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT DE+ E+C MG L
Sbjct: 120 VQSVTEDEWKEICSMGGL 137


>gi|49476264|ref|YP_034305.1| hypothetical protein BH16120 [Bartonella henselae str. Houston-1]
 gi|49239072|emb|CAF28375.1| hypothetical protein BH16120 [Bartonella henselae str. Houston-1]
          Length = 142

 Score =  187 bits (475), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 91/138 (65%), Positives = 102/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPHKWSWDMQKQKGADGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T      WECV+I A+  MP PVSL  IKANP+L +M+L+  SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTADPR-WECVNIRALYDMPTPVSLKQIKANPKLKNMVLVNVSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+ EVC MG L
Sbjct: 120 VQPVTEDEWREVCLMGNL 137


>gi|319404869|emb|CBI78470.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 140

 Score =  186 bits (473), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 104/138 (75%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS+WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSN+G EI
Sbjct: 1   MAYWLFKSEPSKWSWDMQKQKGFDGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNQGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T+     WECVDI A+C +P PVSL  IKANP+L +M+L+ + RLS
Sbjct: 61  VGIVEVCAEAHPDSTSSDPR-WECVDIRAICDIPNPVSLKQIKANPKLKNMMLVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT DE+ E+C MG L
Sbjct: 120 VQSVTEDEWKEICSMGGL 137


>gi|209551267|ref|YP_002283184.1| hypothetical protein Rleg2_3695 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537023|gb|ACI56958.1| protein of unknown function DUF55 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 143

 Score =  186 bits (471), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 103/142 (72%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M++GDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGEKGTEWTGVRNYLARNNMRAMQLGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV I AV  MP PV+L  +KA+ +L+ M L+ S RLS
Sbjct: 61  VGIVEVSALSQPDSTAKGDPKWDCVHIRAVMDMPKPVTLKDVKASEKLAKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|319407830|emb|CBI81483.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 142

 Score =  186 bits (471), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 104/138 (75%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS+WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSN+G EI
Sbjct: 1   MAYWLFKSEPSKWSWDMQKQKGIDGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNQGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T+     WECVDI A+C +P PVSL  IKANP+L +M+L+ + RLS
Sbjct: 61  VGIVEVCAEAHPDSTSSDPR-WECVDIRAICDIPNPVSLKQIKANPKLKNMMLVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT DE+ E+C MG L
Sbjct: 120 VQSVTEDEWKEICFMGGL 137


>gi|153008306|ref|YP_001369521.1| hypothetical protein Oant_0971 [Ochrobactrum anthropi ATCC 49188]
 gi|151560194|gb|ABS13692.1| protein of unknown function DUF55 [Ochrobactrum anthropi ATCC
           49188]
          Length = 144

 Score =  184 bits (468), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 87/139 (62%), Positives = 103/139 (74%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ +G  GE W GVRNY ARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWEMQKARGEKGEQWDGVRNYLARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    + D T +    WECVDI AV  MP PV+L  +KANP+L  M L+ S RLS
Sbjct: 61  VGIVEVCALAHHDSTTDDPR-WECVDIRAVRDMPKPVTLKDVKANPKLEKMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE++EVCRMG L 
Sbjct: 120 VQPVTEDEWIEVCRMGGLD 138


>gi|239833015|ref|ZP_04681344.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239825282|gb|EEQ96850.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 144

 Score =  184 bits (467), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 87/139 (62%), Positives = 102/139 (73%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ +G  GE W GVRNY ARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWDMQKARGEKGEQWDGVRNYLARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    + D T +    WECVDI AV  MP PV+L  +KANP+L  M L+ S RLS
Sbjct: 61  VGIVEVCALAHHDSTTDDPR-WECVDIRAVRDMPKPVTLKDVKANPKLEKMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE++EVCRMG L 
Sbjct: 120 VQPVTEDEWIEVCRMGGLD 138


>gi|218512513|ref|ZP_03509353.1| hypothetical protein Retl8_01884 [Rhizobium etli 8C-3]
          Length = 137

 Score =  184 bits (466), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 88/136 (64%), Positives = 100/136 (73%)

Query: 7   KSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEV 66
           KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VGDKGFFYHSN G EIVGI EV
Sbjct: 1   KSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGDKGFFYHSNDGLEIVGIVEV 60

Query: 67  ITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTT 126
              ++PD TA+    W+CVDI AV  MP PV+L  IKAN +LS M L+ S RLSVQPVT 
Sbjct: 61  CALSHPDSTAKGDPKWDCVDIRAVMDMPKPVTLKDIKANEKLSKMSLVTSMRLSVQPVTN 120

Query: 127 DEYLEVCRMGKLSNPP 142
           DE+ EVCRMG L NPP
Sbjct: 121 DEWAEVCRMGGLDNPP 136


>gi|319406354|emb|CBI79993.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 142

 Score =  182 bits (463), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 88/138 (63%), Positives = 102/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSN+G EI
Sbjct: 1   MAYWLFKSEPHKWSWDMQKQKGGDGEQWDGVRNYQARNNMRAMKCGDKGFFYHSNQGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T+     WECVDI A+C +P PVSL  IKANP+L +M L+ + RLS
Sbjct: 61  VGIVEVCAEAHPDSTSLDPR-WECVDIRAICDIPNPVSLKQIKANPKLKNMTLVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT DE+ E+C MG L
Sbjct: 120 VQSVTEDEWKEICSMGGL 137


>gi|118592014|ref|ZP_01549408.1| hypothetical protein SIAM614_25097 [Stappia aggregata IAM 12614]
 gi|118435310|gb|EAV41957.1| hypothetical protein SIAM614_25097 [Stappia aggregata IAM 12614]
          Length = 141

 Score =  179 bits (455), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 101/141 (71%), Gaps = 1/141 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP +WSW+ Q+ +G  GE W G+RNYQARNNMR M +GDK FFYHSN G+E+
Sbjct: 1   MQYWLIKSEPDKWSWEQQKARGDKGEQWDGIRNYQARNNMRAMEIGDKAFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV +  +PD T +    WECVD  AVC MP PV+L  +KA PRL+ M L+ S RLS
Sbjct: 61  VGIVEVCSDIHPDTTIDDPR-WECVDFKAVCDMPKPVTLADVKAEPRLAKMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           VQPVT +E+  VC MG L  P
Sbjct: 120 VQPVTEEEWKIVCEMGGLKEP 140


>gi|110635535|ref|YP_675743.1| hypothetical protein Meso_3206 [Mesorhizobium sp. BNC1]
 gi|110286519|gb|ABG64578.1| protein of unknown function DUF55 [Chelativorans sp. BNC1]
          Length = 141

 Score =  179 bits (454), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 85/142 (59%), Positives = 101/142 (71%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ WSW+MQ+ KG  G+ W GVRNYQARNNMR M+VGD GFFYHS K   +
Sbjct: 1   MAYWLFKSEPTSWSWEMQKKKGAQGQEWDGVRNYQARNNMRAMKVGDLGFFYHSVKETSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T +    WECVDI AV  +P PVSL  IK NP+L  M+L+ +SRLS
Sbjct: 61  VGIVEVIAPAHPDSTTDDPR-WECVDIRAVLDVPKPVSLEEIKTNPKLKDMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPV+  E+ E+C MG L   P
Sbjct: 120 VQPVSNAEWREICHMGGLDKAP 141


>gi|328541992|ref|YP_004302101.1| Ubiquinol-cytochrome c reductase, iron-sulfur subunit [polymorphum
           gilvum SL003B-26A1]
 gi|326411741|gb|ADZ68804.1| Ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Polymorphum
           gilvum SL003B-26A1]
          Length = 141

 Score =  176 bits (447), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP +WSW+MQ+ KG  G+ W GVRNYQARNNMR M++GD+GFFYHSN+G+EI
Sbjct: 1   MRYWLFKSEPFKWSWEMQKAKGAAGQEWDGVRNYQARNNMRTMQIGDRGFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI A+  +P PV+L  +KA PRL+ M L+ S RLS
Sbjct: 61  VGIVEVCELAHPDSTTDDPR-WECVDIRALRDLPRPVTLAEVKAEPRLADMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC MG L
Sbjct: 120 VQPVTEEEWRIVCAMGGL 137


>gi|146278949|ref|YP_001169108.1| hypothetical protein Rsph17025_2917 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557190|gb|ABP71803.1| protein of unknown function DUF55 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 137

 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP  WSW+ QQ KG+ GE WTGVRNYQARN+MR M++G++GFFYHSN G+E+
Sbjct: 1   MAFWLFKSEPDAWSWEQQQAKGQAGEEWTGVRNYQARNHMRAMKLGERGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV + AV  MP PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCGLSAPDSTADDPR-WDCVTVRAVEPMPRPVTLEAIKAEPRLAGMVLVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV  +E+  +C MG L
Sbjct: 120 VQPVGDEEWRMICEMGGL 137


>gi|307942597|ref|ZP_07657945.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307774236|gb|EFO33449.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 141

 Score =  174 bits (442), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/141 (56%), Positives = 98/141 (69%), Gaps = 1/141 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP +WSW+ Q+ KG  GE W G+RNYQARNNMR M +GDK FFYHSN G+EI
Sbjct: 1   MQYWLIKSEPDKWSWEQQKAKGEAGEEWDGIRNYQARNNMRAMEIGDKAFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV +  +PD T +    WECVD  AVC +P PV+L  +K  PRL+ M L+ S RLS
Sbjct: 61  VGIVEVCSEIHPDSTTDDPR-WECVDFKAVCDVPKPVTLADVKGEPRLADMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           VQPV  +E+  VC+M     P
Sbjct: 120 VQPVKKEEWDLVCQMAGFKEP 140


>gi|300024954|ref|YP_003757565.1| hypothetical protein Hden_3453 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526775|gb|ADJ25244.1| protein of unknown function DUF55 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 145

 Score =  174 bits (441), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 1/142 (0%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           AYWL+KSEP  +SW     +G  GE+W GVRNYQARNNMR M+VGD GFFYHSN+G+ +V
Sbjct: 3   AYWLLKSEPDAFSWDELVSRGAKGESWDGVRNYQARNNMRAMKVGDLGFFYHSNEGKNVV 62

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI  +I   +P+   +++  WECVD+ AV  +P PV+L AIKANP+L  M+L+ +SRLSV
Sbjct: 63  GICRIIALAHPE-AKDETGKWECVDVAAVAPVPNPVTLEAIKANPKLDGMVLVNNSRLSV 121

Query: 122 QPVTTDEYLEVCRMGKLSNPPL 143
           QPV+ DE+ EVCRMG +    L
Sbjct: 122 QPVSADEWKEVCRMGGVEQRKL 143


>gi|90421070|ref|ZP_01228973.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334705|gb|EAS48482.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 145

 Score =  174 bits (440), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 101/139 (72%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP +WS+  Q+  G  G+ W GVRNYQARN MR+M+VGD+GFFYHSN+G+ +
Sbjct: 1   MRYWLFKSEPFKWSFDHQKKAGDKGQEWDGVRNYQARNFMREMKVGDRGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD TA+    WECVDI AV  +P PV+L A+KA P L  M+L+ +SRLS
Sbjct: 61  VGIVEVIAEAHPDSTAKDGK-WECVDIKAVMDVPDPVTLDAVKAEPALKDMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV  DE+ +VC MG L 
Sbjct: 120 VQPVEPDEFRKVCEMGGLD 138


>gi|114705605|ref|ZP_01438508.1| hypothetical protein FP2506_14104 [Fulvimarina pelagi HTCC2506]
 gi|114538451|gb|EAU41572.1| hypothetical protein FP2506_14104 [Fulvimarina pelagi HTCC2506]
          Length = 145

 Score =  173 bits (439), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP +WS++ Q++KG  G+ W GVRNYQARN MR+M+VGD+GFFYHSN+G+E+
Sbjct: 1   MRYWLFKSEPFKWSFEQQKEKGEAGQEWDGVRNYQARNFMREMKVGDRGFFYHSNEGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV+   +PD + + S  WECVDI AV  +P PVSL  +K  PRL  M+L+ +SRLS
Sbjct: 61  VGIVEVVAEAHPD-SKDNSGKWECVDIKAVMDVPNPVSLDQVKDEPRLKDMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPV   E+  VC MG
Sbjct: 120 VQPVEEAEFKLVCEMG 135


>gi|163742575|ref|ZP_02149961.1| hypothetical protein RG210_06799 [Phaeobacter gallaeciensis 2.10]
 gi|161384160|gb|EDQ08543.1| hypothetical protein RG210_06799 [Phaeobacter gallaeciensis 2.10]
          Length = 140

 Score =  171 bits (434), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  QQ KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MAYWLFKSEPSTWSWADQQAKGETGEEWDGVRNYQARNFMREMKIGDRGFFYHSMKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T +    WECVDI AV S   PV+L  IK +PRL +M+L+ +SRLS
Sbjct: 61  VGIVEICADVHPDSTTDDPR-WECVDIKAVRSFAVPVTLDQIKGDPRLENMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT +E+  +C +GK
Sbjct: 120 VQPVTAEEWAHICALGK 136


>gi|221641004|ref|YP_002527266.1| hypothetical protein RSKD131_2905 [Rhodobacter sphaeroides KD131]
 gi|221161785|gb|ACM02765.1| Hypothetical Protein RSKD131_2905 [Rhodobacter sphaeroides KD131]
          Length = 137

 Score =  171 bits (433), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  WSW  Q  KG  GE WTGVRNYQARN+MR M++GD+GFFYHSN G+E+
Sbjct: 1   MACWLFKSEPDAWSWDQQVAKGAEGEEWTGVRNYQARNHMRAMQLGDRGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV + AV  +P PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCGLSAPDSTADDPR-WDCVTVRAVEPLPKPVTLEAIKAEPRLAQMVLVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV+  E+L +C MG L
Sbjct: 120 VQPVSEAEWLTICEMGGL 137


>gi|254477687|ref|ZP_05091073.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Ruegeria sp.
           R11]
 gi|214031930|gb|EEB72765.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Ruegeria sp.
           R11]
          Length = 147

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 81/136 (59%), Positives = 98/136 (72%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  QQ KG  GE W GVRNYQARN MR M++GD+GFFYHS K + +
Sbjct: 8   MAYWLFKSEPSTWSWDDQQAKGDAGEEWDGVRNYQARNFMRDMKLGDRGFFYHSQKEKSV 67

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+   ++PD + +    WECVDI A+ S   PV+L  IKA+PRLS M L+ SSRLS
Sbjct: 68  VGIVEICAESHPDSSTDDER-WECVDIKAIRSFVTPVTLEQIKADPRLSDMALVKSSRLS 126

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT +E+  VC +G
Sbjct: 127 VQPVTAEEWKIVCALG 142


>gi|304320334|ref|YP_003853977.1| hypothetical protein PB2503_03802 [Parvularcula bermudensis
           HTCC2503]
 gi|303299236|gb|ADM08835.1| hypothetical protein PB2503_03802 [Parvularcula bermudensis
           HTCC2503]
          Length = 140

 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 78/137 (56%), Positives = 99/137 (72%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+KSEPS WSW+ Q  KG  GE W GVRN+QA+N M++M+ GD  FFYHS K REI
Sbjct: 1   MAYWLMKSEPSTWSWQDQLAKGEAGEPWDGVRNHQAKNYMQEMKKGDLAFFYHSQKDREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I    PDPTA   S WECV I A  ++  PV+L  IK  P L+ M+L+ +SRLS
Sbjct: 61  VGIVEIIEEAMPDPTAAPDSPWECVTIAARETLDAPVTLAQIKDTPDLAEMVLVKNSRLS 120

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT+D++  +C+MG+
Sbjct: 121 VQPVTSDQWALICKMGQ 137


>gi|126732173|ref|ZP_01747974.1| hypothetical protein SSE37_17820 [Sagittula stellata E-37]
 gi|126707255|gb|EBA06320.1| hypothetical protein SSE37_17820 [Sagittula stellata E-37]
          Length = 139

 Score =  170 bits (430), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 97/136 (71%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M  GD GFFYHS K REI
Sbjct: 1   MKFWLFKSEPSTWSWNDQVAKGDAGEEWDGVRNYQARNFMREMTPGDLGFFYHSQKDREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T + +  WECVDI AV  +P PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVSAPAHPDSTTDDAR-WECVDIKAVEPLPAPVTLDAIKAEPRLADMVLVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT +E+  +C MG
Sbjct: 120 VQPVTAEEWDVICTMG 135


>gi|126724564|ref|ZP_01740407.1| hypothetical protein RB2150_12051 [Rhodobacterales bacterium
           HTCC2150]
 gi|126705728|gb|EBA04818.1| hypothetical protein RB2150_12051 [Rhodobacterales bacterium
           HTCC2150]
          Length = 139

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 98/139 (70%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  WSW  Q  KG +GE W GVRNYQARN MR+M +GD GFFYHS K + +
Sbjct: 1   MAYWLFKSEPDAWSWDKQVAKGDIGEEWDGVRNYQARNFMRQMAIGDLGFFYHSQKDKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +VI   +PD T +    WECVDI AV ++P PV+L  +K +PRL+ M L+ +SRLS
Sbjct: 61  VGIVQVIATAHPDSTTDDVR-WECVDIKAVKAVPKPVTLQMVKDDPRLAEMFLVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV  DE+  +C MG ++
Sbjct: 120 VQPVRDDEWAMICEMGGVA 138


>gi|163738029|ref|ZP_02145445.1| hypothetical protein RGBS107_06444 [Phaeobacter gallaeciensis
           BS107]
 gi|161388645|gb|EDQ12998.1| hypothetical protein RGBS107_06444 [Phaeobacter gallaeciensis
           BS107]
          Length = 140

 Score =  169 bits (428), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/137 (57%), Positives = 98/137 (71%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  QQ KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MAYWLFKSEPSTWSWADQQAKGETGEEWDGVRNYQARNFMREMKIGDRGFFYHSMKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T +    WECVDI AV S   PV+L  IK + RL +M+L+ +SRLS
Sbjct: 61  VGIVEICADVHPDSTTDDPR-WECVDIKAVRSFAVPVTLDQIKGDSRLENMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT +E+  +C +GK
Sbjct: 120 VQPVTAEEWAHICALGK 136


>gi|91974952|ref|YP_567611.1| hypothetical protein RPD_0472 [Rhodopseudomonas palustris BisB5]
 gi|91681408|gb|ABE37710.1| protein of unknown function DUF589 [Rhodopseudomonas palustris
           BisB5]
          Length = 137

 Score =  168 bits (426), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 80/138 (57%), Positives = 102/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  M+ GD+ FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           +GI E+I   YPDPT ++S  + CVD+ A   +  PV+L+A+KA PRL+ M L+  SRLS
Sbjct: 61  IGIAEIIREAYPDPT-DESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+  +C+MG L
Sbjct: 120 VQPVTADEWKLICKMGGL 137


>gi|77462052|ref|YP_351556.1| hypothetical protein RSP_1512 [Rhodobacter sphaeroides 2.4.1]
 gi|77386470|gb|ABA77655.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 137

 Score =  168 bits (425), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/138 (58%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  WSW  Q  KG  GE WTGVRNYQARN+MR M++GD+GFFYHSN G+E+
Sbjct: 1   MACWLFKSEPDAWSWDQQVAKGAEGEEWTGVRNYQARNHMRAMQLGDRGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV + AV  +P PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCGLSAPDSTADDPR-WDCVTVRAVEPLPKPVTLEAIKAEPRLAGMVLVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV+  E+  +C MG L
Sbjct: 120 VQPVSEAEWRTICEMGGL 137


>gi|126460941|ref|YP_001042055.1| hypothetical protein Rsph17029_0164 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559979|ref|ZP_08414301.1| hypothetical protein RSWS8N_13000 [Rhodobacter sphaeroides WS8N]
 gi|126102605|gb|ABN75283.1| protein of unknown function DUF55 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332277691|gb|EGJ23006.1| hypothetical protein RSWS8N_13000 [Rhodobacter sphaeroides WS8N]
          Length = 141

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 81/138 (58%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  WSW  Q  KG  GE WTGVRNYQARN+MR M++GD+GFFYHSN G+E+
Sbjct: 1   MACWLFKSEPDAWSWDQQVAKGAEGEEWTGVRNYQARNHMRAMQLGDRGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV + AV  +P PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCGLSAPDSTADDPR-WDCVTVRAVEPLPKPVTLEAIKAEPRLAQMVLVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV+  E+  +C MG L
Sbjct: 120 VQPVSEAEWRTICEMGGL 137


>gi|192288685|ref|YP_001989290.1| hypothetical protein Rpal_0254 [Rhodopseudomonas palustris TIE-1]
 gi|192282434|gb|ACE98814.1| protein of unknown function DUF55 [Rhodopseudomonas palustris
           TIE-1]
          Length = 137

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  MR GD+ FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT + S  + CVDI A   +  PV+L A+KA PRL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DASGKFVCVDIKADKPLKSPVTLAAVKAEPRLAEMALMKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG L
Sbjct: 120 VQPVTAEEWKLVCKMGGL 137


>gi|114799058|ref|YP_759218.1| hypothetical protein HNE_0488 [Hyphomonas neptunium ATCC 15444]
 gi|114739232|gb|ABI77357.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 145

 Score =  168 bits (425), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 80/139 (57%), Positives = 100/139 (71%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  WSW+ Q  KG  GE W+GVRNY ARN+MR+M++GD+ FFYHSN G EI
Sbjct: 1   MQYWLMKSEPDAWSWEQQVKKGEAGEIWSGVRNYTARNHMREMKLGDRVFFYHSNIGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV   + PDPT + +  W+CV I A+  MP PV+L A K NP+L+ M L+ S RLS
Sbjct: 61  VGVCEVCELSKPDPTTDDAR-WDCVTIRALAPMPKPVTLKAAKENPKLAEMSLVSSFRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT  E+ EVCRMG + 
Sbjct: 120 VQPVTAAEWKEVCRMGGMD 138


>gi|316931773|ref|YP_004106755.1| hypothetical protein Rpdx1_0381 [Rhodopseudomonas palustris DX-1]
 gi|315599487|gb|ADU42022.1| protein of unknown function DUF55 [Rhodopseudomonas palustris DX-1]
          Length = 137

 Score =  167 bits (422), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  MR GD+ F+YHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFYYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT + S  + CVDI A   +  PV+L A+KA PRL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DASGKFVCVDIKADKPLKTPVTLAAVKAEPRLAEMALLKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG L
Sbjct: 120 VQPVTAEEWKLVCKMGGL 137


>gi|39933330|ref|NP_945606.1| hypothetical protein RPA0253 [Rhodopseudomonas palustris CGA009]
 gi|39652955|emb|CAE25697.1| DUF589 [Rhodopseudomonas palustris CGA009]
          Length = 137

 Score =  166 bits (421), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  MR GD+ F+YHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFYYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT + S  + CVDI A   +  PV+L A+KA PRL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DASGKFVCVDIKADKPLKTPVTLAAVKAEPRLADMALMKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG L
Sbjct: 120 VQPVTAEEWKLVCKMGGL 137


>gi|260431932|ref|ZP_05785903.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415760|gb|EEX09019.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 140

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/137 (57%), Positives = 97/137 (70%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + I
Sbjct: 1   MAYWLFKSEPSTWSWDQQVAKGDAGEEWDGVRNYQARNFMRQMKLGDRGFFYHSQKDKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV     PV+L  IKA+PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTDDER-WECVDIRAVRPFAKPVTLDQIKADPRLADMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPV+  E+  +C +G+
Sbjct: 120 VQPVSDAEWAVICELGQ 136


>gi|310817095|ref|YP_003965059.1| Thymocyte nuclear protein 1 [Ketogulonicigenium vulgare Y25]
 gi|308755830|gb|ADO43759.1| Thymocyte nuclear protein 1 [Ketogulonicigenium vulgare Y25]
          Length = 142

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 82/139 (58%), Positives = 95/139 (68%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP E+ W  QQ  G  G AW+GVRNYQARNNMR M VGD  FFYHSN G+EI
Sbjct: 1   MRYWLMKSEPDEFGWDHQQALGPAGGAWSGVRNYQARNNMRAMSVGDLVFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI  VI     DPT +    W+CV + AV  +P PV+L  IKA P L+ M L+ SSRLS
Sbjct: 61  VGIMRVIAPAAQDPTTDDPR-WDCVSVTAVEKLPRPVTLDTIKATPALADMALVKSSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV TDE+  +CRMG L 
Sbjct: 120 VQPVATDEWKLICRMGGLD 138


>gi|163745145|ref|ZP_02152505.1| hypothetical protein OIHEL45_06140 [Oceanibulbus indolifex HEL-45]
 gi|161381963|gb|EDQ06372.1| hypothetical protein OIHEL45_06140 [Oceanibulbus indolifex HEL-45]
          Length = 139

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 97/139 (69%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ WSW  Q+ KG  GE W GVRNYQARN MR+M+VGD GFFYHS K REI
Sbjct: 1   MAYWLFKSEPATWSWADQKAKGDAGEEWDGVRNYQARNFMREMKVGDLGFFYHSQKDREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD + +    WECVDI A+ S   PV+L  IKA+PRL  M+L  + RLS
Sbjct: 61  VGIVEVCAEAHPDSSTDDPR-WECVDIKALRSFSVPVTLDTIKADPRLEDMVLAKNPRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT  E+  +C +GK +
Sbjct: 120 VQPVTEAEWELICALGKTT 138


>gi|92116180|ref|YP_575909.1| hypothetical protein Nham_0559 [Nitrobacter hamburgensis X14]
 gi|91799074|gb|ABE61449.1| protein of unknown function DUF589 [Nitrobacter hamburgensis X14]
          Length = 137

 Score =  166 bits (420), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/138 (57%), Positives = 101/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW+ Q  KG  GEAWTGVRN+ AR N+  M+ GD+ FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSAWSWQQQVAKGAKGEAWTGVRNFTARQNLVAMKKGDQAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A   +  PV++ A+KA+ RL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DKTGRFVCVDIKADKPLKTPVTIAAVKADKRLADMALVKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  VC+MG L
Sbjct: 120 VQPVTPAEWKMVCKMGGL 137


>gi|90421572|ref|YP_529942.1| hypothetical protein RPC_0044 [Rhodopseudomonas palustris BisB18]
 gi|90103586|gb|ABD85623.1| protein of unknown function DUF589 [Rhodopseudomonas palustris
           BisB18]
          Length = 137

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 101/136 (74%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEPS WSW+ Q  KG  GEAWTGVRN+ A+ +M KM+ GD+ F+YHSN+G++I
Sbjct: 1   MAFWLVKSEPSTWSWEQQVAKGAKGEAWTGVRNHSAKLHMMKMKKGDRAFYYHSNEGKQI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT + S  + CVDI A+  +  PV+L+AIKA   L+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DDSGKFVCVDIKALTPLKTPVTLVAIKAEKSLAEMALLKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT DE+  VC+MG
Sbjct: 120 VQPVTADEWKIVCKMG 135


>gi|149204338|ref|ZP_01881305.1| hypothetical protein RTM1035_18335 [Roseovarius sp. TM1035]
 gi|149142223|gb|EDM30270.1| hypothetical protein RTM1035_18335 [Roseovarius sp. TM1035]
          Length = 139

 Score =  166 bits (419), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 78/140 (55%), Positives = 96/140 (68%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W+ Q  KG  GE W GVRNYQARN MR+M +GD+GFFYHS   + +
Sbjct: 1   MRYWLFKSEPSTWGWQDQLAKGDAGEEWDGVRNYQARNFMREMALGDRGFFYHSQSEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EVI   +PD  ++    WECVDI AV S   PV+L  IK++PRL+ M+L+ +SRLS
Sbjct: 61  VGTVEVIATAHPDSKSDDPR-WECVDIKAVASAKTPVTLDTIKSDPRLADMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT DE+  +C M  LS 
Sbjct: 120 VQPVTADEWRIICDMAGLSG 139


>gi|84501226|ref|ZP_00999431.1| hypothetical protein OB2597_12713 [Oceanicola batsensis HTCC2597]
 gi|84390517|gb|EAQ03005.1| hypothetical protein OB2597_12713 [Oceanicola batsensis HTCC2597]
          Length = 137

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/138 (58%), Positives = 95/138 (68%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP  WSW  Q  KG  GE W GVRNYQARN MR+M++GD+GFFYHS K REI
Sbjct: 1   MRYWLFKSEPDTWSWGDQVAKGAAGEEWDGVRNYQARNFMREMKLGDRGFFYHSQKTREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  +P PV+L  IKA P L+ M+L+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTDDER-WECVDIRAVEPVPTPVTLDQIKATPELAGMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV   E+  +CRM  L
Sbjct: 120 VQPVEEAEWRVICRMAGL 137


>gi|294679021|ref|YP_003579636.1| hypothetical protein RCAP_rcc03505 [Rhodobacter capsulatus SB 1003]
 gi|294477841|gb|ADE87229.1| protein of unknown function DUF55 [Rhodobacter capsulatus SB 1003]
          Length = 139

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 79/139 (56%), Positives = 99/139 (71%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  WSW MQ  KG  GE W GVRNY ARNNMR M++GD+GFFYHSN G+E+
Sbjct: 1   MAKWLFKSEPDVWSWDMQVAKGAEGEEWHGVRNYLARNNMRAMQLGDQGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD T E    W+CVDI A+  +  PV+L  +KA+PRL+ M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSTTEDPR-WDCVDIRALRPLARPVTLATVKADPRLAQMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT +E+  VC +G ++
Sbjct: 120 VQPVTEEEWKIVCELGGVA 138


>gi|259417456|ref|ZP_05741375.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259346362|gb|EEW58176.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 140

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 97/136 (71%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ W W  Q  KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MAYWLFKSEPNTWGWHDQVAKGDAGEEWDGVRNYQARNFMREMKLGDRGFFYHSLKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD   +    WECVDI A+ +   PVSL  IK+NP L +M+L+ +SRLS
Sbjct: 61  VGIVEVCAEVHPDSKTDDPR-WECVDIKAIRAFAQPVSLDQIKSNPTLENMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT DE+ E+C+MG
Sbjct: 120 VQPVTEDEWNEICKMG 135


>gi|99032450|pdb|2GBS|A Chain A, Nmr Structure Of Rpa0253 From Rhodopseudomonas Palustris.
           No Structural Genomics Consortium Target Rpr3
          Length = 145

 Score =  165 bits (417), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 81/138 (58%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           +AYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  MR GD+ F+YHSN+G+EI
Sbjct: 1   VAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFYYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT + S  + CVDI A   +  PV+L A+KA PRL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DASGKFVCVDIKADKPLKTPVTLAAVKAEPRLADMALMKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG L
Sbjct: 120 VQPVTAEEWKLVCKMGGL 137


>gi|260428915|ref|ZP_05782892.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260419538|gb|EEX12791.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 145

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS WSW+ Q  KG  GE WTGVRNYQARN MR+M +GD+GFFYHS K + I
Sbjct: 7   MKYWLFKSEPSAWSWEDQVAKGDAGEEWTGVRNYQARNFMREMALGDRGFFYHSLKEKAI 66

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EV   ++PD + +    WECVDI A+     PV+L  IKA+PRLS M+L+ +SRLS
Sbjct: 67  VGAVEVSAESHPDSSTDDDR-WECVDIRALAPARTPVTLDDIKADPRLSDMVLVKNSRLS 125

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+  +C M  +
Sbjct: 126 VQPVTEDEWHAICAMAGI 143


>gi|86747443|ref|YP_483939.1| hypothetical protein RPB_0317 [Rhodopseudomonas palustris HaA2]
 gi|86570471|gb|ABD05028.1| Protein of unknown function DUF589 [Rhodopseudomonas palustris
           HaA2]
          Length = 137

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/138 (57%), Positives = 99/138 (71%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  M+ GD+ FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMMAMKKGDRAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT ++S  + CVD+ A   +  PV+L A+K   +LS M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DESGKFVCVDLKADKKLKTPVTLAAVKEEKKLSEMALLKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+  VC+MG L
Sbjct: 120 VQPVTADEWKLVCKMGGL 137


>gi|86136720|ref|ZP_01055298.1| hypothetical protein MED193_13637 [Roseobacter sp. MED193]
 gi|85826044|gb|EAQ46241.1| hypothetical protein MED193_13637 [Roseobacter sp. MED193]
          Length = 140

 Score =  164 bits (416), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 96/137 (70%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+MR+GD+GFFYHS K + +
Sbjct: 1   MRYWLFKSEPSTWGWPDQVAKGETGEEWDGVRNYQARNFMREMRLGDRGFFYHSQKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD T E    W+CVDI A+ +   PVSL  IKA+PRL  MIL+ +SRLS
Sbjct: 61  VGIVEVCAESHPDSTTEDDR-WDCVDIKALRAFTQPVSLDQIKADPRLEEMILVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT  E+  VC +G+
Sbjct: 120 VQPVTEAEWRAVCALGQ 136


>gi|148251905|ref|YP_001236490.1| hypothetical protein BBta_0291 [Bradyrhizobium sp. BTAi1]
 gi|146404078|gb|ABQ32584.1| hypothetical protein BBta_0291 [Bradyrhizobium sp. BTAi1]
          Length = 137

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 99/136 (72%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M+YWLVKSEPS WSW  Q +KG  GEAWTGVRNY AR N+  M+ G+  F+YHSN+G+EI
Sbjct: 1   MSYWLVKSEPSVWSWDQQVEKGAKGEAWTGVRNYTARQNLVAMKKGELAFYYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A      PV+L AIKA P+L+ M L+  SRLS
Sbjct: 61  VGIAEIIKEAYPDPT-DKTGKFVCVDIKAHKPFKTPVTLAAIKAEPKLAEMALVKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT +E+  VC+MG
Sbjct: 120 VQPVTPEEWKLVCKMG 135


>gi|255261429|ref|ZP_05340771.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255103764|gb|EET46438.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 139

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/139 (56%), Positives = 97/139 (69%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEPS WSW  Q  KG  GE W GVRNYQARN MR M +GD+GFFYHS K +EI
Sbjct: 1   MAFWLFKSEPSVWSWDDQVAKGDAGEEWDGVRNYQARNFMRSMAIGDRGFFYHSQKDKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  +  P+SL  IK + RL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTDNDR-WECVDIKAVEPLLQPISLDQIKGDERLAEMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT +E+  +C +G +S
Sbjct: 120 VQPVTENEFALICTLGGVS 138


>gi|27375680|ref|NP_767209.1| hypothetical protein blr0569 [Bradyrhizobium japonicum USDA 110]
 gi|27348818|dbj|BAC45834.1| blr0569 [Bradyrhizobium japonicum USDA 110]
          Length = 148

 Score =  164 bits (415), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 99/138 (71%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEPS WSW  Q  KG  GEAWTGVRNY AR N+  M+ GDK FFYHSN+G+EI
Sbjct: 12  MNYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNYTARQNLVAMKKGDKAFFYHSNEGKEI 71

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++   YPDPT +++  + CVDI A   +  PV++ AIKA  +L+ M L+  SRLS
Sbjct: 72  VGIAEIVKEAYPDPT-DKTEKFVCVDIKADKPLKTPVTMAAIKAEKKLADMALVKYSRLS 130

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG +
Sbjct: 131 VQPVTAEEWKLVCKMGGM 148


>gi|126734489|ref|ZP_01750236.1| hypothetical protein RCCS2_10019 [Roseobacter sp. CCS2]
 gi|126717355|gb|EBA14219.1| hypothetical protein RCCS2_10019 [Roseobacter sp. CCS2]
          Length = 146

 Score =  164 bits (414), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 79/137 (57%), Positives = 95/137 (69%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  W W  Q  KG  GE W GVRNYQARNNMR M++G+KGFFYHS  G EI
Sbjct: 8   MARWLFKSEPDVWGWDAQVAKGEAGEEWDGVRNYQARNNMRAMKLGEKGFFYHSRTGLEI 67

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    W+CVDI AV     PV+L  IKA+PRLS M+L+ +SRLS
Sbjct: 68  VGIVEVCAEAHPDSTTDDDR-WDCVDIKAVRPFTKPVTLETIKADPRLSDMVLVNNSRLS 126

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT +E+  +C +G+
Sbjct: 127 VQPVTDEEWQIICDLGE 143


>gi|146337461|ref|YP_001202509.1| hypothetical protein BRADO0304 [Bradyrhizobium sp. ORS278]
 gi|146190267|emb|CAL74261.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 137

 Score =  163 bits (413), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 99/136 (72%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M+YWLVKSEPS WSW  Q +KG  GEAWTGVRNY AR N+  M+ G+  F+YHSN+G+ I
Sbjct: 1   MSYWLVKSEPSVWSWDQQVEKGAKGEAWTGVRNYTARQNLVAMKQGELAFYYHSNEGKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A  +   PV+L AIKA P+L+ M L+  SRLS
Sbjct: 61  VGIAEIIKEAYPDPT-DKTEKFVCVDIKAHKAFKTPVTLAAIKAEPKLAEMALVKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT +E+  VC+MG
Sbjct: 120 VQPVTPEEWKLVCKMG 135


>gi|110677856|ref|YP_680863.1| hypothetical protein RD1_0467 [Roseobacter denitrificans OCh 114]
 gi|3925819|dbj|BAA34646.1| unnamed protein product [Roseobacter denitrificans]
 gi|109453972|gb|ABG30177.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 140

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M+VGD GFFYHS K + I
Sbjct: 1   MAYWLFKSEPSAWSWDDQVAKGEAGEEWDGVRNYQARNFMREMKVGDLGFFYHSQKEKSI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T  Q   WECVDI AV ++  PVSL  +K + RL+ M L+  SRLS
Sbjct: 61  VGIVEVIAEAHPDSTT-QDDRWECVDIKAVRAVKTPVSLEDVKQDDRLADMALLKMSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV  +E+  +C M  ++ 
Sbjct: 120 VQPVRPEEWAIICEMAGVAE 139


>gi|163732932|ref|ZP_02140376.1| hypothetical protein RLO149_09740 [Roseobacter litoralis Och 149]
 gi|161393467|gb|EDQ17792.1| hypothetical protein RLO149_09740 [Roseobacter litoralis Och 149]
          Length = 147

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M+VGD GFFYHS K + I
Sbjct: 1   MAYWLFKSEPSTWSWDDQMAKGEAGEEWDGVRNYQARNFMRQMKVGDLGFFYHSQKEKSI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T E    W+CVDI AV  +  PVSL A+K + RL+ M L+  SRLS
Sbjct: 61  VGIVEVIAEAHPDSTTEDER-WDCVDIKAVRPVKTPVSLEAVKQDERLADMALLKMSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV  +E+  +C M  + +
Sbjct: 120 VQPVQPEEWAVICDMAGVPD 139


>gi|319780783|ref|YP_004140259.1| hypothetical protein Mesci_1045 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166671|gb|ADV10209.1| protein of unknown function DUF55 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 141

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP ++S++M + KG+ G  W GVRNY ARNNM+ M++GD GFFYHSN+G  I
Sbjct: 1   MNYWLFKSEPFKFSFEMLKAKGKAGTQWDGVRNYAARNNMKAMQIGDLGFFYHSNEGLNI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T++    WECVDI AV  +P P +L  +KANP+L+ M L+   RLS
Sbjct: 61  VGIAEVCALAHPDTTSDDPR-WECVDIRAVRDVPNPPTLEQVKANPKLADMALVRLGRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT  E+ EVCRMG L+  P
Sbjct: 120 VQPVTPAEWKEVCRMGGLTPAP 141


>gi|254472992|ref|ZP_05086390.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Pseudovibrio
           sp. JE062]
 gi|211957713|gb|EEA92915.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Pseudovibrio
           sp. JE062]
          Length = 142

 Score =  162 bits (411), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 94/139 (67%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP++WSW  Q+ KG  GE W GVRNYQARN MR M++GD+GFFYHSN G+E+
Sbjct: 1   MQYWLFKSEPNKWSWDQQKAKGEEGEEWDGVRNYQARNFMRDMKIGDRGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  +P  V+L  +KA  RLS M L+ S RLS
Sbjct: 61  VGIVEVCALAHPDSTTDDPR-WECVDIKAVKDLPQTVTLAQVKAEERLSDMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV  +E+  V  M  + 
Sbjct: 120 VQPVKPEEWAVVLEMAGMD 138


>gi|115522097|ref|YP_779008.1| hypothetical protein RPE_0067 [Rhodopseudomonas palustris BisA53]
 gi|115516044|gb|ABJ04028.1| protein of unknown function DUF55 [Rhodopseudomonas palustris
           BisA53]
          Length = 137

 Score =  162 bits (410), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 98/136 (72%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ NM KM+ GD  F+YHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHTAKLNMMKMKKGDLAFYYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDP  ++S  + CVD+ A   +  PV+L+A+KA P L+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDP-GDESGKFVCVDLKASKPLKTPVTLIAVKAEPALAEMALLKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  +C+MG
Sbjct: 120 VQPVTAAEWKLICKMG 135


>gi|254512217|ref|ZP_05124284.1| hypothetical protein RKLH11_2762 [Rhodobacteraceae bacterium KLH11]
 gi|221535928|gb|EEE38916.1| hypothetical protein RKLH11_2762 [Rhodobacteraceae bacterium KLH11]
          Length = 147

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/137 (56%), Positives = 94/137 (68%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M+VGD+GFFYHS K + I
Sbjct: 8   MAYWLFKSEPSTWSWDQQVAKGDAGEEWDGVRNYQARNFMRQMQVGDRGFFYHSQKEKAI 67

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T +    WECVDI AV     PV+L  IK   RL+ M+L+ S+RLS
Sbjct: 68  VGIVEICAEAHPDSTTDDER-WECVDIKAVRPFTTPVTLEQIKTEERLADMVLVKSARLS 126

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT  E+  +C +G+
Sbjct: 127 VQPVTEAEWRVICGLGE 143


>gi|85713689|ref|ZP_01044679.1| hypothetical protein NB311A_04094 [Nitrobacter sp. Nb-311A]
 gi|85699593|gb|EAQ37460.1| hypothetical protein NB311A_04094 [Nitrobacter sp. Nb-311A]
          Length = 137

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 78/138 (56%), Positives = 99/138 (71%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW+ Q  KG  GE WTGVRN+ AR N+  M+ GD  FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSAWSWEQQVAKGAKGEPWTGVRNFTARQNLAAMKKGDLAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A   +  PV++ A+KA+ RL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DKTGKFVCVDIKANKPLKTPVTIAAVKADERLADMALVKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  +C+MG L
Sbjct: 120 VQPVTPAEWKLICKMGGL 137


>gi|13473581|ref|NP_105149.1| hypothetical protein mlr4228 [Mesorhizobium loti MAFF303099]
 gi|14024331|dbj|BAB50935.1| mlr4228 [Mesorhizobium loti MAFF303099]
          Length = 141

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS +S++  + KG+ G  W GVRNY ARNNM+ M++GD GFFYHSN+G  I
Sbjct: 1   MNYWLFKSEPSVFSFEALKAKGKAGTQWDGVRNYAARNNMKAMQIGDLGFFYHSNEGLNI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T++    WECVDI AV  +P P +L  +KANP+L+ M L+   RLS
Sbjct: 61  VGIAEVCALAHPDTTSDDPR-WECVDIRAVRDVPTPPTLEQVKANPKLADMALVRLGRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT  E+ EVCRMG L+  P
Sbjct: 120 VQPVTPAEWKEVCRMGGLTPAP 141


>gi|260464229|ref|ZP_05812422.1| protein of unknown function DUF55 [Mesorhizobium opportunistum
           WSM2075]
 gi|259030032|gb|EEW31315.1| protein of unknown function DUF55 [Mesorhizobium opportunistum
           WSM2075]
          Length = 141

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 98/142 (69%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS +S++  + KG+ G  W GVRNY ARNNM+ M++GD GFFYHSN+G  +
Sbjct: 1   MNYWLFKSEPSVFSFEALKAKGKAGTQWDGVRNYAARNNMKAMQIGDLGFFYHSNEGLNV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  MP P +L  +KANP+L+ M L+   RLS
Sbjct: 61  VGIAEVCALAHPDSTTDDPR-WECVDIRAVRDMPNPPTLEEVKANPKLADMALVRLGRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT  E+ EVCRMG L+  P
Sbjct: 120 VQPVTPAEWKEVCRMGGLTPAP 141


>gi|254463760|ref|ZP_05077171.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Rhodobacterales bacterium Y4I]
 gi|206684668|gb|EDZ45150.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Rhodobacterales bacterium Y4I]
          Length = 140

 Score =  162 bits (409), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 93/137 (67%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR M VGD+GFFYHS K + +
Sbjct: 1   MRYWLFKSEPSTWSWDDQVSKGDTGEEWDGVRNYQARNFMRDMNVGDRGFFYHSQKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T      WECVDI AV     PVSL  IKA+PRL  M+L+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTVDDR-WECVDIKAVRPFAKPVSLDQIKADPRLEDMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPV+ +E+  VC +G+
Sbjct: 120 VQPVSEEEWSAVCALGE 136


>gi|99082672|ref|YP_614826.1| hypothetical protein TM1040_2832 [Ruegeria sp. TM1040]
 gi|99038952|gb|ABF65564.1| protein of unknown function DUF589 [Ruegeria sp. TM1040]
          Length = 140

 Score =  161 bits (408), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/136 (56%), Positives = 97/136 (71%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ W W  Q  KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MAYWLFKSEPNTWGWDDQVAKGEAGEEWDGVRNYQARNFMREMKLGDRGFFYHSLKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD T +    W+CVDI A+     PVSL  IK+NP L +M+L+ +SRLS
Sbjct: 61  VGIVEVCAKSHPDSTTDDPR-WDCVDIKAIRPFVKPVSLDQIKSNPMLENMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+ E+C+MG
Sbjct: 120 VQPVTDAEWQEICKMG 135


>gi|84514846|ref|ZP_01002209.1| hypothetical protein SKA53_11518 [Loktanella vestfoldensis SKA53]
 gi|84511005|gb|EAQ07459.1| hypothetical protein SKA53_11518 [Loktanella vestfoldensis SKA53]
          Length = 139

 Score =  161 bits (408), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 94/138 (68%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  W W  Q  KG VGE W GVRNYQARNNMR M+ GD GFFYHS  G EI
Sbjct: 1   MAYWLFKSEPDVWGWDQQTAKGAVGEEWGGVRNYQARNNMRAMKTGDLGFFYHSRTGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV T ++PD T +    W+CVD+ AV     PVSL  IKA+ RL  M+L+ ++RLS
Sbjct: 61  VGIVEVCTESHPDSTTDDPR-WDCVDVRAVRPFVKPVSLAQIKADLRLKDMVLVNNARLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  +C +G +
Sbjct: 120 VQPVTDTEWKTICALGGI 137


>gi|126738542|ref|ZP_01754247.1| hypothetical protein RSK20926_08757 [Roseobacter sp. SK209-2-6]
 gi|126720341|gb|EBA17047.1| hypothetical protein RSK20926_08757 [Roseobacter sp. SK209-2-6]
          Length = 140

 Score =  161 bits (407), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 97/137 (70%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS WSW+ Q +KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MRYWLFKSEPSTWSWQDQINKGDAGEEWDGVRNYQARNFMREMKLGDRGFFYHSQKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    W+CVDI    S   PVSL  IK++PRL  MIL+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTDDDR-WDCVDIKFFRSFIKPVSLDQIKSDPRLEEMILVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT +E+  +C +G+
Sbjct: 120 VQPVTAEEWGVICALGQ 136


>gi|85705796|ref|ZP_01036893.1| hypothetical protein ROS217_10862 [Roseovarius sp. 217]
 gi|85669786|gb|EAQ24650.1| hypothetical protein ROS217_10862 [Roseovarius sp. 217]
          Length = 139

 Score =  160 bits (405), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 95/138 (68%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W+ Q  KG  GE W GVRNYQARN MR M +GD+GFFYHS   + +
Sbjct: 1   MQYWLFKSEPSTWGWQDQLAKGDAGEEWDGVRNYQARNFMRDMAIGDRGFFYHSQTEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD  ++    WECVDI A+ +   PV+L  IK++PRL+ MIL+ +SRLS
Sbjct: 61  VGIVEVIATAHPDSKSDDPR-WECVDIKAIETARTPVTLDTIKSDPRLAEMILVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +++  +C M  L
Sbjct: 120 VQPVTAEQWRIICDMAGL 137


>gi|75674666|ref|YP_317087.1| hypothetical protein Nwi_0468 [Nitrobacter winogradskyi Nb-255]
 gi|74419536|gb|ABA03735.1| Protein of unknown function DUF589 [Nitrobacter winogradskyi
           Nb-255]
          Length = 137

 Score =  160 bits (404), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 78/138 (56%), Positives = 98/138 (71%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW+ Q  KG  GE WTGVRN+ AR N+  M+ GD  FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSAWSWEQQVAKGAKGEPWTGVRNFTARQNLNAMKKGDLAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A   +  PV++ A+KA+ RL+ + L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DKTGRFVCVDIKASKPLKTPVTIAAVKADRRLADIALVKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  VC MG L
Sbjct: 120 VQPVTPAEWKLVCEMGGL 137


>gi|87303869|ref|ZP_01086563.1| hypothetical protein WH5701_00090 [Synechococcus sp. WH 5701]
 gi|87281630|gb|EAQ73633.1| hypothetical protein WH5701_00090 [Synechococcus sp. WH 5701]
          Length = 139

 Score =  159 bits (403), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M VGD+GFFYHS K + +
Sbjct: 1   MRHWLFKSEPSVWGWSDQVAKGDAGEEWNGVRNYQARNFMREMAVGDRGFFYHSQKEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EVI   +PD T +    WECVDI A+     PV+L  IKA+PRLS M+L+ +SRLS
Sbjct: 61  VGTVEVIAEAHPDSTTDDPR-WECVDIKALEVARGPVTLEMIKADPRLSEMVLVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT +E+  VC M  +S 
Sbjct: 120 VQPVTAEEWRIVCEMAGVSG 139


>gi|254439422|ref|ZP_05052916.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
 gi|198254868|gb|EDY79182.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
          Length = 139

 Score =  159 bits (403), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 96/141 (68%), Gaps = 2/141 (1%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M  GD+GFFYHS K + +
Sbjct: 1   MRYWLFKSEPSTWGWDDQVAKGDAGEEWDGVRNYQARNFMREMACGDRGFFYHSQKEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV     PV+L  IKA+  LS M+L+ +SRLS
Sbjct: 61  VGIVEVCAPAHPDSTIDDDR-WECVDIKAVRPFETPVTLDQIKADDSLSEMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           VQPV+ DE+L +C +G+ +NP
Sbjct: 120 VQPVSDDEWLAICALGR-TNP 139


>gi|326405336|ref|YP_004285418.1| hypothetical protein ACMV_31890 [Acidiphilium multivorum AIU301]
 gi|325052198|dbj|BAJ82536.1| hypothetical protein ACMV_31890 [Acidiphilium multivorum AIU301]
          Length = 137

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/138 (56%), Positives = 95/138 (68%), Gaps = 3/138 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP  +SW  Q   G   E WTGVRN+ ARNN++ MRVGD+ FFYHSN GREI
Sbjct: 1   MNYWLVKSEPDAFSWDQQVANGV--EPWTGVRNHAARNNLKAMRVGDRAFFYHSNIGREI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE S  W  VD+ A+  MP PV L AIKA+P L+ + L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTAE-SGDWVAVDMKAIAPMPHPVGLAAIKADPALADLALVRLSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V PV+ + +  +C MG L
Sbjct: 118 VGPVSPEHWAHLCAMGGL 135


>gi|148261832|ref|YP_001235959.1| hypothetical protein Acry_2850 [Acidiphilium cryptum JF-5]
 gi|146403513|gb|ABQ32040.1| protein of unknown function DUF55 [Acidiphilium cryptum JF-5]
          Length = 137

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/138 (56%), Positives = 95/138 (68%), Gaps = 3/138 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP  +SW  Q   G   E WTGVRN+ ARNN++ MRVGD+ FFYHSN GREI
Sbjct: 1   MNYWLVKSEPDAFSWDQQVANGV--EPWTGVRNHAARNNLKAMRVGDRAFFYHSNIGREI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE S  W  VD+ A+  MP PV L AIKA+P L+ + L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTAE-SGDWVAVDMKAIAPMPHPVGLAAIKADPALADLALVRLSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V PV+ + +  +C MG L
Sbjct: 118 VGPVSPEHWAHLCAMGGL 135


>gi|254500353|ref|ZP_05112504.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436424|gb|EEE43103.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 141

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 100/141 (70%), Gaps = 1/141 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP +WSW+ Q+ KG  GE W G+RNYQARNNMR M +GDK FFYHSN G+E+
Sbjct: 1   MQYWLIKSEPDKWSWEQQKAKGDAGEQWDGIRNYQARNNMRAMEIGDKAFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV +  +PD T +    WECVD  AVC MP PV+L  +KA  RL  M L+ S RLS
Sbjct: 61  VGVVEVCSDIHPDTTIDDPR-WECVDFKAVCDMPKPVTLAQVKAESRLEKMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           VQPVT +E+  VC MG +S P
Sbjct: 120 VQPVTEEEWKIVCEMGGMSKP 140


>gi|114765148|ref|ZP_01444292.1| hypothetical protein 1100011001332_R2601_15040 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542423|gb|EAU45450.1| hypothetical protein R2601_15040 [Roseovarius sp. HTCC2601]
          Length = 139

 Score =  159 bits (402), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 79/139 (56%), Positives = 92/139 (66%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M+YWL KSEPS WSW+ Q  KG  GE W GVRNYQARN MR+M VGD GFFYHS K + +
Sbjct: 1   MSYWLFKSEPSTWSWQDQVAKGDAGEEWDGVRNYQARNFMRQMAVGDLGFFYHSQKEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EVI   +PD + +    WECVDI AV +   PV+L  IK  P LS M L+ S+RLS
Sbjct: 61  VGTVEVIAAAHPDSSTDDPR-WECVDIKAVQAAKTPVTLEQIKQKPALSEMALVKSARLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT  E+  VC M  L 
Sbjct: 120 VQPVTEVEWRLVCEMAGLD 138


>gi|56698668|ref|YP_169045.1| hypothetical protein SPO3857 [Ruegeria pomeroyi DSS-3]
 gi|56680405|gb|AAV97071.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 140

 Score =  157 bits (398), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 92/137 (67%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  W W  Q  KG  GE W GVRNYQARN MR M +GD+GFFYHS   + +
Sbjct: 1   MAYWLFKSEPETWGWDDQVAKGDAGEEWDGVRNYQARNFMRAMALGDRGFFYHSQSDKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD  ++    WECVDI AV     PV+L  IKA+PRLS M+L+ +SRLS
Sbjct: 61  VGIVEVCAEVHPDSKSDDPR-WECVDIRAVRPFQQPVTLEQIKADPRLSEMVLVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT  E+  +C MG+
Sbjct: 120 VQPVTEAEWRAICAMGQ 136


>gi|89067492|ref|ZP_01155005.1| hypothetical protein OG2516_11646 [Oceanicola granulosus HTCC2516]
 gi|89047061|gb|EAR53115.1| hypothetical protein OG2516_11646 [Oceanicola granulosus HTCC2516]
          Length = 139

 Score =  157 bits (397), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 92/139 (66%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  WSW  Q  +G  GE W GVRNYQARN MR+M+VGD GFFYHS   + +
Sbjct: 1   MAYWLFKSEPEGWSWDDQVARGEAGEEWDGVRNYQARNVMRQMKVGDLGFFYHSQSDKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T++    WECVDI AV     PV+L  IKA+PR + M L+ ++RLS
Sbjct: 61  VGIVEVIAEAHPDSTSDDDR-WECVDIRAVRPFTRPVTLEQIKADPRFADMALVKNTRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV    +  +C MG  +
Sbjct: 120 VQPVDEAAWRAICEMGDTA 138


>gi|304394320|ref|ZP_07376243.1| thymocyte nuclear protein 1 [Ahrensia sp. R2A130]
 gi|303293760|gb|EFL88137.1| thymocyte nuclear protein 1 [Ahrensia sp. R2A130]
          Length = 145

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 77/143 (53%), Positives = 96/143 (67%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP +WSW+ Q+ KG VGE W G+RNYQARN MR M+VGD+ FFYHSN+G E+
Sbjct: 1   MQYWLFKSEPFKWSWEQQKAKGDVGEEWDGIRNYQARNFMRDMKVGDRAFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD T +    W+CV I A+  +P PV+L  +KA   L+ M L+ S RLS
Sbjct: 61  VGIAEVSAESAPDSTIDDER-WDCVHIRALADVPKPVTLKDVKAMEVLADMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPV   E+  VCRMG +    L
Sbjct: 120 VQPVKRAEWEVVCRMGGIDPDTL 142


>gi|299133152|ref|ZP_07026347.1| protein of unknown function DUF55 [Afipia sp. 1NLS2]
 gi|298593289|gb|EFI53489.1| protein of unknown function DUF55 [Afipia sp. 1NLS2]
          Length = 137

 Score =  156 bits (395), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 77/136 (56%), Positives = 96/136 (70%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ NM KM+ GD  FFYHSN+G+EI
Sbjct: 1   MNYWLVKSEPSTWSWDQQVAKGNKGEAWTGVRNHSAKLNMMKMKKGDLAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++   YPDPT + S  + CVDI A   +  PV+L+A+KA  +L+ M L+  SRLS
Sbjct: 61  VGIVEIVREHYPDPT-DASGKFVCVDIAARKPLKTPVTLVAVKAEAKLADMELLRLSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQ VT  ++  VC+MG
Sbjct: 120 VQAVTPQQWAIVCKMG 135


>gi|254462027|ref|ZP_05075443.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Rhodobacterales bacterium HTCC2083]
 gi|206678616|gb|EDZ43103.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 138

 Score =  156 bits (394), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 76/139 (54%), Positives = 94/139 (67%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W  Q  KG  GE W GVRNYQARN MR M VGD+GFFYHS K + +
Sbjct: 1   MQYWLFKSEPSVWGWDDQVAKGGTGEEWDGVRNYQARNFMRDMSVGDRGFFYHSQKEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI A+  +   V+L  IKA+PRL+ M L+ SSRLS
Sbjct: 61  VGIVEVCKEAHPDSTTDDPR-WECVDIKAIEPLKTAVTLETIKADPRLAEMSLVKSSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV  +E+  +C +G+++
Sbjct: 120 VQPVRAEEWQIICALGEIA 138


>gi|83950375|ref|ZP_00959108.1| hypothetical protein ISM_04735 [Roseovarius nubinhibens ISM]
 gi|83838274|gb|EAP77570.1| hypothetical protein ISM_04735 [Roseovarius nubinhibens ISM]
          Length = 139

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 93/139 (66%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP+ WSW+ QQ KG  GE W GVRNYQARN MR+M VGD+GFFYHS   + +
Sbjct: 1   MRYWLFKSEPATWSWEDQQAKGEAGEEWDGVRNYQARNFMREMAVGDRGFFYHSQTEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T++    WECVDI AV  +   V+L  IKA PRL+ M L+  SRLS
Sbjct: 61  VGIVEVIAEAHPDSTSDDPR-WECVDIRAVAPVARAVTLDEIKAEPRLAEMALLRQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQP    E+  VC M  ++
Sbjct: 120 VQPEREAEWRIVCEMAGVA 138


>gi|89056568|ref|YP_512019.1| hypothetical protein Jann_4077 [Jannaschia sp. CCS1]
 gi|88866117|gb|ABD56994.1| protein of unknown function DUF589 [Jannaschia sp. CCS1]
          Length = 137

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 78/138 (56%), Positives = 91/138 (65%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  WSW  Q  KG  GE W GVRNYQARN MR M VGD+GFFYHS   + +
Sbjct: 1   MAYWLFKSEPGVWSWDDQVAKGDAGEEWDGVRNYQARNFMRDMAVGDRGFFYHSQAEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    W+CVDI AV  +  PV+L  IKA   L+ M L+ S+RLS
Sbjct: 61  VGIVEVCAEAHPDSTTDDDR-WDCVDIKAVKPLAQPVTLGQIKARDDLADMALVKSARLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  VC+MG L
Sbjct: 120 VQPVTDAEWKIVCKMGGL 137


>gi|260575769|ref|ZP_05843765.1| protein of unknown function DUF55 [Rhodobacter sp. SW2]
 gi|259021922|gb|EEW25222.1| protein of unknown function DUF55 [Rhodobacter sp. SW2]
          Length = 139

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 76/139 (54%), Positives = 94/139 (67%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP  WSW  Q  KG  GE W GVRNYQARNNMR M++GD+GFFYHSN G+ +
Sbjct: 1   MRYWLFKSEPDTWSWDQQVAKGDAGEEWHGVRNYQARNNMRAMQIGDQGFFYHSNIGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD T +    W+CV I A+ ++P PVSL A K  P L +M+L+ +SRLS
Sbjct: 61  VGIVEVCRLSAPDSTTDDPR-WDCVHIRALRALPKPVSLDACKVQPGLEAMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT +E+  V  M  + 
Sbjct: 120 VQPVTPEEWRIVLGMAGID 138


>gi|159045952|ref|YP_001534746.1| hypothetical protein Dshi_3412 [Dinoroseobacter shibae DFL 12]
 gi|157913712|gb|ABV95145.1| protein of unknown function DUF55 [Dinoroseobacter shibae DFL 12]
          Length = 139

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 75/139 (53%), Positives = 93/139 (66%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS WSW MQ  KG  GE W GVRNYQARN MR+M +GD+GFFYHS K + I
Sbjct: 1   MRYWLFKSEPSVWSWDMQVAKGDAGEEWDGVRNYQARNFMREMALGDRGFFYHSQKDKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EV    +PD T E    W+CVDI A+  +   V+L  IK++P L  M+L+ ++RLS
Sbjct: 61  VGTVEVCAEAHPDSTTEDDR-WDCVDIRALTPLVRHVTLDEIKSDPALGEMVLVRNARLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT  E+  +C MG + 
Sbjct: 120 VQPVTETEWRRICEMGGVD 138


>gi|83953036|ref|ZP_00961758.1| hypothetical protein NAS141_12046 [Sulfitobacter sp. NAS-14.1]
 gi|83842004|gb|EAP81172.1| hypothetical protein NAS141_12046 [Sulfitobacter sp. NAS-14.1]
          Length = 139

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 77/136 (56%), Positives = 90/136 (66%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M VGD GFFYHS   R I
Sbjct: 1   MAYWLFKSEPSTWGWLDQVAKGDTGEEWDGVRNYQARNFMREMAVGDLGFFYHSQGERAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD + E +  WECVDI AV     PV+L  IKA+ R   M+L+ S RLS
Sbjct: 61  VGIVEVCAAAHPDSSTEDAR-WECVDIKAVRPFEKPVTLDDIKADGRFDDMLLVKSPRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT +++  +C +G
Sbjct: 120 VQPVTAEQWSAICALG 135


>gi|170748166|ref|YP_001754426.1| hypothetical protein Mrad2831_1748 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654688|gb|ACB23743.1| protein of unknown function DUF55 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 138

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 72/139 (51%), Positives = 96/139 (69%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ WSW  Q   G  G  W GVRN+ A+  +  M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPATWSWDQQVAAGEAGTYWNGVRNHLAKKQLMAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI  VI   YPD T +++  +  VD+ AV +MP PV+L AIKA+P L+ M+L+ +SRLS
Sbjct: 61  VGIVAVIRAYYPDHT-DETGRFGMVDVKAVRAMPSPVTLEAIKADPALADMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT  E+  VC +G L 
Sbjct: 120 VQPVTEAEWARVCALGGLG 138


>gi|149912851|ref|ZP_01901385.1| hypothetical protein RAZWK3B_02645 [Roseobacter sp. AzwK-3b]
 gi|149813257|gb|EDM73083.1| hypothetical protein RAZWK3B_02645 [Roseobacter sp. AzwK-3b]
          Length = 139

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 93/139 (66%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP  WSW  Q  KG  GE W GVRNYQARN MR M++GD+GFFYHS   + +
Sbjct: 1   MRYWLFKSEPEAWSWNDQVAKGDSGEEWDGVRNYQARNFMRDMKLGDRGFFYHSQTEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   +PD  A+    W+CVDI AV  +  PV+L  IK +PRLS M+L+ S RLS
Sbjct: 61  VGIVEIIAEAHPDSKADDPR-WDCVDIKAVEPVKTPVTLETIKGDPRLSDMMLVKSPRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV+  E+  +C M  ++
Sbjct: 120 VQPVSEGEWRIICDMAGVT 138


>gi|296533505|ref|ZP_06896080.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Roseomonas cervicalis
           ATCC 49957]
 gi|296266180|gb|EFH12230.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Roseomonas cervicalis
           ATCC 49957]
          Length = 137

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 95/140 (67%), Gaps = 3/140 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW+ Q + G   E WTGVRN QA  N+R MR+GD+ FFYHSN G+EI
Sbjct: 1   MAYWLVKSEPDAFSWQQQVENGV--EPWTGVRNAQAAKNLRAMRLGDRAFFYHSNVGKEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV    YPDPT E+S  W CVD+ AV  MP PV+L  IK  P L+ + LI  SRLS
Sbjct: 59  VGVVEVAREAYPDPT-EESGRWACVDMRAVGPMPRPVTLAEIKTVPELAGIGLIRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           V PV+ + +  +CRMG  + 
Sbjct: 118 VMPVSDEHWALLCRMGGFAG 137


>gi|21328629|gb|AAM48635.1| conserved hypothetical protein [uncultured marine proteobacterium]
          Length = 136

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 94/137 (68%), Gaps = 4/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ WSW  QQ KG VGE W GVRNYQARNNMR M++GD+ FFYHS   + I
Sbjct: 1   MAYWLFKSEPATWSWADQQAKGAVGEEWDGVRNYQARNNMRAMQLGDQAFFYHSQSEKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++ D T E    WECVDI A+ S+  PV+L   KA+ RL+ M L+  +RLS
Sbjct: 61  VGIVEVCALSHQDSTTEDPR-WECVDIRAIRSLTKPVTLHMCKADHRLADMALVKYTRLS 119

Query: 121 VQPVTTDEY---LEVCR 134
           VQPV  +E+   LE+ R
Sbjct: 120 VQPVRAEEWGIILELSR 136


>gi|83941987|ref|ZP_00954449.1| hypothetical protein EE36_07123 [Sulfitobacter sp. EE-36]
 gi|83847807|gb|EAP85682.1| hypothetical protein EE36_07123 [Sulfitobacter sp. EE-36]
          Length = 139

 Score =  154 bits (388), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 77/136 (56%), Positives = 90/136 (66%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M VGD GFFYHS   R I
Sbjct: 1   MAYWLFKSEPSTWGWPDQVAKGDAGEEWDGVRNYQARNFMREMAVGDLGFFYHSQGERAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD + E +  WECVDI AV     PV+L  IKA+ R   M L+ S RLS
Sbjct: 61  VGIVEVCAAAHPDSSTEDAR-WECVDIKAVRPFEKPVTLDDIKADGRFDDMPLVKSPRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT++++  +C +G
Sbjct: 120 VQPVTSEQWSAICALG 135


>gi|162149206|ref|YP_001603667.1| hypothetical protein GDI_3436 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545054|ref|YP_002277283.1| hypothetical protein Gdia_2937 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787783|emb|CAP57379.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532731|gb|ACI52668.1| protein of unknown function DUF55 [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 138

 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 95/136 (69%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW  Q   G   E WTGVR++QA+ N+  M  GD+ FFYHSN G+EI
Sbjct: 1   MAYWLVKSEPDAFSWDQQVANGV--EPWTGVRSHQAKRNLMAMARGDRAFFYHSNIGKEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ E++   YPDPTAE S  W CVD+ AV  MP PV+L AIKA+P L+ + L+  SRLS
Sbjct: 59  VGVVEIVREAYPDPTAE-SGAWVCVDVRAVGPMPHPVTLAAIKADPDLADLALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V PV+  ++  +CRMG
Sbjct: 118 VVPVSDTQWGHLCRMG 133


>gi|254559407|ref|YP_003066502.1| hypothetical protein METDI0831 [Methylobacterium extorquens DM4]
 gi|254266685|emb|CAX22465.1| conserved hypothethical protein (DUF589) [Methylobacterium
           extorquens DM4]
          Length = 140

 Score =  153 bits (387), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 76/136 (55%), Positives = 93/136 (68%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q + G  G  W GVRN+ A+  M+ M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPSTWSWDQQVEAGEGGTFWNGVRNHLAKKQMQAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VD+ AV  MP PVSL AIKA   L  M L+ +SRLS
Sbjct: 61  VGIVEVIKPYYPDHT-DESGRFGMVDVRAVAPMPRPVSLDAIKAATALKDMALVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  VC MG
Sbjct: 120 VQPVTEAEWATVCAMG 135


>gi|218528774|ref|YP_002419590.1| hypothetical protein Mchl_0742 [Methylobacterium chloromethanicum
           CM4]
 gi|218521077|gb|ACK81662.1| protein of unknown function DUF55 [Methylobacterium
           chloromethanicum CM4]
          Length = 140

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 93/136 (68%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q + G  G  W GVRN+ A+  M+ M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPSTWSWDQQVEAGEGGTFWNGVRNHLAKKQMQAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VD+ AV  MP PV+L AIKA   L  M L+ +SRLS
Sbjct: 61  VGIVEVIKPYYPDHT-DESGRFGMVDVRAVAPMPRPVTLDAIKATTALKDMALVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  VC MG
Sbjct: 120 VQPVTEAEWATVCAMG 135


>gi|296116767|ref|ZP_06835374.1| hypothetical protein GXY_13223 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976689|gb|EFG83460.1| hypothetical protein GXY_13223 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 137

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 76/136 (55%), Positives = 91/136 (66%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW  Q       E WTGVRN+QA+ N+  M VGD  FFYHSN GREI
Sbjct: 1   MAYWLVKSEPDAFSWDEQVANNV--EPWTGVRNHQAKKNLMAMAVGDLAFFYHSNVGREI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ E++   YPDPTA Q   W CVD+ AV  MP PV+L  IKA+P LS + L+  SRLS
Sbjct: 59  VGVVEIVRAAYPDPTAPQGG-WVCVDVRAVGPMPTPVTLARIKADPVLSDLALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V PV+   +  +CRMG
Sbjct: 118 VVPVSDAHWSHLCRMG 133


>gi|163850169|ref|YP_001638212.1| hypothetical protein Mext_0729 [Methylobacterium extorquens PA1]
 gi|240137302|ref|YP_002961771.1| hypothetical protein MexAM1_META1p0555 [Methylobacterium extorquens
           AM1]
 gi|163661774|gb|ABY29141.1| protein of unknown function DUF55 [Methylobacterium extorquens PA1]
 gi|240007268|gb|ACS38494.1| conserved hypothetical protein (DUF589) [Methylobacterium
           extorquens AM1]
          Length = 140

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 93/136 (68%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q + G  G  W GVRN+ A+  M+ M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPSTWSWDQQVEAGEGGTFWNGVRNHLAKKQMQAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VD+ AV  MP PV+L AIKA   L  M L+ +SRLS
Sbjct: 61  VGIVEVIKPYYPDHT-DESGRFGMVDVRAVAPMPRPVTLDAIKAATALKDMALVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  VC MG
Sbjct: 120 VQPVTEAEWATVCAMG 135


>gi|170740413|ref|YP_001769068.1| hypothetical protein M446_2173 [Methylobacterium sp. 4-46]
 gi|168194687|gb|ACA16634.1| protein of unknown function DUF55 [Methylobacterium sp. 4-46]
          Length = 137

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 96/138 (69%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL KSEPS WSW  Q+  G  G  W GVRN+ A+ +++ MR G++GFFYHSN+G+ +
Sbjct: 1   MPHWLFKSEPSTWSWDQQEAAGEAGTFWNGVRNHLAKKHLQAMRTGEQGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EVI   YPD T ++S  +  VD+ AV  +P PV+L AIKA PRL  M+L+ +SRLS
Sbjct: 61  VGLVEVIRPYYPDHT-DESGKFGMVDVRAVARLPRPVTLDAIKAEPRLKDMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  +  MG L
Sbjct: 120 VQPVTEEEWAVIRAMGGL 137


>gi|188579970|ref|YP_001923415.1| hypothetical protein Mpop_0702 [Methylobacterium populi BJ001]
 gi|179343468|gb|ACB78880.1| protein of unknown function DUF55 [Methylobacterium populi BJ001]
          Length = 139

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 92/136 (67%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q + G  G  W GVRN+ A+  M+ M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPSTWSWDQQVEAGEGGTFWNGVRNHLAKKQMQAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VD+ AV  MP PV L AIKA   L  M L+ +SRLS
Sbjct: 61  VGIVEVIKPYYPDHT-DESGRFGMVDLRAVAPMPRPVGLDAIKAEAALKDMALVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  +C MG
Sbjct: 120 VQPVTEAEWARICAMG 135


>gi|154251794|ref|YP_001412618.1| hypothetical protein Plav_1341 [Parvibaculum lavamentivorans DS-1]
 gi|154155744|gb|ABS62961.1| protein of unknown function DUF55 [Parvibaculum lavamentivorans
           DS-1]
          Length = 141

 Score =  152 bits (383), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 91/142 (64%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q+ KG  GE W GVRNYQA NNM+ M+ GD GFFYHS   + I
Sbjct: 1   MAYWLFKSEPSTWSWDDQKKKGAKGEPWNGVRNYQANNNMKAMKKGDLGFFYHSVDEKSI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI  VI    PDPT E+   +  V I AV  MP PV+L  +K  P L  M+L  +SRLS
Sbjct: 61  VGIVRVIGEHRPDPTDEKGK-FGLVVIEAVEDMPKPVTLDDVKKEPALHDMVLANNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPV  +E+  VC+MG L   P
Sbjct: 120 VQPVRDEEWKLVCKMGGLKKAP 141


>gi|154245056|ref|YP_001416014.1| hypothetical protein Xaut_1108 [Xanthobacter autotrophicus Py2]
 gi|154159141|gb|ABS66357.1| protein of unknown function DUF55 [Xanthobacter autotrophicus Py2]
          Length = 163

 Score =  151 bits (382), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 93/136 (68%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP +WSW MQ   G  G  W GVRN+ A+  +  M+ GD+GFFYHSN+G+EI
Sbjct: 27  MAHWLYKSEPFKWSWDMQVKAGAKGTHWDGVRNHLAKQQLLAMKKGDRGFFYHSNEGKEI 86

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPDP+ + S  +  VDI AV  +  PV+L A+KA PRL  M LI  SRLS
Sbjct: 87  VGIVEVIKEAYPDPS-DPSGKFFMVDIKAVKPLKTPVTLAAVKAEPRLQEMALIKFSRLS 145

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPV+ +E+  VC MG
Sbjct: 146 VQPVSDEEWDIVCGMG 161


>gi|254485940|ref|ZP_05099145.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Roseobacter
           sp. GAI101]
 gi|214042809|gb|EEB83447.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Roseobacter
           sp. GAI101]
          Length = 139

 Score =  151 bits (381), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 88/136 (64%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M  GD GFFYHS   R I
Sbjct: 1   MAYWLFKSEPSTWGWDDQVAKGDTGEEWDGVRNYQARNFMREMAKGDLGFFYHSQGERAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   + D + +    WECVDI AV     PV+L  IK++ R   M L+ S RLS
Sbjct: 61  VGIVEVIAEAHQDSSTDDDR-WECVDIKAVRPFETPVTLDDIKSDGRFDDMPLVKSPRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT +++ ++C MG
Sbjct: 120 VQPVTAEQWQQICAMG 135


>gi|119384733|ref|YP_915789.1| hypothetical protein Pden_2001 [Paracoccus denitrificans PD1222]
 gi|119374500|gb|ABL70093.1| protein of unknown function DUF55 [Paracoccus denitrificans PD1222]
          Length = 141

 Score =  150 bits (379), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 90/129 (69%), Gaps = 1/129 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  +S+     KG  GE W GVRNYQARNNMR M+ G++GFFYHSN G+EI
Sbjct: 1   MAYWLFKSEPDVFSFDDLIAKGETGEQWDGVRNYQARNNMRAMKKGERGFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD TA+    WECVD+ AV  +  P+SL   KA PRL  M+L+ +SRLS
Sbjct: 61  VGICEVAAEAHPDSTADDPK-WECVDVRAVARVRRPISLDEAKAEPRLKDMVLVNNSRLS 119

Query: 121 VQPVTTDEY 129
           VQPV+  E+
Sbjct: 120 VQPVSDAEW 128


>gi|209883484|ref|YP_002287341.1| protein of unknown function DUF55 [Oligotropha carboxidovorans OM5]
 gi|209871680|gb|ACI91476.1| protein of unknown function DUF55 [Oligotropha carboxidovorans OM5]
          Length = 137

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 74/138 (53%), Positives = 94/138 (68%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEPS WSW  Q   G+ GE WTGVRN+ A+ NM KM+ GD+ FFYHSN+G+EI
Sbjct: 1   MNYWLVKSEPSVWSWDQQVANGKKGEPWTGVRNHSAKLNMMKMKKGDRAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++   YPDPT + +  + CVDI A   +  PV+L A+K    L+ M L+  SRLS
Sbjct: 61  VGIVEIVREHYPDPT-DATGKFVCVDIIAGKPLKKPVTLTAVKGEAALADMELLRLSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT  ++  VC+MG L
Sbjct: 120 VQSVTPAQWKHVCKMGGL 137


>gi|217977110|ref|YP_002361257.1| protein of unknown function DUF55 [Methylocella silvestris BL2]
 gi|217502486|gb|ACK49895.1| protein of unknown function DUF55 [Methylocella silvestris BL2]
          Length = 139

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/139 (51%), Positives = 97/139 (69%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL+KSEPS WSW  Q + G+ G  W GVRN+ A+ N+  M+VG++ FFYHSN+G+EI
Sbjct: 1   MAHWLLKSEPSSWSWDKQVEAGKKGTFWNGVRNHSAKLNLMAMKVGEEAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDP+ + S  +  VD+ A   +  PV+L AIKA+PRL  MIL+ +SRLS
Sbjct: 61  VGIVEIIKPYYPDPS-DASGKFGMVDVRAKTPLKRPVTLEAIKADPRLKDMILVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV+  E+  +C  G L 
Sbjct: 120 VQPVSEAEWNIICAEGGLG 138


>gi|220921144|ref|YP_002496445.1| hypothetical protein Mnod_1136 [Methylobacterium nodulans ORS 2060]
 gi|219945750|gb|ACL56142.1| protein of unknown function DUF55 [Methylobacterium nodulans ORS
           2060]
          Length = 137

 Score =  149 bits (376), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 94/136 (69%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEPS WSW  Q   G  G  W GVRN+ A+ +++ M+ G++GFFYHSN+G+ +
Sbjct: 1   MAHWLFKSEPSTWSWDQQVAAGEAGTFWNGVRNHLAKKHLQAMQRGEQGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VDI AV  +P PV+L AIKA PRL  M+L+ ++RLS
Sbjct: 61  VGIVEVIRTYYPDHT-DESGRFGMVDIKAVTGLPRPVTLDAIKAEPRLKDMVLVNNARLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  +  MG
Sbjct: 120 VQPVTEAEWAVIRAMG 135


>gi|163797979|ref|ZP_02191921.1| hypothetical protein BAL199_06951 [alpha proteobacterium BAL199]
 gi|159176773|gb|EDP61344.1| hypothetical protein BAL199_06951 [alpha proteobacterium BAL199]
          Length = 139

 Score =  147 bits (372), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 90/137 (65%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  WSW  Q  KG VGE W GVRNYQA NNM+ M VGD+GFFYHS   + I
Sbjct: 1   MAYWLFKSEPGAWSWDDQVAKGDVGEGWNGVRNYQAANNMKAMVVGDRGFFYHSVDEKRI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PDPT ++S  +  V I A+  +  PV+L  +KA PRL    L+  SRLS
Sbjct: 61  VGIVEVIETYHPDPT-DESGRFGMVTIKAIKPVNKPVTLADVKAEPRLEGFALVRQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           V PVT D++  +C M +
Sbjct: 120 VVPVTDDQWELLCGMAE 136


>gi|58040086|ref|YP_192050.1| hypothetical protein GOX1653 [Gluconobacter oxydans 621H]
 gi|58002500|gb|AAW61394.1| Hypothetical protein GOX1653 [Gluconobacter oxydans 621H]
          Length = 138

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/141 (51%), Positives = 91/141 (64%), Gaps = 3/141 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEP  +SW  Q D G   E WTGVRNYQARNN+  M+ GD   FYHS   + I
Sbjct: 1   MAFWLVKSEPEAFSWAQQLDHGV--EPWTGVRNYQARNNLSAMKNGDLALFYHSVSEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE    W CVD+ A+ +   PVSL  IKA+P L+ M L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTAEDPR-WVCVDVKAMGAFAHPVSLADIKADPALAEMALLKQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           V PVT  E+  + ++G  + P
Sbjct: 118 VAPVTETEFRHLTQIGGWTRP 138


>gi|84684553|ref|ZP_01012454.1| hypothetical protein 1099457000260_RB2654_13049 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667532|gb|EAQ14001.1| hypothetical protein RB2654_13049 [Rhodobacterales bacterium
           HTCC2654]
          Length = 137

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 72/136 (52%), Positives = 90/136 (66%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP+ W W  Q  KG  GE W GVRNYQARNNMR+M++GD GFFYHS   + +
Sbjct: 1   MRYWLFKSEPNAWGWDDQVAKGEAGEEWDGVRNYQARNNMREMKLGDLGFFYHSVDEKRV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  +  PV+L   K +PRL+ M+L+ ++RLS
Sbjct: 61  VGIVEVCKEIHPDSTTDDPR-WECVDIKAVRPVKKPVTLDMCKNDPRLADMVLVNNTRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  V  + 
Sbjct: 120 VQPVTEAEWNVVLELA 135


>gi|158421889|ref|YP_001523181.1| hypothetical protein AZC_0265 [Azorhizobium caulinodans ORS 571]
 gi|158328778|dbj|BAF86263.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 137

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (70%), Gaps = 1/129 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP +WSW  Q   G  G  W GVRN+ A+  ++ M++GD+GFFYHSN+G+EI
Sbjct: 1   MAHWLYKSEPFKWSWDQQVKAGAKGTHWDGVRNHLAKQQLQAMKLGDQGFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPDP+ + +  +  VD+ AV ++  PV+L  IKA PRL +M LI  SRLS
Sbjct: 61  VGIVEVIREFYPDPS-DATGKFGMVDLKAVRALKKPVTLATIKAEPRLENMALIKFSRLS 119

Query: 121 VQPVTTDEY 129
           VQPVT +E+
Sbjct: 120 VQPVTDEEW 128


>gi|144898290|emb|CAM75154.1| protein containing DUF589 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 137

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/139 (52%), Positives = 93/139 (66%), Gaps = 3/139 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  WSW  Q   G    AWTGVRNYQA N ++ M +GD+ FFYHS   + I
Sbjct: 1   MAYWLVKSEPGAWSWDDQVRDGVT--AWTGVRNYQASNFLKAMTLGDRCFFYHSVNEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV+   YPDPTA+    W C D+ AVC++P PV+L  IKA+PRL+ + LI  SRLS
Sbjct: 59  VGIVEVVREAYPDPTADDPR-WVCPDLKAVCAVPNPVTLADIKADPRLAELPLIRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           V P+  + +  +C M K++
Sbjct: 118 VMPMDDESWALICAMAKVT 136


>gi|298292777|ref|YP_003694716.1| hypothetical protein Snov_2809 [Starkeya novella DSM 506]
 gi|296929288|gb|ADH90097.1| protein of unknown function DUF55 [Starkeya novella DSM 506]
          Length = 139

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 73/136 (53%), Positives = 90/136 (66%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP +WSW  Q   G  G  W GVRN+ A+ N+  M+ GD+GFFYHSN+G+EI
Sbjct: 1   MAHWLYKSEPFKWSWDNQVAAGAKGTHWDGVRNHAAKLNLLAMKKGDRGFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPDP+ + +  +  VDI AV  +  PVSL A+K  PRL+ M LI  SRLS
Sbjct: 61  VGIVEVIKEAYPDPS-DPTGRFFMVDIKAVEPLKQPVSLAAVKEEPRLAEMALIKFSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  V  M 
Sbjct: 120 VQPVTDAEWAIVLEMA 135


>gi|196228807|ref|ZP_03127673.1| protein of unknown function DUF55 [Chthoniobacter flavus Ellin428]
 gi|196227088|gb|EDY21592.1| protein of unknown function DUF55 [Chthoniobacter flavus Ellin428]
          Length = 143

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 89/134 (66%), Gaps = 3/134 (2%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGI 63
           W+VKSEP+ + W    D GR   AWTGVRN+ AR N+R MR GD+  FYHS +G+EIVG+
Sbjct: 9   WMVKSEPTAYGWSTFVDDGRT--AWTGVRNFTARLNLRAMRKGDRVLFYHSVEGKEIVGL 66

Query: 64  FEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQP 123
            EV    YPDPTA++   W CVD+  V  +P PV+L  IK NP+L  M L+  SRLSV P
Sbjct: 67  AEVAAEAYPDPTAKEGD-WSCVDLVPVKPLPRPVTLAEIKENPKLQEMKLLRQSRLSVMP 125

Query: 124 VTTDEYLEVCRMGK 137
           +T  E+ E+ RM K
Sbjct: 126 ITPAEFAEIERMSK 139


>gi|288959280|ref|YP_003449621.1| hypothetical protein AZL_024390 [Azospirillum sp. B510]
 gi|288911588|dbj|BAI73077.1| hypothetical protein AZL_024390 [Azospirillum sp. B510]
          Length = 139

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 93/141 (65%), Gaps = 3/141 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP ++SW      GR    W GVRNYQA NN++ M VGD+ FFYHSN+G EI
Sbjct: 1   MAYWLVKSEPFKYSWDRMVADGRT--HWDGVRNYQASNNLKAMEVGDRAFFYHSNEGLEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++   YPDP+ ++S  +  VD+  V  +  PV+L  IKA+P L SM L+  SRLS
Sbjct: 59  VGIVEIVRTYYPDPS-DESGRFGMVDVAPVTPVRTPVTLKQIKADPLLQSMALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           V PV+ DE+  VC +  +  P
Sbjct: 118 VCPVSDDEWTRVCDLAGVGVP 138


>gi|114326937|ref|YP_744094.1| hypothetical protein GbCGDNIH1_0273 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315111|gb|ABI61171.1| hypothetical protein GbCGDNIH1_0273 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 153

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 90/142 (63%), Gaps = 9/142 (6%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           AYWLVKSEP  +SW  Q   G   E WTGVRN+ A+ N+  MRVGD  FFYHSN GREIV
Sbjct: 3   AYWLVKSEPDAFSWDQQVAHGV--EPWTGVRNHAAKRNLATMRVGDLAFFYHSNIGREIV 60

Query: 62  GIFEVITCTYPDPTAEQ-------SSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILI 114
           G+ +V+   YPDPT E        S+ W CVD+ AV  MP PV+L  IKA P L+ + L+
Sbjct: 61  GVVQVVREAYPDPTVEADELSRDGSNPWLCVDMRAVGKMPSPVTLAMIKAEPGLADLALV 120

Query: 115 VSSRLSVQPVTTDEYLEVCRMG 136
             SRLSV  V+   +  +CRMG
Sbjct: 121 RQSRLSVSSVSPQHWAILCRMG 142


>gi|182680121|ref|YP_001834267.1| hypothetical protein Bind_3218 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636004|gb|ACB96778.1| protein of unknown function DUF55 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 144

 Score =  143 bits (360), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 96/137 (70%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL+KSEP++WSW  Q    R G  W GVRN+ A+ ++  M+VG++ FFYHSN G+ +
Sbjct: 1   MAHWLIKSEPNKWSWDDQVKAAREGTFWNGVRNHLAKQHLMAMKVGEQVFFYHSNIGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPDP+ + +  +  VD+ A      PV+L AIKA+PRLS MIL+ +SRLS
Sbjct: 61  VGIAEVIKPYYPDPS-DATGKFGMVDVRARQPFAKPVTLEAIKADPRLSDMILVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT +E+  +C +G+
Sbjct: 120 VQPVTDEEWTIICGLGE 136


>gi|312116198|ref|YP_004013794.1| hypothetical protein Rvan_3515 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221327|gb|ADP72695.1| protein of unknown function DUF55 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 141

 Score =  143 bits (360), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 89/141 (63%), Gaps = 1/141 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL K+EP  +SW  Q   G  GE W+GVRN  A+ NMR M+ GD GFFYHS   + I
Sbjct: 1   MAYWLFKTEPGTFSWDDQLKAGGKGEEWSGVRNALAQKNMRAMKKGDLGFFYHSVNEKRI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+  V+   +PD T + +  W CVD+ AV   P PV+L  IK  P+L+ M L+  SRLS
Sbjct: 61  VGVVRVLNEIHPDST-DPTGRWNCVDVEAVAPFPEPVTLAEIKGEPQLADMALVKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           VQPVT +E+  VCRMG    P
Sbjct: 120 VQPVTAEEWDIVCRMGGYKPP 140


>gi|23015468|ref|ZP_00055243.1| COG2947: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 137

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 90/136 (66%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEP  WSW  Q   G    AWTGVRNYQA NN++ M++GDK FFYHS   + I
Sbjct: 1   MAFWLVKSEPGAWSWDDQMRDGVT--AWTGVRNYQACNNLKAMKLGDKAFFYHSVDEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE    W C D+ AV  +  P++L  IKA+PRL+ + L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTAEDPR-WMCPDLKAVAPLARPITLAEIKADPRLAELPLLRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V PV  D +  +C +G
Sbjct: 118 VCPVDADAWRLICDLG 133


>gi|294085045|ref|YP_003551805.1| hypothetical protein SAR116_1478 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664620|gb|ADE39721.1| Protein of unknown function DUF589 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 139

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEPS WSW+ Q D+G  GE W GVRNYQA NNM+ M++GD  FFYHS   ++I
Sbjct: 1   MQYWLLKSEPSSWSWQDQLDRGDAGEGWDGVRNYQASNNMKAMQIGDLAFFYHSVNEKQI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PDPT + S  +  V + AV ++  PV+L +IKA+ RL  M L+  +RLS
Sbjct: 61  VGIVEICALYHPDPT-DASGRFGMVTVKAVKNVSKPVTLASIKADERLQDMALVRQARLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           V PVT  ++  +  M + +
Sbjct: 120 VTPVTEPQWRIIMDMAETT 138


>gi|83594902|ref|YP_428654.1| hypothetical protein Rru_A3573 [Rhodospirillum rubrum ATCC 11170]
 gi|83577816|gb|ABC24367.1| Protein of unknown function DUF589 [Rhodospirillum rubrum ATCC
           11170]
          Length = 135

 Score =  139 bits (350), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 92/138 (66%), Gaps = 3/138 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW+ Q DKG   E W GVRN+QA N+M+ MR+GD+ FFYHS   + I
Sbjct: 1   MAYWLVKSEPSTWSWQNQLDKGI--EHWDGVRNHQASNHMKAMRLGDQAFFYHSVNEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV+   YPDPT + +  +  VD  A+ ++P PV+L  IKA+PRLS + L+  SRLS
Sbjct: 59  VGIVEVVKEYYPDPT-DPAHRFGMVDFKALHTLPTPVTLAMIKADPRLSHLGLVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V  V    +  +  +G L
Sbjct: 118 VSSVDEASWGLIRGLGGL 135


>gi|323137591|ref|ZP_08072668.1| protein of unknown function DUF55 [Methylocystis sp. ATCC 49242]
 gi|322397217|gb|EFX99741.1| protein of unknown function DUF55 [Methylocystis sp. ATCC 49242]
          Length = 139

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 91/136 (66%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL+KSEPS WSW  Q   G  G  W GVRN+ A+ ++  M+ G++GFFYHSN+ R I
Sbjct: 1   MAHWLLKSEPSTWSWDQQVAAGAKGTFWNGVRNHLAKKHLMVMQKGERGFFYHSNEERAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPD T +++  +  VD+ AV  +  PV+L  IKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEIIKTYYPDHT-DETGKFGMVDVKAVKPLKQPVTLGDIKAEPRLADMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  +  M 
Sbjct: 120 VQPVTDAEWAVIMEMA 135


>gi|83313274|ref|YP_423538.1| hypothetical protein amb4175 [Magnetospirillum magneticum AMB-1]
 gi|82948115|dbj|BAE52979.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 137

 Score =  138 bits (347), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 91/139 (65%), Gaps = 3/139 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEP  WSW  Q   G    AWTGVRNYQA NN++ M++GD+ FFYHS   + I
Sbjct: 1   MAFWLVKSEPGAWSWDDQVRDGVT--AWTGVRNYQACNNLKAMKLGDRAFFYHSVDEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE    W C D+ AV  +  PV+L  IKA+PRL+ + L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTAEDPR-WMCPDLKAVAPLARPVTLAEIKADPRLAELPLLRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           V PV    +  +C +G ++
Sbjct: 118 VCPVDEASWRLLCDLGGVT 136


>gi|258541995|ref|YP_003187428.1| hypothetical protein APA01_09010 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633073|dbj|BAH99048.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636130|dbj|BAI02099.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639185|dbj|BAI05147.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642239|dbj|BAI08194.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645294|dbj|BAI11242.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648349|dbj|BAI14290.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651402|dbj|BAI17336.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654393|dbj|BAI20320.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 139

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 73/141 (51%), Positives = 92/141 (65%), Gaps = 3/141 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW  Q   G   E WTGVRN+QA+ N+  M+ GD+ FFYHSN  R I
Sbjct: 1   MAYWLVKSEPDAFSWDEQVANGV--EPWTGVRNHQAKKNLAAMKAGDRAFFYHSNVQRAI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE +  W CVD+ A+  MP PV+L  IKA P L  + L+  SRLS
Sbjct: 59  VGVVEVVREGYPDPTAE-TDKWVCVDVKAIAPMPTPVTLAQIKAEPTLEDLALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           V PV+ + +  +C MG+   P
Sbjct: 118 VCPVSAEHWQILCDMGEWQEP 138


>gi|296447227|ref|ZP_06889157.1| protein of unknown function DUF55 [Methylosinus trichosporium OB3b]
 gi|296255286|gb|EFH02383.1| protein of unknown function DUF55 [Methylosinus trichosporium OB3b]
          Length = 136

 Score =  136 bits (343), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 89/136 (65%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW      G  G  W GVRN+ A+  M  M++G++GFFYHSN  + I
Sbjct: 1   MAHWLFKSEPATWSWDQMVAAGAEGTFWNGVRNHLAKQQMMAMQLGERGFFYHSNAEKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T + +  +  VD+ AV  +  PVSL  IKA+PRLS+MIL+ +SRLS
Sbjct: 61  VGIVEVIRTYHPDHT-DPTGKFGMVDVKAVEPLKTPVSLARIKADPRLSAMILVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+  +  M 
Sbjct: 120 VQPVTEAEWELILSMA 135


>gi|255595834|ref|XP_002536398.1| conserved hypothetical protein [Ricinus communis]
 gi|223519820|gb|EEF25986.1| conserved hypothetical protein [Ricinus communis]
          Length = 104

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 78/103 (75%)

Query: 40  MRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSL 99
           MR M++GDKGFFYHSN+G EIVGI EV   ++PD +A+    W+CVDI AV  MP PV+L
Sbjct: 1   MRAMQIGDKGFFYHSNEGLEIVGIVEVCALSHPDSSAKGDPKWDCVDIRAVMDMPKPVTL 60

Query: 100 MAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPP 142
             +KA+ +LS M L+ S RLSVQPVT DE+LEVCRMG L NPP
Sbjct: 61  KDVKASEKLSKMSLVTSMRLSVQPVTDDEWLEVCRMGGLDNPP 103


>gi|329114246|ref|ZP_08243008.1| Hypothetical protein APO_1032 [Acetobacter pomorum DM001]
 gi|326696322|gb|EGE48001.1| Hypothetical protein APO_1032 [Acetobacter pomorum DM001]
          Length = 139

 Score =  134 bits (338), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 73/141 (51%), Positives = 90/141 (63%), Gaps = 3/141 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW  Q   G   E WTGVRN+QA+ N+  M+ GD+ FFYHSN  R I
Sbjct: 1   MAYWLVKSEPDAFSWDEQVANGV--EPWTGVRNHQAKKNLAAMKAGDRAFFYHSNVQRAI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE +  W CVD+ A+  MP PV+L  IKA P L  + L+  SRLS
Sbjct: 59  VGVVEVVREGYPDPTAE-TDKWVCVDVKAIAPMPNPVTLAQIKAEPTLEDLALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           V PV+   +  +C MG    P
Sbjct: 118 VCPVSAAHWQILCEMGGWQEP 138


>gi|312132184|ref|YP_003999524.1| hypothetical protein Lbys_3523 [Leadbetterella byssophila DSM
           17132]
 gi|311908730|gb|ADQ19171.1| protein of unknown function DUF55 [Leadbetterella byssophila DSM
           17132]
          Length = 136

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 69/136 (50%), Positives = 86/136 (63%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP ++SW     KG  G+ W GVRNY ARNN++ M+ GD  FFYHSN+G EI
Sbjct: 1   MNYWLVKSEPFKFSWDTFVSKG--GDMWDGVRNYAARNNLKAMKEGDLVFFYHSNEGLEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ +V    YPDPTA+    W  VD+  V  +  PVSL  IKA+P L  M ++  SRLS
Sbjct: 59  VGLAKVTKEHYPDPTADDPK-WVVVDLVPVKKLNKPVSLAQIKADPVLQQMAIVRLSRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V PVT  E+  V  + 
Sbjct: 118 VSPVTPTEFDRVMDLA 133


>gi|332666965|ref|YP_004449753.1| hypothetical protein Halhy_5054 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332335779|gb|AEE52880.1| Uncharacterized protein family UPF0310 [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 134

 Score =  132 bits (333), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 90/137 (65%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WLVKSEP  +S+   + +GR    W GVRNY ARNN+R M+ GD+  FYHSN G E+
Sbjct: 1   MNFWLVKSEPDAYSYDKLEAEGR--GMWDGVRNYAARNNLRAMKEGDQVLFYHSNIGMEV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V    YPDPTAE S  W  V++  V  +  P++L  IKA P L+++ LI  SRLS
Sbjct: 59  VGICQVAKEHYPDPTAE-SGDWSVVEVIPVRRIKRPITLKEIKATPELANIALIKQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V P+T +E+ ++ +M K
Sbjct: 118 VMPLTAEEFEKILKMSK 134


>gi|209965641|ref|YP_002298556.1| hypothetical protein RC1_2357 [Rhodospirillum centenum SW]
 gi|209959107|gb|ACI99743.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 137

 Score =  130 bits (327), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 91/139 (65%), Gaps = 3/139 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEP ++SW      GR    W GVRN+QA NN++ MRVGD+ FFYHSN+G EI
Sbjct: 1   MAHWLVKSEPFKYSWDRFVADGRT--HWDGVRNHQAANNLKAMRVGDRAFFYHSNEGLEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDP+ + S  +  VD+  V  +  PV+L  +K +P LS M L+  SRLS
Sbjct: 59  VGVAEVVREYYPDPS-DGSGRFGMVDLAPVLPVRVPVTLKQMKEDPLLSQMQLVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           V  VT +++  VC +  ++
Sbjct: 118 VSAVTPEQWDRVCALAGIT 136


>gi|312891707|ref|ZP_07751216.1| protein of unknown function DUF55 [Mucilaginibacter paludis DSM
           18603]
 gi|311295790|gb|EFQ72950.1| protein of unknown function DUF55 [Mucilaginibacter paludis DSM
           18603]
          Length = 134

 Score =  129 bits (325), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 90/136 (66%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WLVKSEP ++SW+     GR    W GVRNYQARNN+R+M+ GD   +YHSN+G+ +
Sbjct: 1   MQHWLVKSEPVKYSWEKFNQDGRT--FWDGVRNYQARNNLREMKEGDLVLYYHSNEGKAV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT +  + W  VD+  V ++  PV+L  IKA+P+L+++ L+   RLS
Sbjct: 59  VGIAKVVKAFYQDPTTDDKN-WVVVDLVPVETIKNPVTLEQIKADPQLANISLVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+  +E+  +  +G
Sbjct: 118 VMPLKAEEFDRILELG 133


>gi|330993813|ref|ZP_08317745.1| Thymocyte nuclear protein 1 [Gluconacetobacter sp. SXCC-1]
 gi|329759081|gb|EGG75593.1| Thymocyte nuclear protein 1 [Gluconacetobacter sp. SXCC-1]
          Length = 109

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 77/106 (72%), Gaps = 1/106 (0%)

Query: 31  VRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAV 90
           +RN+QA+ N+  MRVGD+ FFYHSN GREIVG+ EV+   YPDPTA Q+  W CVD+ A+
Sbjct: 1   MRNHQAKKNLAAMRVGDRAFFYHSNVGREIVGVVEVVRAAYPDPTA-QAGQWVCVDVRAI 59

Query: 91  CSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
             MP PV+L AIKA+P L+ + L+  SRLSV PV+   +  +CRMG
Sbjct: 60  GPMPQPVTLAAIKADPALADLALVRQSRLSVVPVSDAHWAHLCRMG 105


>gi|262277843|ref|ZP_06055636.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224946|gb|EEY75405.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 138

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 87/136 (63%), Gaps = 1/136 (0%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWLVKSEP+ WS + Q+  G  G  W GVRNYQA NN++ M+ GD  FFYHSN G+EIVG
Sbjct: 4   YWLVKSEPNVWSIEQQKKSGSKGTIWDGVRNYQAANNLKAMKKGDLCFFYHSNIGKEIVG 63

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           + EVI   + DPT ++   +  V +     +  PV+L  IK N  LS++ LI  SRLSV 
Sbjct: 64  VVEVIKEYFIDPT-DKEKRFVAVQLKFKQKLKFPVTLENIKQNKELSNLALIKQSRLSVM 122

Query: 123 PVTTDEYLEVCRMGKL 138
           P+ +  +  +C++GK+
Sbjct: 123 PIDSKSWKIICKLGKI 138


>gi|149280361|ref|ZP_01886482.1| hypothetical protein PBAL39_12608 [Pedobacter sp. BAL39]
 gi|149228910|gb|EDM34308.1| hypothetical protein PBAL39_12608 [Pedobacter sp. BAL39]
          Length = 135

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 86/136 (63%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WLVKSEP ++SW    + GR    W GVRNYQARNN++ M+ GD   FYHSN+G+ +
Sbjct: 1   MNHWLVKSEPFKYSWDKFNEDGRT--FWDGVRNYQARNNLKAMKEGDLVLFYHSNEGKHV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT + ++ W  VD+  V ++  PV+L  IKA   L  + LI   RLS
Sbjct: 59  VGIAKVVKEFYQDPTTDDTN-WVVVDLSPVEALKTPVTLEQIKAEESLKDISLIRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+  +E+ ++  MG
Sbjct: 118 VMPLKAEEFDKILEMG 133


>gi|110636509|ref|YP_676716.1| hypothetical protein CHU_0082 [Cytophaga hutchinsonii ATCC 33406]
 gi|110279190|gb|ABG57376.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 135

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 89/137 (64%), Gaps = 5/137 (3%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP ++S+ +   DK      W GVRNYQARNN+R+M+ GD   FYHSN+G+E
Sbjct: 1   MNYWLIKSEPFKYSFDQFVADKKTF---WDGVRNYQARNNLREMKKGDLLLFYHSNEGKE 57

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
           IVGI +++   Y DPT + ++ W  VD+  V  +  PV+L  +K + RL++M L+   RL
Sbjct: 58  IVGIAKIVKEAYQDPTTDDAN-WVVVDVAPVKKLKNPVTLEMVKKDKRLANMALVKLMRL 116

Query: 120 SVQPVTTDEYLEVCRMG 136
           SVQPV  +E+  V  + 
Sbjct: 117 SVQPVRKEEFDIVLELA 133


>gi|284037113|ref|YP_003387043.1| hypothetical protein Slin_2222 [Spirosoma linguale DSM 74]
 gi|283816406|gb|ADB38244.1| protein of unknown function DUF55 [Spirosoma linguale DSM 74]
          Length = 147

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 82/137 (59%), Gaps = 2/137 (1%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP  + W    ++GR    W GVRNYQARNN++ M +GD   FYHS     +
Sbjct: 1   MNYWLVKSEPDTYGWHHFIEQGRA--TWDGVRNYQARNNLKGMLIGDLVLFYHSVTSPAV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+  V+   + DPT  +   W  V++  V +   PV+L  IKA P L+S+ LI  SRLS
Sbjct: 59  VGLATVVRSHFQDPTVPEDPRWVAVELEPVMAFEKPVTLAHIKAEPMLASISLIKQSRLS 118

Query: 121 VQPVTTDEYLEVCRMGK 137
           V PV  DE+  + +MG+
Sbjct: 119 VMPVRADEFELILKMGQ 135


>gi|255531167|ref|YP_003091539.1| hypothetical protein Phep_1261 [Pedobacter heparinus DSM 2366]
 gi|255344151|gb|ACU03477.1| protein of unknown function DUF55 [Pedobacter heparinus DSM 2366]
          Length = 139

 Score =  123 bits (308), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 85/133 (63%), Gaps = 3/133 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           +WLVKSEP ++SW+     GR    W GVRNYQARNN+++M+ GD   FYHSN+G+ +VG
Sbjct: 6   HWLVKSEPFKYSWEKFNKDGRT--FWDGVRNYQARNNLKEMKEGDLVLFYHSNEGKNVVG 63

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           I +V+   Y DPT + ++ W  VD+  V ++  PVSL  IKA   L  + L+   RLSV 
Sbjct: 64  IAKVVKEFYQDPTTDDAN-WVVVDLAPVEALKNPVSLEQIKAEESLKDISLVRQGRLSVM 122

Query: 123 PVTTDEYLEVCRM 135
           P+  +E+ ++  M
Sbjct: 123 PLKAEEFDKILEM 135


>gi|115373851|ref|ZP_01461143.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|310820911|ref|YP_003953269.1| hypothetical protein STAUR_3654 [Stigmatella aurantiaca DW4/3-1]
 gi|115369117|gb|EAU68060.1| conserved hypothetical protein [Stigmatella aurantiaca DW4/3-1]
 gi|309393983|gb|ADO71442.1| conserved uncharacterized protein [Stigmatella aurantiaca DW4/3-1]
          Length = 147

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/141 (41%), Positives = 86/141 (60%), Gaps = 5/141 (3%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL+KSEPS +++   +  G+    WTGVRN++ARNN+R M+ GD   +YHSN+G+ +VG
Sbjct: 6   YWLIKSEPSVYAYAQLERDGQT--EWTGVRNFEARNNLRAMKAGDLCLYYHSNEGKAVVG 63

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           + +V+T   PDPTA  S  W  V +  V ++  PV+L  +K  P L    LI   RLSV 
Sbjct: 64  VAQVLTGAGPDPTAP-SEDWASVSVGPVVALNTPVALATLKKTPALKDFPLITRGRLSVA 122

Query: 123 PVTTDEYLEVCRMGK--LSNP 141
            VT   +  + ++G+  L NP
Sbjct: 123 AVTAKHFKLILKLGETMLPNP 143


>gi|227536061|ref|ZP_03966110.1| protein of hypothetical function DUF55 [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227243958|gb|EEI93973.1| protein of hypothetical function DUF55 [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 137

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 84/136 (61%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M Y+LVKSEP ++SW+     G+    W GVRNYQARNN++ M+ GD   FYHSN+G+E+
Sbjct: 1   MNYFLVKSEPFKYSWEQFNKDGQT--FWDGVRNYQARNNIKAMKEGDLVLFYHSNEGKEV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT E    W  VD+  V +   PV+L  IK++  L  + L+   RLS
Sbjct: 59  VGIAKVVKEFYQDPTTEDER-WVVVDLAPVETFKNPVTLEQIKSDTLLQDVALVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+  +E+  +  +G
Sbjct: 118 VMPLKPEEFDRIVELG 133


>gi|300772032|ref|ZP_07081902.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300760335|gb|EFK57161.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 137

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 84/136 (61%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M Y+LVKSEP ++SW+     G+    W GVRNYQARNN++ M+ GD   FYHSN+G+E+
Sbjct: 1   MNYFLVKSEPFKYSWEQFNKDGQT--FWDGVRNYQARNNIKAMKEGDLVLFYHSNEGKEV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT E    W  VD+  V +   PV+L  IK++  L  + L+   RLS
Sbjct: 59  VGIAKVVKEFYHDPTTEDER-WVVVDLAPVETFKNPVTLEQIKSDTLLQDVALVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+  +E+  +  +G
Sbjct: 118 VMPLKPEEFDRIVELG 133


>gi|303325551|ref|ZP_07355994.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Desulfovibrio sp.
           3_1_syn3]
 gi|302863467|gb|EFL86398.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Desulfovibrio sp.
           3_1_syn3]
          Length = 155

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 65/155 (41%), Positives = 85/155 (54%), Gaps = 14/155 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL K+EP  +SW+  ++       W GVRNYQARN MR MRVGD GFFYHS +   I
Sbjct: 1   MKYWLFKTEPGCFSWQDLENSPDQTSPWDGVRNYQARNFMRAMRVGDLGFFYHSGQQPGI 60

Query: 61  VGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VGI E++   YPD TA+             +   WE VD+    ++P P+S   + A P 
Sbjct: 61  VGIVEIVRAAYPDATAQDPENQHFDPKATPEKPIWEMVDVRLRRALPHPLSRKELAAWPE 120

Query: 108 LSSMILIV-SSRLSVQPVTTDEYLEVCRMGKLSNP 141
           LS M L+   SRLSVQPV    +  +C +  +  P
Sbjct: 121 LSGMELMKRGSRLSVQPVDAKAFAFICNLAGIQRP 155


>gi|326800929|ref|YP_004318748.1| hypothetical protein Sph21_3540 [Sphingobacterium sp. 21]
 gi|326551693|gb|ADZ80078.1| Uncharacterized protein family UPF0310 [Sphingobacterium sp. 21]
          Length = 134

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 84/136 (61%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M Y+LVKSEP ++SW  QQ        W GVRNYQARNN++ M+ GD   FYHSN+G+E+
Sbjct: 1   MNYFLVKSEPFKYSW--QQFLKDKQTFWDGVRNYQARNNLKAMKKGDLVLFYHSNEGKEV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT      W  VD+  + ++  PV+L  IKA+ +L  + L+   RLS
Sbjct: 59  VGIAKVVKEAYQDPTTSDER-WVVVDLAPLQTLKKPVTLETIKADEQLQDIALVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+  +E+  +  +G
Sbjct: 118 VMPLAPEEFDRIVALG 133


>gi|311746060|ref|ZP_07719845.1| hypothetical protein ALPR1_06515 [Algoriphagus sp. PR1]
 gi|126576277|gb|EAZ80555.1| hypothetical protein ALPR1_06515 [Algoriphagus sp. PR1]
          Length = 139

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 58/136 (42%), Positives = 83/136 (61%), Gaps = 5/136 (3%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YW+VKSEP  +SW  +  K    + W GVRNYQARN +++M++GDK  FYHS K + +
Sbjct: 8   MNYWMVKSEPGSYSW--EDFKKAKEDIWDGVRNYQARNFLKEMQLGDKVLFYHSGKEKAV 65

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV    +PDPT E+   WE V +     +  PV+L  IKA   L+ M+++  SRLS
Sbjct: 66  VGVAEVSEEHFPDPTDEK---WEAVKLKVNSQLKNPVTLHEIKAEDALADMLMLRQSRLS 122

Query: 121 VQPVTTDEYLEVCRMG 136
           V  +   E+  + +MG
Sbjct: 123 VMSMEKTEFDLILKMG 138


>gi|88797323|ref|ZP_01112913.1| hypothetical protein MED297_20857 [Reinekea sp. MED297]
 gi|88780192|gb|EAR11377.1| hypothetical protein MED297_20857 [Reinekea sp. MED297]
          Length = 160

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 82/149 (55%), Gaps = 14/149 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MA WL+K+EP E+S     ++G  GE W G+RNYQARN +R+M+VGD    YHS      
Sbjct: 1   MAVWLLKTEPGEFSIDDLAERGSDGEPWNGIRNYQARNFLREMQVGDLVLIYHSACATPG 60

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ EVI   YPDP A                  W  +D+  +     P+SL AIKA P
Sbjct: 61  IVGLAEVIRDAYPDPDALNPESRYFDPKSHADNIRWSLIDVRFLQKYSAPLSLKAIKAEP 120

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRM 135
            L  M L+ SSRLSV PVT  EY  +C +
Sbjct: 121 SLGEMKLVNSSRLSVSPVTEAEYQTLCSL 149


>gi|325104591|ref|YP_004274245.1| protein of unknown function DUF55 [Pedobacter saltans DSM 12145]
 gi|324973439|gb|ADY52423.1| protein of unknown function DUF55 [Pedobacter saltans DSM 12145]
          Length = 135

 Score =  117 bits (293), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 83/137 (60%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP ++SW+     GR    W GVRNYQARNN++ M+  D   FYHSN+G+ +
Sbjct: 1   MNYWLVKSEPFKYSWEQFNKDGRT--FWDGVRNYQARNNLKAMKEEDLVMFYHSNEGKCV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ +V+   Y DPT + S+ W  VDI  V ++  PVSL  IK +  L  + L+   RLS
Sbjct: 59  VGVAKVVKEFYQDPTTDDSN-WVVVDISPVETLKNPVSLEQIKKDEYLQDIALVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V P+   E+  +  + +
Sbjct: 118 VMPLKKHEFDRILELSE 134


>gi|148265469|ref|YP_001232175.1| hypothetical protein Gura_3446 [Geobacter uraniireducens Rf4]
 gi|146398969|gb|ABQ27602.1| protein of unknown function DUF55 [Geobacter uraniireducens Rf4]
          Length = 156

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 89/155 (57%), Gaps = 15/155 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGR- 58
           MAYWL KSEP  +S +  + +  + E W GVRNYQARN +R  ++ GD   FYHSN    
Sbjct: 1   MAYWLFKSEPGSFSIEDLRHRPGMTEHWDGVRNYQARNYLRDAVKPGDLVLFYHSNIPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI EV+   YPD TA               S  W  VD+  V +MP PV L  IK N
Sbjct: 61  AVVGIAEVVRGGYPDYTAFNPGSEHFDPKSSPVSPIWYMVDVRYVAAMPRPVPLEQIKGN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
           P L++M L+  SRLS+QPVT +E+  +  MG +++
Sbjct: 121 PLLAAMPLVKRSRLSIQPVTPEEWRTILAMGGMTD 155


>gi|256424428|ref|YP_003125081.1| hypothetical protein Cpin_5451 [Chitinophaga pinensis DSM 2588]
 gi|256039336|gb|ACU62880.1| protein of unknown function DUF55 [Chitinophaga pinensis DSM 2588]
          Length = 137

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP ++SW      G+    W GVRNYQARNN++ M  GD   FYHSN+G  +
Sbjct: 1   MNYWLVKSEPFKYSWDQFVKDGKT--FWDGVRNYQARNNLKGMEKGDLVLFYHSNEGLAV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V    Y DPT    + W  VD+  V     PV+L  +KA  RL ++ LI   RLS
Sbjct: 59  VGIAKVAKAHYQDPTTPDPN-WVVVDLQPVKPFKTPVTLAQMKAEKRLENLSLIRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V  VT +E+  +  MG+
Sbjct: 118 VCAVTEEEFDTILEMGE 134


>gi|330813351|ref|YP_004357590.1| protein of unknown function DUF55 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486446|gb|AEA80851.1| protein of unknown function DUF55 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 137

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 62/138 (44%), Positives = 81/138 (58%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP+ WS   Q+  G  G AW GVRNYQA NN+++M  GD  FFYHSN G+EI
Sbjct: 1   MKYWLMKSEPNVWSIDQQKKVGVKGTAWDGVRNYQAANNLKQMSKGDLCFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   + D T +    +  V +     +  PV+L  IK    L  + L+  SRLS
Sbjct: 61  VGIVEVIKTAFIDVT-DPDKRFVAVQVKFKQKLNQPVTLENIKKTKELQDLSLVKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V  +    +  +C+MGKL
Sbjct: 120 VTSIDPKSWKILCKMGKL 137


>gi|294464768|gb|ADE77890.1| unknown [Picea sitchensis]
          Length = 143

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 85/135 (62%), Gaps = 3/135 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           +WL+K+EP EWSW+ Q     V + W GVRN QA+NNM+ M VGD  FFYHS  K ++IV
Sbjct: 4   FWLLKTEPEEWSWEHQATNNGVSQ-WDGVRNAQAQNNMKAMNVGDLCFFYHSGKKDKQIV 62

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI +VI  +Y DP+ + S  +  VD+ AV  +  PV+L  IK +  L   ++I   RLSV
Sbjct: 63  GIVKVIKESYADPS-DPSGKYGVVDVEAVSPLEKPVTLAQIKQDEELKDFVMIKQPRLSV 121

Query: 122 QPVTTDEYLEVCRMG 136
            PVT   +  +C++G
Sbjct: 122 VPVTDKIWTRLCQLG 136


>gi|294011472|ref|YP_003544932.1| hypothetical protein SJA_C1-14860 [Sphingobium japonicum UT26S]
 gi|292674802|dbj|BAI96320.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 135

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 81/137 (59%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  +S+    +KGR    W GVRN+ A+ +MR MR GD   FYHSN G E 
Sbjct: 1   MNYWLMKSEPDAFSYDDLVEKGRA--EWDGVRNHAAQGHMRAMRKGDLSIFYHSNIGVEA 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++    PD T +++  W  V +        PV+L  +KA+P+L+ M +I  SRLS
Sbjct: 59  VGIMEIVGEAAPDST-DETGKWIAVHVAPKEKFEKPVTLKTMKADPKLADMAMIRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V P+T  E+  +  + K
Sbjct: 118 VSPLTAAEFRHIVDLSK 134


>gi|168034962|ref|XP_001769980.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162678701|gb|EDQ65156.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 137

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 85/137 (62%), Gaps = 4/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+K+EP EW W  Q+  G +   W GVRN  A+ ++R M++GD  FFYHS KG  +
Sbjct: 3   MGYWLLKTEPGEWGWADQEKNGGISN-WDGVRNALAQKHLRSMQLGDHAFFYHSGKGPSV 61

Query: 61  VGIFEVITCTYPDPTAEQS-SCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
           VG+ EV+   YPD T E   SC   VD+ A+ ++P PV L AIK    L   IL+  SRL
Sbjct: 62  VGVVEVVKVAYPDNTDESGKSC--MVDVRALAALPKPVPLSAIKNVEELRDWILLRQSRL 119

Query: 120 SVQPVTTDEYLEVCRMG 136
           SV PV+ DE+  VC +G
Sbjct: 120 SVMPVSPDEWQRVCELG 136


>gi|255035010|ref|YP_003085631.1| hypothetical protein Dfer_1217 [Dyadobacter fermentans DSM 18053]
 gi|254947766|gb|ACT92466.1| protein of unknown function DUF55 [Dyadobacter fermentans DSM
           18053]
          Length = 137

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/136 (42%), Positives = 81/136 (59%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WLVKSEP ++SW     +G     W GVRNY ARNN+  M+VGD   FYHSN+G+E+
Sbjct: 1   MNHWLVKSEPFKYSWDHLVAEGE--GMWDGVRNYAARNNLMAMKVGDPVLFYHSNEGKEV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ +V    YPDPT ++   W  V++  +   P  V+L  IK +  L  M L+  SRLS
Sbjct: 59  VGLAKVSKEHYPDPTTDEPG-WVVVNVVPIEKFPNTVTLAQIKKDELLKQMDLVRLSRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V PV  +E+  +  + 
Sbjct: 118 VVPVKREEFDHIVALA 133


>gi|103486530|ref|YP_616091.1| hypothetical protein Sala_1041 [Sphingopyxis alaskensis RB2256]
 gi|98976607|gb|ABF52758.1| protein of unknown function DUF589 [Sphingopyxis alaskensis RB2256]
          Length = 141

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (63%), Gaps = 2/133 (1%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL+KSEP  ++W  Q  K   G  W GVRN+ A+ N+  M+ GD+  FYHSN G+E VG
Sbjct: 5   YWLMKSEPDAYAWG-QLVKDGTG-IWDGVRNHTAKLNLMAMKKGDEALFYHSNIGKECVG 62

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           I E+   ++PDPTAE+ S W  V +  V ++  PV+L AIKA PRL+ M LI  SRLSV 
Sbjct: 63  IMEITEESFPDPTAEEGSPWVVVRVAPVRALTHPVTLAAIKAEPRLADMDLIRQSRLSVG 122

Query: 123 PVTTDEYLEVCRM 135
            VT  E+  + +M
Sbjct: 123 RVTPTEWQLILKM 135


>gi|222056192|ref|YP_002538554.1| protein of unknown function DUF55 [Geobacter sp. FRC-32]
 gi|221565481|gb|ACM21453.1| protein of unknown function DUF55 [Geobacter sp. FRC-32]
          Length = 158

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 86/150 (57%), Gaps = 15/150 (10%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKG-RE 59
           +YWL KSEP+ +S+   +      E W GVRNYQARN +R +++VGD+  FYHSN     
Sbjct: 5   SYWLFKSEPTNFSFDDLRTCPNSTEHWDGVRNYQARNYLRDEVQVGDQVLFYHSNIAVPA 64

Query: 60  IVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI EV+   YPD TA              +   W  VD+  V   P PV L  +K NP
Sbjct: 65  IVGIAEVVRAGYPDWTARDPENKHFDPASTAEKPIWYMVDVRFVNPFPRPVKLAELKNNP 124

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
            LS M+L+  SRLS+QPV  +E+ ++ RMG
Sbjct: 125 ALSGMVLLSRSRLSIQPVREEEWRQILRMG 154


>gi|322417836|ref|YP_004197059.1| hypothetical protein GM18_0294 [Geobacter sp. M18]
 gi|320124223|gb|ADW11783.1| protein of unknown function DUF55 [Geobacter sp. M18]
          Length = 156

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 86/153 (56%), Gaps = 15/153 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGR-EI 60
           YWL KSEPS +S    + +    E W GVRN+QARN +R +++VGD+  FYHSN     +
Sbjct: 4   YWLFKSEPSSFSLDDLKHRPEATEHWDGVRNFQARNFLRDQVQVGDRVLFYHSNIAEPAV 63

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VGI EV+   YPD TA                  W  VD+  V  +P PV+L  +K+ P 
Sbjct: 64  VGIAEVVKAGYPDFTAFDPQSKYFDPRSSPDKPTWYMVDVRFVRELPRPVTLAELKSIPE 123

Query: 108 LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
           LS+M L+  SRLS+QPV  +E+ E+  +  L+ 
Sbjct: 124 LSAMALLNRSRLSIQPVRREEWEEILALAGLTQ 156


>gi|108759607|ref|YP_631422.1| hypothetical protein MXAN_3223 [Myxococcus xanthus DK 1622]
 gi|108463487|gb|ABF88672.1| conserved hypothetical protein [Myxococcus xanthus DK 1622]
          Length = 142

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 78/139 (56%), Gaps = 3/139 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL+KSEPS +++   +  G+    WTGVRN++ARNN+R M+ GD   +YHSN+ + +VG
Sbjct: 6   YWLIKSEPSVYAYAQLEKDGKT--EWTGVRNFEARNNIRAMKPGDLCLYYHSNEDKAVVG 63

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           + +V+T   PD T      W    +  V     PV L  IKA   L    L+   RLSV 
Sbjct: 64  VAQVLTPPGPDSTVPDED-WAATFMGPVVPFTQPVDLATIKATAALKDFPLVTRGRLSVA 122

Query: 123 PVTTDEYLEVCRMGKLSNP 141
           PVT   + +V +MGK   P
Sbjct: 123 PVTATHFKQVLKMGKTVLP 141


>gi|223936776|ref|ZP_03628686.1| protein of unknown function DUF55 [bacterium Ellin514]
 gi|223894627|gb|EEF61078.1| protein of unknown function DUF55 [bacterium Ellin514]
          Length = 139

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 81/135 (60%), Gaps = 3/135 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWLVK EP  +SW      G+   AWTGVRN+ ARNN+R M+ GD   FYHS   +++VG
Sbjct: 5   YWLVKQEPEAYSWTTFVKDGKT--AWTGVRNFLARNNLRSMKKGDFVLFYHSVSEKQVVG 62

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           + +V    Y DPTA +   W  VD+  V ++  PV+L  IKA+  L  M+L+  SRLSV 
Sbjct: 63  LAKVEKEGYADPTATEGD-WVAVDLVPVKTLGKPVTLEVIKADKILKDMLLVRQSRLSVT 121

Query: 123 PVTTDEYLEVCRMGK 137
            +  +++  + ++ +
Sbjct: 122 SLNKEQFEHLMKLAE 136


>gi|225163784|ref|ZP_03726083.1| protein of unknown function DUF55 [Opitutaceae bacterium TAV2]
 gi|224801614|gb|EEG19911.1| protein of unknown function DUF55 [Opitutaceae bacterium TAV2]
          Length = 145

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 81/144 (56%), Gaps = 9/144 (6%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           + YWLVK EP  ++W+     GR    W GVRN+QARNN++ MR GD+  FY S   + +
Sbjct: 4   IQYWLVKQEPESYAWETFVRDGRT--TWDGVRNFQARNNLKAMREGDRVLFYASVSTKAV 61

Query: 61  VGIFEVITCTYPDPTAEQSSC-------WECVDICAVCSMPCPVSLMAIKANPRLSSMIL 113
           +G   V    +PDPT +           W  V++ A  ++  PV+L AIKA   L+ + L
Sbjct: 62  LGTARVSRTAFPDPTVDADEARSGGREGWLAVELEAGQALAKPVTLEAIKAEASLTDIAL 121

Query: 114 IVSSRLSVQPVTTDEYLEVCRMGK 137
           +  SRLSV P+T +E+  +  +GK
Sbjct: 122 LRQSRLSVMPLTREEFETIVALGK 145


>gi|85708152|ref|ZP_01039218.1| hypothetical protein NAP1_02915 [Erythrobacter sp. NAP1]
 gi|85689686|gb|EAQ29689.1| hypothetical protein NAP1_02915 [Erythrobacter sp. NAP1]
          Length = 136

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 82/135 (60%), Gaps = 7/135 (5%)

Query: 3   YWLVKSEPSEWSWK--MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           YWL+KSEP ++SW   + +++G     W GVRN+ A+ N+R M VGD+ FFYHS +G EI
Sbjct: 4   YWLMKSEPFKYSWDDLVAEEEG----TWDGVRNHSAKLNLRAMEVGDEAFFYHSREGLEI 59

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV      DPT +++  W  V I        PV+L  IKA P+L+   L+  SRLS
Sbjct: 60  VGVVEVTVAGIGDPT-DETGKWAAVKIKPKRKFDNPVTLKQIKAEPKLADCELVRLSRLS 118

Query: 121 VQPVTTDEYLEVCRM 135
           V  +  DE+  +C+M
Sbjct: 119 VAKIKPDEWKLICKM 133


>gi|153002940|ref|YP_001377265.1| hypothetical protein Anae109_0061 [Anaeromyxobacter sp. Fw109-5]
 gi|152026513|gb|ABS24281.1| protein of unknown function DUF55 [Anaeromyxobacter sp. Fw109-5]
          Length = 146

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 81/138 (58%), Gaps = 5/138 (3%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+K+EP  ++W     +G    AWTGV N QA+ N+R M+ GD+   YHS + R  
Sbjct: 1   MAYWLLKTEPGTYAWDDLVREGTT--AWTGVSNPQAQANLRAMQAGDRTVIYHSGEKR-A 57

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDP+A + +   CVD+ AV  +P PV L A+K  P      L+   RLS
Sbjct: 58  VGVAEVVRTAYPDPSAGEGAV--CVDVKAVAPLPAPVPLEALKQEPAFEGSALVRQGRLS 115

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V P++  E+ ++  +  +
Sbjct: 116 VVPLSPAEWRDLTALADI 133


>gi|154346792|ref|XP_001569333.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|134066675|emb|CAM44477.1| conserved hypothetical protein [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 164

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 64/149 (42%), Positives = 80/149 (53%), Gaps = 16/149 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP ++S  +     +   AW GVRNY ARNNMR M VGDK  FYHSN K   + 
Sbjct: 13  YWLLKSEPHKFS--IDDLAKQKTSAWDGVRNYAARNNMRAMAVGDKALFYHSNTKEPGVA 70

Query: 62  GIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           GI EV+   Y D TA             ++ + W+ VD+  V      V+L A+K+   L
Sbjct: 71  GIAEVVRLAYDDFTALDKTSEYFDPKATKEKNPWQMVDVKFVEKWNAVVTLQAMKSRREL 130

Query: 109 SSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             M L   SRLSVQPV   EY  V RM +
Sbjct: 131 QKMALFTQSRLSVQPVGAAEYAYVLRMNE 159


>gi|149186854|ref|ZP_01865164.1| hypothetical protein ED21_25487 [Erythrobacter sp. SD-21]
 gi|148829521|gb|EDL47962.1| hypothetical protein ED21_25487 [Erythrobacter sp. SD-21]
          Length = 136

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 82/138 (59%), Gaps = 7/138 (5%)

Query: 3   YWLVKSEPSEWSWK--MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           YWLVKSEP ++SW   + +++G     W GVRN++A+NN+  M VGD+ FFYHS +G EI
Sbjct: 4   YWLVKSEPFKYSWDDLVAEEEG----TWDGVRNHRAKNNLAAMEVGDQAFFYHSREGLEI 59

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV      DPT  +   W  V +     +P PV+L  IKA P+L+   L+  SRLS
Sbjct: 60  VGICEVSVAGITDPTDPEGK-WAAVKVVPKTKLPSPVTLKQIKAEPQLADCELVKLSRLS 118

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V  +  +E+  +  M  +
Sbjct: 119 VAEIKPEEWSIILEMAGI 136


>gi|90022771|ref|YP_528598.1| ubiquinol-cytochrome c reductase, iron-sulfur subunit
           [Saccharophagus degradans 2-40]
 gi|89952371|gb|ABD82386.1| protein of unknown function DUF589 [Saccharophagus degradans 2-40]
          Length = 150

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 87/153 (56%), Gaps = 19/153 (12%)

Query: 1   MAYWLVKSEPSEWS-WKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KG 57
           MA WL KSEP E+S   +Q+DK  V   W G+RNYQARN +R ++ VGD+  FYHS+ K 
Sbjct: 1   MACWLFKSEPDEYSIADLQRDKTTV---WNGIRNYQARNFLRDEVAVGDEVLFYHSSCKP 57

Query: 58  REIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKA 104
             + G+ +V+   YPDP+    S              W CVDI    +   PV+L  IKA
Sbjct: 58  TAVAGLAKVVRGAYPDPSQFDPSSPYYDAKSKPEAPRWVCVDIAFKAAFKHPVTLDRIKA 117

Query: 105 NPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
            P LS M+L+   RLS+QPVT D+  +V  + K
Sbjct: 118 TPALSEMLLVKQGRLSIQPVTEDQSKQVQSLAK 150


>gi|308535153|ref|YP_002137093.2| hypothetical protein Gbem_0266 [Geobacter bemidjiensis Bem]
 gi|308052498|gb|ACH37297.2| protein of unknown function DUF55 [Geobacter bemidjiensis Bem]
          Length = 154

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 84/149 (56%), Gaps = 15/149 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGR-EI 60
           YWL KSEPS +S +  + +    E W GVRNYQARN +R +++VGD+  FYHSN     +
Sbjct: 4   YWLFKSEPSSFSLEDLKHRPNATEHWDGVRNYQARNFLRDEVQVGDQVLFYHSNIAEPAV 63

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VGI EV+   YPD TA              +   W  VD+  V  +P PV+L  +K  P 
Sbjct: 64  VGIAEVVRAGYPDFTAFDPESNYFDPKSNPEKPAWFMVDVKFVRELPRPVTLSELKTVPE 123

Query: 108 LSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
           LS M L+  SRLS+QPV  +E+  + ++ 
Sbjct: 124 LSGMALLNRSRLSIQPVRKEEWDLILKLA 152


>gi|296284756|ref|ZP_06862754.1| hypothetical protein CbatJ_14098 [Citromicrobium bathyomarinum
           JL354]
          Length = 130

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 78/131 (59%), Gaps = 3/131 (2%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFE 65
           +KSEP  + W   + +G     W GVR++QA+NN+  M VGD+ FFYHSN GREIVGI E
Sbjct: 1   MKSEPDVYGWDDLEKEGT--GVWDGVRSHQAKNNLAAMEVGDQAFFYHSNIGREIVGIVE 58

Query: 66  VITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVT 125
           ++     DPT +++  W  V +     +P  V+L  +KA P+L+ M L+  SRLSV  V 
Sbjct: 59  IVEAHMTDPT-DETGKWAAVRVKPKTKLPNVVTLKQVKAEPQLADMQLVKLSRLSVAEVM 117

Query: 126 TDEYLEVCRMG 136
            DE+  +  M 
Sbjct: 118 PDEWSLILSMA 128


>gi|182413932|ref|YP_001818998.1| hypothetical protein Oter_2115 [Opitutus terrae PB90-1]
 gi|177841146|gb|ACB75398.1| protein of unknown function DUF55 [Opitutus terrae PB90-1]
          Length = 138

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 85/136 (62%), Gaps = 5/136 (3%)

Query: 3   YWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           YWLVKSEP  ++W  + +D+     AWTGVR++ AR N+++MR GD+  FY S   + ++
Sbjct: 5   YWLVKSEPEAYAWTDLVRDRR---TAWTGVRSFPARLNLQRMRRGDRVLFYESVTTKAVI 61

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI EV    +PD TA++   W  V + AV  +  PV+L  IKA P L+ + L+  SRLSV
Sbjct: 62  GIAEVTKPAFPDTTADEPG-WVAVGLKAVEPLGQPVTLAQIKAEPALADIALLRQSRLSV 120

Query: 122 QPVTTDEYLEVCRMGK 137
            P++ + Y  + ++G+
Sbjct: 121 LPLSAEAYQRIVKLGQ 136


>gi|254784720|ref|YP_003072148.1| hypothetical protein TERTU_0500 [Teredinibacter turnerae T7901]
 gi|237686001|gb|ACR13265.1| conserved hypothetical protein [Teredinibacter turnerae T7901]
          Length = 155

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 84/152 (55%), Gaps = 19/152 (12%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KG 57
           M+YWL KSEP+E+    + +DK      W G+RNYQARN +R  + VGD+  FYHS+ K 
Sbjct: 3   MSYWLFKSEPNEYGIDHLAKDKK---ARWDGIRNYQARNILRDDVSVGDQVLFYHSSCKP 59

Query: 58  REIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKA 104
             IVG+ EV+   YPDP    +               W CVDI        P++L A+K 
Sbjct: 60  TAIVGLAEVVAEGYPDPAQFNADSPYFDAKSKIDAPRWVCVDIAFQAKFKNPLTLAALKK 119

Query: 105 NPRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
            P LS M+L+  SRLS+QPVT  E+  + R G
Sbjct: 120 MPELSEMVLLQQSRLSIQPVTKAEFEFILRTG 151


>gi|222825044|dbj|BAH22202.1| hypothetical protein [Wolbachia endosymbiont of Cadra cautella]
          Length = 132

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 88/137 (64%), Gaps = 6/137 (4%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL+KSEPSE+SW+ + +K +V + W GV NYQA+N MR M++GD  FFYH+ K R I
Sbjct: 1   MQFWLLKSEPSEYSWQ-KMEKKQVTQ-WNGVCNYQAQNYMRAMKLGDLAFFYHTGKERVI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           +GI EV+   Y       +S +  V++  +  +   V+L +IK NP L +M+++  SRLS
Sbjct: 59  LGIVEVLKEYY----HVYNSKFGLVNVKLLKPLNNQVTLSSIKQNPLLKNMVILKQSRLS 114

Query: 121 VQPVTTDEYLEVCRMGK 137
           V PV   E+ E+ RM +
Sbjct: 115 VSPVLETEWNEIIRMSE 131


>gi|197120485|ref|YP_002132436.1| hypothetical protein AnaeK_0064 [Anaeromyxobacter sp. K]
 gi|196170334|gb|ACG71307.1| protein of unknown function DUF55 [Anaeromyxobacter sp. K]
          Length = 146

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 78/138 (56%), Gaps = 5/138 (3%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+K+EP  ++W      G     WTGV N QA+ N+R M+ GD+   YHS + R  
Sbjct: 1   MAYWLLKTEPGTYAWSDLVADGTT--PWTGVANPQAQTNLRAMKAGDRAIVYHSGEKRA- 57

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV+   YPDPTA       CVD+ AV ++P PV L A+K  P     +L+   RLS
Sbjct: 58  VGIAEVVRTAYPDPTAGGELV--CVDVKAVEALPAPVPLEALKQEPAFEGSVLLRQGRLS 115

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V P+   E+ ++  +  +
Sbjct: 116 VVPLAPAEWRDLASLADV 133


>gi|91762556|ref|ZP_01264521.1| hypothetical protein PU1002_04786 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718358|gb|EAS85008.1| hypothetical protein PU1002_04786 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 137

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 77/135 (57%), Gaps = 1/135 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  WS   Q+  G  G  W GVRNYQA  N+R M+ GD  FFYHSN G+EI
Sbjct: 1   MNYWLMKSEPDVWSIDQQKKAGAKGAPWDGVRNYQAAKNLRAMKKGDLCFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   + D T ++   +  V +     +   V+L  +K    LS + LI  SRLS
Sbjct: 61  VGIVEVIKEAFLDKT-DKDGRFVAVQVKFKEKLKKSVTLEEVKKTKSLSHLSLIRQSRLS 119

Query: 121 VQPVTTDEYLEVCRM 135
           V P+ +  +  + +M
Sbjct: 120 VMPIDSKSWKILNKM 134


>gi|85373612|ref|YP_457674.1| hypothetical protein ELI_03925 [Erythrobacter litoralis HTCC2594]
 gi|84786695|gb|ABC62877.1| hypothetical protein ELI_03925 [Erythrobacter litoralis HTCC2594]
          Length = 137

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 79/128 (61%), Gaps = 5/128 (3%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           YWL+KSEPS++ W    D    GE  W GVRN++A+NN+  M VGD+ FFYHS +G EIV
Sbjct: 4   YWLMKSEPSKYGW---DDLVAEGEGVWDGVRNHRAKNNLAAMEVGDQCFFYHSREGLEIV 60

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI EV      DPT  +   W  V +  V  +  PV+L  +KA+PRL+ M L+  SRLSV
Sbjct: 61  GICEVSVAGITDPTDPEGK-WAAVKVKPVRKLEQPVTLKQVKADPRLTEMELVKLSRLSV 119

Query: 122 QPVTTDEY 129
             V  +E+
Sbjct: 120 AEVRPEEW 127


>gi|190570990|ref|YP_001975348.1| hypothetical protein WPa_0578 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019507|ref|ZP_03335313.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357262|emb|CAQ54686.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994929|gb|EEB55571.1| conserved hypothetical protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 132

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 88/137 (64%), Gaps = 6/137 (4%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL+KSEPSE+SW+ + +K +V + W GV NYQA+N MR M++GD  FFYH+ K R I
Sbjct: 1   MQFWLLKSEPSEYSWQ-KMEKEQVTQ-WNGVCNYQAQNYMRAMKLGDLAFFYHTGKERVI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           +GI EV+   Y       +S +  V++  +  +   V+L +IK NP L +M+++  SRLS
Sbjct: 59  LGIVEVLKEYYHV----YNSKFGLVNVKFLKPLSNQVTLNSIKQNPLLKNMVILKQSRLS 114

Query: 121 VQPVTTDEYLEVCRMGK 137
           V PV   E+ E+ RM +
Sbjct: 115 VSPVLETEWNEIIRMSE 131


>gi|253698905|ref|YP_003020094.1| hypothetical protein GM21_0251 [Geobacter sp. M21]
 gi|251773755|gb|ACT16336.1| protein of unknown function DUF55 [Geobacter sp. M21]
          Length = 156

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 83/149 (55%), Gaps = 15/149 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGR-EI 60
           YWL KSEPS +S +  + +    E W GVRNYQARN +R +++VGD   FYHSN     +
Sbjct: 4   YWLFKSEPSSFSLEDLKHRPGATEHWDGVRNYQARNFLRDEVQVGDLVLFYHSNIAEPAV 63

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ EV+   YPD TA              Q   W  VD+  V  +P PV+L  +K  P 
Sbjct: 64  VGVAEVVKAGYPDFTAFDPESNYFDPKSDPQKPVWYMVDVKFVRELPRPVTLSELKTVPE 123

Query: 108 LSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
           LS M L+  SRLS+QPV  +E+  + ++ 
Sbjct: 124 LSGMALLNRSRLSIQPVRKEEWDLILKLA 152


>gi|220915197|ref|YP_002490501.1| protein of unknown function DUF55 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219953051|gb|ACL63435.1| protein of unknown function DUF55 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 146

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 77/138 (55%), Gaps = 5/138 (3%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+K+EP  ++W      G     WTGV N QA+ N+R M+ GD+   YHS + R  
Sbjct: 1   MAYWLLKTEPGTYAWSDLVADGTT--PWTGVANPQAQTNLRAMKAGDRAIVYHSGEKRA- 57

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV+   YPDPTA       CVD+ AV  +P PV L A+K  P     +L+   RLS
Sbjct: 58  VGIAEVVRTAYPDPTAGGELV--CVDVKAVEPLPAPVPLEALKQEPAFEGSVLLRQGRLS 115

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V P+   E+ ++  +  +
Sbjct: 116 VVPLAPAEWRDLASLADV 133


>gi|327482771|gb|AEA86081.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 149

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 85/151 (56%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP E+S    QD  ++G   W GVRNYQARN +R+M+ GD  FFYHS+    
Sbjct: 1   MPYWLMKSEPDEFSI---QDLKKLGHGRWDGVRNYQARNFLRQMQEGDHFFFYHSSCAEP 57

Query: 60  -IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  VI   YPDPTA              +++ W  VD+  V +   P++L  +KAN
Sbjct: 58  GIAGVGRVIRSAYPDPTALDPESPYHDGKASSEANPWSAVDVEFVEAFSAPLALARLKAN 117

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           P L  + L+   SRLSV PV+  E+  +  M
Sbjct: 118 PALRELALVKKGSRLSVMPVSDTEWQAILAM 148


>gi|307295576|ref|ZP_07575412.1| protein of unknown function DUF55 [Sphingobium chlorophenolicum
           L-1]
 gi|306878615|gb|EFN09835.1| protein of unknown function DUF55 [Sphingobium chlorophenolicum
           L-1]
          Length = 135

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  +S+    +KG+    W GVRN+ A+ +M+ MR GD   FYHSN G E 
Sbjct: 1   MNYWLMKSEPDVFSYDDLVEKGKA--EWDGVRNHAAQLHMKAMRKGDLSIFYHSNIGVEA 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +++    PD T + +  W  V +        PV+L  +KA+P L++M +I  SRLS
Sbjct: 59  VGIMQIVEEAAPDST-DDTGKWIAVHVGPKEKFEKPVTLKTMKADPALANMAMIRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V P+T  E+  +  + K
Sbjct: 118 VSPLTEAEFKHIVALSK 134


>gi|239905206|ref|YP_002951945.1| hypothetical protein DMR_05680 [Desulfovibrio magneticus RS-1]
 gi|239795070|dbj|BAH74059.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 159

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 77/150 (51%), Gaps = 14/150 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+KSEP  +S             W GVRN+QARN +R MR+GD   FYHS     +
Sbjct: 1   MAYWLIKSEPGCFSIDDLAAAPDRTTGWDGVRNFQARNFLRAMRLGDGLLFYHSVTDPGV 60

Query: 61  VGIFEVITCTYPDPTAEQSS-------------CWECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ EV    YPD TA+                 W+ VD+  V   P PV L A++  P 
Sbjct: 61  VGLAEVAREAYPDATAQDPDSGHFDPRASPDKPLWDMVDVRFVAKFPAPVPLAALRGVPE 120

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCRMG 136
           L+ M +L   SRLSV PVT  E+  +  MG
Sbjct: 121 LAGMEVLRKGSRLSVTPVTDREFAVIRAMG 150


>gi|86156489|ref|YP_463274.1| hypothetical protein Adeh_0059 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85773000|gb|ABC79837.1| protein of unknown function DUF589 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 154

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 77/138 (55%), Gaps = 5/138 (3%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+K+EP  ++W      G     WTGV N QA+ N+R M+ GD+   YHS + R  
Sbjct: 9   MAYWLLKTEPGTYAWSDLVADGTT--PWTGVANPQAQANLRAMKAGDRAIVYHSGEKRA- 65

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV+   YPDPTA       CVD+ AV  +P PV L A+K  P     +L+   RLS
Sbjct: 66  VGIAEVVRTAYPDPTAGGELV--CVDVKAVEPLPAPVPLEALKLEPAFEGSVLLRQGRLS 123

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V P+   E+ ++  +  +
Sbjct: 124 VVPLAPAEWRDLAALADV 141


>gi|71083019|ref|YP_265738.1| hypothetical protein SAR11_0313 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062132|gb|AAZ21135.1| Uncharacterized conserved protein [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 137

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 77/138 (55%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  WS   Q+  G  G  W GVRNYQA  N+R M+ GD  FFYHSN G+EI
Sbjct: 1   MNYWLMKSEPDVWSIDQQKKAGAKGAPWDGVRNYQAAKNLRAMKKGDLCFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EVI   + D T ++   +  V +     +   V+L  IK    LS + LI  SRLS
Sbjct: 61  VGTVEVIKEAFLDKT-DKDGRFVAVQVKFKEKLRKSVTLEEIKKTKSLSHLSLIRQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V P+ +  +  + +M  +
Sbjct: 120 VMPIDSKSWKILNKMSSI 137


>gi|254455572|ref|ZP_05069001.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
 gi|207082574|gb|EDZ60000.1| conserved hypothetical protein [Candidatus Pelagibacter sp.
           HTCC7211]
          Length = 132

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 76/133 (57%), Gaps = 1/133 (0%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFE 65
           +KSEP  WS   Q   G  G  W GVRNYQA  N++ M+ GD  FFYHSN G+EIVGI E
Sbjct: 1   MKSEPDVWSINQQIKAGLKGAPWDGVRNYQAAKNLKSMKKGDLCFFYHSNIGKEIVGIVE 60

Query: 66  VITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVT 125
           VI   Y D T ++S  +  V +     +  PV+L  IK N  LS + LI  SRLSV P+ 
Sbjct: 61  VIKEAYLDKT-DKSGRFVAVTVRFKKKLSNPVTLEDIKKNKELSHLSLIKQSRLSVMPID 119

Query: 126 TDEYLEVCRMGKL 138
           +  +  +  M K+
Sbjct: 120 SKSWKILNNMSKI 132


>gi|317121599|ref|YP_004101602.1| hypothetical protein Tmar_0760 [Thermaerobacter marianensis DSM
           12885]
 gi|315591579|gb|ADU50875.1| protein of unknown function DUF55 [Thermaerobacter marianensis DSM
           12885]
          Length = 138

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 83/140 (59%), Gaps = 3/140 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVK+EPS +S+   + +G   + W GVRN  A+ +M+ M+ GD    YH+   ++ 
Sbjct: 1   MAYWLVKTEPSVYSYADLEREGT--DYWDGVRNNLAQKHMKAMQPGDLVLVYHTGSEKQA 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPT + +  W  VD+ A   +P PV+L+ IKA+P      L+ +SRLS
Sbjct: 59  VGVAEVVRGAYPDPT-DPTGRWVAVDLKARLRLPRPVTLVQIKADPAFKDWELVRNSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           V PV    +  + RM  L +
Sbjct: 118 VMPVPEPLWERIMRMAGLGS 137


>gi|325274680|ref|ZP_08140728.1| hypothetical protein G1E_15683 [Pseudomonas sp. TJI-51]
 gi|324100187|gb|EGB97985.1| hypothetical protein G1E_15683 [Pseudomonas sp. TJI-51]
          Length = 149

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 83/145 (57%), Gaps = 19/145 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E S +     GR+GEA W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSIEA---LGRLGEARWDGVRNYQARNFLRAMSEGDRFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI E+I   YPDPTA              + + W  VD+  V ++P  + L  +K  
Sbjct: 58  GIAGIGEIIRAAYPDPTALDPQSPYHDAKATAEKNPWSAVDVAHVQTLPRVLELGQLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEY 129
             L+ + L+   SRLSV PVT +++
Sbjct: 118 AGLAELPLVQKGSRLSVMPVTAEQW 142


>gi|42520567|ref|NP_966482.1| hypothetical protein WD0724 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410306|gb|AAS14416.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 132

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 84/138 (60%), Gaps = 10/138 (7%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL+KSEPSE+SW+ + +K +V E W GVRNYQA+N M+ M+V D  FFYH+ K + I
Sbjct: 1   MQFWLLKSEPSEYSWQ-KMEKEQVVE-WDGVRNYQAQNYMKIMKVSDLAFFYHTGKKKAI 58

Query: 61  VGIFEVITCTYP--DPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSR 118
           +GI EV    Y   DP       +  V++  +  +   V+L  IK NP L +M ++   R
Sbjct: 59  LGIVEVFKEYYHVNDPK------FGLVNVKFLKPLNNQVTLNNIKQNPLLKNMTILKQPR 112

Query: 119 LSVQPVTTDEYLEVCRMG 136
           LS+ PV+  E+ E+ RM 
Sbjct: 113 LSIAPVSEIEWNEIIRMS 130


>gi|114321684|ref|YP_743367.1| hypothetical protein Mlg_2537 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228078|gb|ABI57877.1| protein of unknown function DUF55 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 158

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 82/153 (53%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+  +  + +    E W GVRNYQARN MR +M+VGD  FFYHSN K  
Sbjct: 1   MNYWLMKSEPDEFGIEDLKQRPDQIEPWDGVRNYQARNMMRDQMKVGDLAFFYHSNTKPP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI E++   YPDPT               +   W  VD+     +P  V+L  +K  
Sbjct: 61  GIVGIVEIVREGYPDPTQFDPDDKHYDPKSDPEKPRWYLVDVKFKAILPRKVTLHELKRQ 120

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
           P+L  M L+   +RLSV PV  D +  +  + +
Sbjct: 121 PQLEGMKLLARGNRLSVMPVEPDHWAHIIALAE 153


>gi|119774710|ref|YP_927450.1| hypothetical protein Sama_1573 [Shewanella amazonensis SB2B]
 gi|119767210|gb|ABL99780.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 156

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 87/152 (57%), Gaps = 16/152 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S +    + +  E W G+RNYQARN MR  M+VGD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIRDLAARPQQTEGWHGIRNYQARNFMRDAMKVGDRVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ E+ +  YPD +A               S  W  +DI  V     PV+L AIK++
Sbjct: 61  AIVGVAEIASDVYPDSSAWDPESDYFDPKSSPDSPRWLQLDIRFVKEFTKPVTLTAIKSH 120

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMG 136
           P L+ M+L+   SRLS+QPV    +  + +M 
Sbjct: 121 PGLTDMLLVQKGSRLSIQPVDEIHWQLIHQMA 152


>gi|157877981|ref|XP_001687281.1| hypothetical protein [Leishmania major strain Friedlin]
 gi|68130356|emb|CAJ09668.1| conserved hypothetical protein [Leishmania major strain Friedlin]
          Length = 164

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 80/151 (52%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           + YWL+KSEP ++S  +     +    W GVRNY ARNNMR M VGDK  FYHSN K   
Sbjct: 11  IHYWLLKSEPHKFS--IDDLAKQKTSPWDGVRNYAARNNMRAMSVGDKVLFYHSNTKEPG 68

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           + G+ EV+   Y D TA             ++ + W+ VD+  V      ++L  +K+  
Sbjct: 69  VAGLAEVVRLAYDDFTALDKTSEYFDPKATKEKNPWKMVDVKFVARWDTVLTLHELKSRR 128

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
            L  M L   SRLSVQPV+  EY  + RM +
Sbjct: 129 ELQKMALFTQSRLSVQPVSASEYAYILRMNE 159


>gi|225174464|ref|ZP_03728463.1| protein of unknown function DUF55 [Dethiobacter alkaliphilus AHT 1]
 gi|225170249|gb|EEG79044.1| protein of unknown function DUF55 [Dethiobacter alkaliphilus AHT 1]
          Length = 133

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 80/137 (58%), Gaps = 5/137 (3%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+K+EP ++S+   +  G   + W GVRN QA+ N+R M  GD+ F YH+   + I
Sbjct: 1   MNYWLLKTEPEDYSFADLKQAGM--DVWDGVRNRQAQKNIRAMSPGDQAFIYHTGNEKAI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ E+++  + DPT +Q   +  V++ A  ++P PV+L  IK  P+     L+   RLS
Sbjct: 59  VGVAEIVSIPFSDPTDDQ---FHAVNVRAQHALPRPVTLKEIKEAPQFEKWALVRQPRLS 115

Query: 121 VQPVTTDEYLEVCRMGK 137
           V PV+   + +V  + K
Sbjct: 116 VMPVSAKHWQQVIELSK 132


>gi|24373533|ref|NP_717576.1| hypothetical protein SO_1969 [Shewanella oneidensis MR-1]
 gi|24347845|gb|AAN55020.1|AE015640_3 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 153

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 86/153 (56%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S +  + +    E W G+RNYQARN MR  M++GDK FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIEDLKARPNQTEPWFGIRNYQARNYMRDAMQIGDKVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  VDI  V      + L  IK+ 
Sbjct: 61  GIVGIAEVVTNAYPDSTAFDPESTYFDPKSDPSNPRWLRVDIRFVEQFKEIIPLSLIKSL 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGK 137
           P+L+ M L+   SRLS+QPVT +++  V  + +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTAEQWQAVLMLSR 153


>gi|325284095|ref|YP_004256636.1| hypothetical protein Deipr_1887 [Deinococcus proteolyticus MRP]
 gi|324315904|gb|ADY27019.1| Uncharacterized protein family UPF0310 [Deinococcus proteolyticus
           MRP]
          Length = 156

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 85/153 (55%), Gaps = 17/153 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP  +S+   Q   R  E W G+RNYQARN +R+M  GD G FYHSN +   
Sbjct: 1   MAYWLLKSEPDVFSFADLQAVRR--EPWNGIRNYQARNFLRQMVPGDLGLFYHSNTQPPH 58

Query: 60  IVGIFEVITCTYP-----DPTAE----QSSC----WECVDICAVCSMPCPVSLMAIKANP 106
           I G+  V+   YP     DP +E    +SS     W  VD+ AV + P PV+L  ++A P
Sbjct: 59  IAGVLRVVREAYPDDLQFDPASEYYDPKSSAEALRWSMVDVGAVAAFPQPVTLEDLRALP 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKL 138
             +   L+   +RLSV P++  E+    R G L
Sbjct: 119 EWAESPLVRRGNRLSVMPLSEAEFQAALRAGGL 151


>gi|294055996|ref|YP_003549654.1| protein of unknown function DUF55 [Coraliomargarita akajimensis DSM
           45221]
 gi|293615329|gb|ADE55484.1| protein of unknown function DUF55 [Coraliomargarita akajimensis DSM
           45221]
          Length = 154

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 86/153 (56%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP  +S++  + +    E W GVRNYQARN MR +M+VGD+  FYHSN    
Sbjct: 1   MKYWLMKSEPDVFSFEDLKQRPGQTEPWDGVRNYQARNFMRDEMKVGDQILFYHSNTNPP 60

Query: 60  -IVGIFEVITCTYPDPTA--EQSSC-----------WECVDICAVCSMPCPVSLMAIKAN 105
            +VG+ EV +  YPDP+A  +QS             W  VD+     +P  VSL  +KA 
Sbjct: 61  GVVGVAEVASSAYPDPSAFDQQSKYYDAKSDPENPRWILVDVKYRADLPRMVSLEEMKAI 120

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGK 137
           P L+ M +L   +RLS+ PVT  E+  +    K
Sbjct: 121 PELAEMRVLQRGNRLSITPVTEAEFEAIVAAAK 153


>gi|212704335|ref|ZP_03312463.1| hypothetical protein DESPIG_02390 [Desulfovibrio piger ATCC 29098]
 gi|212672297|gb|EEB32780.1| hypothetical protein DESPIG_02390 [Desulfovibrio piger ATCC 29098]
          Length = 153

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 81/150 (54%), Gaps = 15/150 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP  +SW+  +       +W GVRNYQARN M+ M+ GD GFFYHS     I
Sbjct: 1   MNYWLFKSEPGCYSWQDLEAAPGQTTSWDGVRNYQARNFMKAMKKGDLGFFYHSGADPSI 60

Query: 61  VGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ EV+   YPD TA+             +   WE VD+    ++P  +S   + A+  
Sbjct: 61  VGVVEVVREAYPDHTAQDPENNHFDPRATPEKPIWEMVDVRLHKALPA-LSRKELSAHAA 119

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCRMG 136
           L+ M L+   SRLSVQPV+ + +  +  + 
Sbjct: 120 LAGMELMRRGSRLSVQPVSAEAFEYIMHLA 149


>gi|58699076|ref|ZP_00373912.1| hypothetical protein WwAna1073 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630500|ref|YP_002727291.1| hypothetical protein WRi_007510 [Wolbachia sp. wRi]
 gi|58534404|gb|EAL58567.1| hypothetical protein WwAna1073 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225592481|gb|ACN95500.1| hypothetical protein WRi_007510 [Wolbachia sp. wRi]
          Length = 132

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 10/138 (7%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL+KSEPSE+SW+ + +K +V E W GVRNYQA+N M+ M+  D  FFYH+ K + I
Sbjct: 1   MQFWLLKSEPSEYSWQ-KMEKEQVVE-WDGVRNYQAQNYMKIMKASDLAFFYHTGKEKAI 58

Query: 61  VGIFEVITCTYP--DPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSR 118
           +GI EV    Y   DP       +  V++  +  +   V+L  IK NP L +M ++   R
Sbjct: 59  LGIVEVFKEYYHVNDPK------FGLVNVKFLKPLNNQVTLNNIKQNPLLKNMTILKQPR 112

Query: 119 LSVQPVTTDEYLEVCRMG 136
           LS+ PV+  E+ E+ RM 
Sbjct: 113 LSIAPVSEIEWNEIIRMS 130


>gi|75766309|pdb|2AR1|A Chain A, Structure Of Hypothetical Protein From Leishmania Major
          Length = 172

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 79/151 (52%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           + YWL+KSEP ++S  +     +    W GVRNY ARNNMR M VGDK  FYHSN K   
Sbjct: 19  IHYWLLKSEPHKFS--IDDLAKQKTSPWDGVRNYAARNNMRAMSVGDKVLFYHSNTKEPG 76

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           + G+ EV+   Y D TA             ++ + W+ VD+  V      ++L  +K+  
Sbjct: 77  VAGLAEVVRLAYDDFTALDKTSEYFDPKATKEKNPWKMVDVKFVARWDTVLTLHELKSRR 136

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
            L  M L    RLSVQPV+  EY  + RM +
Sbjct: 137 ELQKMALFTQRRLSVQPVSASEYAYILRMNE 167


>gi|94498817|ref|ZP_01305363.1| hypothetical protein SKA58_10994 [Sphingomonas sp. SKA58]
 gi|94421746|gb|EAT06801.1| hypothetical protein SKA58_10994 [Sphingomonas sp. SKA58]
          Length = 152

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 74/137 (54%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  +S+     KG+    W GVRN+ A+ +MR MR GD   FYHSN G   
Sbjct: 18  MHYWLMKSEPDVFSYDDLVAKGQA--EWDGVRNHAAQGHMRAMRKGDLALFYHSNIGLAA 75

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI  ++    PD T + S  W  V +     +  PV+L A+K    LS M +I   RLS
Sbjct: 76  VGIMSIVEEAAPDST-DSSGKWIAVHVAPKERLANPVTLKAMKTQDALSDMAIIRQPRLS 134

Query: 121 VQPVTTDEYLEVCRMGK 137
           V P+T  ++  +  M K
Sbjct: 135 VSPLTPAQFDHIVAMSK 151


>gi|317051710|ref|YP_004112826.1| hypothetical protein Selin_1537 [Desulfurispirillum indicum S5]
 gi|316946794|gb|ADU66270.1| protein of unknown function DUF55 [Desulfurispirillum indicum S5]
          Length = 152

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 85/155 (54%), Gaps = 22/155 (14%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGE---AWTGVRNYQARNNMRKMRVGDKGFFYHSN-K 56
           MA+WLVK+EP  ++    QD  R+ +    W GVRNYQARNN+R M +GD+ F YHSN K
Sbjct: 1   MAFWLVKTEPHVFAI---QDFLRMPDRVSGWDGVRNYQARNNLRAMSLGDEVFLYHSNVK 57

Query: 57  GREIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIK 103
            R IVG+  V+   YPD TA                  W  VD+  V   P  + L  +K
Sbjct: 58  ERGIVGLATVVREAYPDETALDPGSASFDPRSDRANPRWYQVDLQLVEIFPRVLELGFLK 117

Query: 104 ANPRLSSMILI--VSSRLSVQPVTTDEYLEVCRMG 136
             P L+SM+L+     RLSVQPVT +E+  +  +G
Sbjct: 118 TVPELASMVLLSKAGQRLSVQPVTGEEFRIIRGLG 152


>gi|118581613|ref|YP_902863.1| hypothetical protein Ppro_3212 [Pelobacter propionicus DSM 2379]
 gi|118504323|gb|ABL00806.1| protein of unknown function DUF55 [Pelobacter propionicus DSM 2379]
          Length = 156

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 15/156 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGR- 58
           M YWL K+EP  +S+   +++  + E W GVRN+QARN +R  ++VGD   FYHSN  + 
Sbjct: 1   MNYWLFKTEPGCFSFDNLKNRPNMTEPWDGVRNFQARNYLRDTVKVGDLVLFYHSNIPQP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+  V+   YPD TA               +  W  VD+  +  M   VSL  IKAN
Sbjct: 61  AIVGLATVVREGYPDTTALDPEGEHFDPKSSPANPIWYMVDVRYLKEMTRQVSLEQIKAN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
           P L +M L+  SRLS+QPVT ++   +  MG  S P
Sbjct: 121 PLLEAMPLVNRSRLSIQPVTPEQGEIILAMGGTSLP 156


>gi|313901676|ref|ZP_07835108.1| protein of unknown function DUF55 [Thermaerobacter subterraneus DSM
           13965]
 gi|313468053|gb|EFR63535.1| protein of unknown function DUF55 [Thermaerobacter subterraneus DSM
           13965]
          Length = 138

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 80/140 (57%), Gaps = 3/140 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+K+EPS +S+   +  G   + W GVRN  A+  M++M+ GD    YH+   ++ 
Sbjct: 1   MAYWLLKTEPSVYSYADLEQAGT--DYWDGVRNNLAQKYMKQMQPGDLVLIYHTGSEKQA 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPT + +  W  VD+ A   +P PV+L+ IKA+P      L+ ++RLS
Sbjct: 59  VGVAEVVRGAYPDPT-DPTGRWVAVDVKARLRLPRPVTLVEIKADPAFKDWELVRNARLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
             PV    +  + RM  L  
Sbjct: 118 AMPVPEPLWERIMRMAGLGT 137


>gi|197103569|ref|YP_002128946.1| hypothetical protein PHZ_c0103 [Phenylobacterium zucineum HLK1]
 gi|196476989|gb|ACG76517.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 134

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 80/136 (58%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WLVKSEP+ +S++  Q  GR    W GVRN  A  +++ M+ GD+  FYHS +G  +
Sbjct: 1   MAGWLVKSEPNTYSFEDLQRDGRT--VWDGVRNNAAALHLKAMKAGDEVLFYHSQEGLAV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI  V    +PD T + S  +  V++  V  +  PV+L  +KANP LS M ++  SRLS
Sbjct: 59  VGIARVSREAFPDAT-DPSGRFVAVELEPVRPLARPVTLAEMKANPALSEMAMLRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V PV  +E+  +  M 
Sbjct: 118 VSPVRPEEWRAILGMA 133


>gi|46580821|ref|YP_011629.1| hypothetical protein DVU2416 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601863|ref|YP_966263.1| hypothetical protein Dvul_0815 [Desulfovibrio vulgaris DP4]
 gi|46450241|gb|AAS96889.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562092|gb|ABM27836.1| protein of unknown function DUF55 [Desulfovibrio vulgaris DP4]
 gi|311234525|gb|ADP87379.1| protein of unknown function DUF55 [Desulfovibrio vulgaris RCH1]
          Length = 160

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 77/151 (50%), Gaps = 14/151 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSE   +S            +W GVRNYQARN MR MR GD GFFYHS K  EI
Sbjct: 1   MNYWLFKSETDCFSVDDLAASPDATSSWDGVRNYQARNFMRTMRKGDLGFFYHSGKNPEI 60

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI EV+  ++PD TA               +  W+ VD+  V     P+   A+K    
Sbjct: 61  AGIVEVVRESHPDHTAWDPENDHYDPASTPDAPRWDMVDVRLVQRFVTPLPRAALKGVAG 120

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  M +L   SRLSVQPVT +E+  V  + +
Sbjct: 121 LEGMELLKKGSRLSVQPVTPEEFAIVRHLAE 151


>gi|146292777|ref|YP_001183201.1| hypothetical protein Sputcn32_1677 [Shewanella putrefaciens CN-32]
 gi|145564467|gb|ABP75402.1| protein of unknown function DUF55 [Shewanella putrefaciens CN-32]
          Length = 153

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 84/153 (54%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GDK FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWYGIRNYQARNFMRDGMQIGDKVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  +DI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTHAYPDSTAFDLESTYFDPKSDPSKPRWLSIDIRFVEKFDHIIPLSRIKNM 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGK 137
           P+L+ M L+   SRLS+QPVT +++  V  + +
Sbjct: 121 PQLTDMYLVSKGSRLSIQPVTAEQWQTVLMLTR 153


>gi|113970622|ref|YP_734415.1| hypothetical protein Shewmr4_2287 [Shewanella sp. MR-4]
 gi|114047853|ref|YP_738403.1| hypothetical protein Shewmr7_2359 [Shewanella sp. MR-7]
 gi|113885306|gb|ABI39358.1| protein of unknown function DUF55 [Shewanella sp. MR-4]
 gi|113889295|gb|ABI43346.1| protein of unknown function DUF55 [Shewanella sp. MR-7]
          Length = 153

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 86/153 (56%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWFGIRNYQARNFMRDAMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD +A              Q   W  VDI  V      + L  IK+ 
Sbjct: 61  GIVGIAEVVTNAYPDSSAFDPESKYFDPKSDPQQPRWLRVDIRFVKQFKEIIPLSLIKSL 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGK 137
           P+L+ M L+   SRLS+QPVT +++  V  + +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTEEQWQAVLMLAR 153


>gi|78223566|ref|YP_385313.1| hypothetical protein Gmet_2363 [Geobacter metallireducens GS-15]
 gi|78194821|gb|ABB32588.1| protein of unknown function DUF589 [Geobacter metallireducens
           GS-15]
          Length = 158

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 87/152 (57%), Gaps = 15/152 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGR-EI 60
           +WL KSEPS +S+   + +    E W GVRN+QARN +R +++ GD   FYHSN     I
Sbjct: 7   FWLFKSEPSCFSFDDLKARPNGTEHWDGVRNFQARNLLRDEIKPGDGVLFYHSNIPEPAI 66

Query: 61  VGIFEVITCTYPD-----PTAEQ--------SSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VGI EV++  YPD     P+AE         +  W  VD+  V  +  PV+L  +K +  
Sbjct: 67  VGIAEVVSEGYPDWTALDPSAEHFDPRAGGDNPVWYMVDVRYVRPLKRPVTLNEMKIHSE 126

Query: 108 LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLS 139
           LS M+L+  SRLSVQPVT  E+  + R+G + 
Sbjct: 127 LSGMVLLKRSRLSVQPVTQHEWEYILRLGGID 158


>gi|226228590|ref|YP_002762696.1| hypothetical protein GAU_3184 [Gemmatimonas aurantiaca T-27]
 gi|226091781|dbj|BAH40226.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 164

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 81/149 (54%), Gaps = 15/149 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREI 60
           YWL+KSEP  +S+       +    W  +RN  ARN +R  M+VGD+ F+YHSN +   I
Sbjct: 12  YWLIKSEPDVFSFDDLMQAPQRTTCWDSIRNSGARNFLRDGMKVGDRCFYYHSNAEPSAI 71

Query: 61  VGIFEVITCTYPDPTAEQSS-------------CWECVDICAVCSMPCPVSLMAIKANPR 107
            G+ EV+   YPD TA   S              W  VD+ AV +    V+L  IKA+P 
Sbjct: 72  AGVCEVVREGYPDHTAFDPSHEYYDEKSDPAMPTWFMVDVKAVAAFKTLVTLPQIKADPA 131

Query: 108 LSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
           L+ M L+  SRLSV PVT DE+  VC +G
Sbjct: 132 LAEMALLRVSRLSVVPVTADEWAHVCALG 160


>gi|317484552|ref|ZP_07943460.1| hypothetical protein HMPREF0179_00811 [Bilophila wadsworthia 3_1_6]
 gi|316924213|gb|EFV45391.1| hypothetical protein HMPREF0179_00811 [Bilophila wadsworthia 3_1_6]
          Length = 166

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 78/151 (51%), Gaps = 15/151 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M +WL KSEP  +S+   ++      +W GVRNYQARN MR  M+ GD GFFYHS K  E
Sbjct: 1   MRHWLFKSEPDCYSFTDLENAPGQTTSWDGVRNYQARNFMRDDMKKGDLGFFYHSGKNPE 60

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           I GI E++   +PD TA+                 W  VD+  V     PV    ++  P
Sbjct: 61  IAGIVEIVREGHPDLTAQDPEAGHFDPKATPGDPRWYMVDVKLVRRFEPPVPRSLLRFVP 120

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRMG 136
            L+ M L+   SRLSVQPV  + Y  + R+ 
Sbjct: 121 ELAGMELMKTGSRLSVQPVEAEAYAAIVRLA 151


>gi|117920920|ref|YP_870112.1| hypothetical protein Shewana3_2477 [Shewanella sp. ANA-3]
 gi|117613252|gb|ABK48706.1| conserved hypothetical protein [Shewanella sp. ANA-3]
          Length = 153

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 86/153 (56%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWFGIRNYQARNFMRDAMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD +A              Q   W  VDI  V      + L  IK+ 
Sbjct: 61  GIVGIAEVVTEAYPDNSAFDPESKYFDPKSDPQQPRWLRVDIRFVKQFKEIIPLSLIKSL 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGK 137
           P+L+ M L+   SRLS+QPVT +++  V  + +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTQEQWQAVLMLAR 153


>gi|120599152|ref|YP_963726.1| hypothetical protein Sputw3181_2348 [Shewanella sp. W3-18-1]
 gi|120559245|gb|ABM25172.1| protein of unknown function DUF55 [Shewanella sp. W3-18-1]
 gi|319426081|gb|ADV54155.1| protein of unknown function DUF55 [Shewanella putrefaciens 200]
          Length = 153

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 64/153 (41%), Positives = 84/153 (54%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN +R  M++GDK FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWYGIRNYQARNFIRDGMQIGDKVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  +DI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTHAYPDSTAFDPESTYFDPKSDPSKPRWLSIDIRFVEKFDHIIPLSLIKNM 120

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
           P+L+ M L+   SRLS+QPVT +++  V  + +
Sbjct: 121 PQLTDMYLVSKGSRLSIQPVTAEQWQTVLMLTR 153


>gi|255076003|ref|XP_002501676.1| predicted protein [Micromonas sp. RCC299]
 gi|226516940|gb|ACO62934.1| predicted protein [Micromonas sp. RCC299]
          Length = 194

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 87/165 (52%), Gaps = 28/165 (16%)

Query: 4   WLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           WLVK+EP E+S   ++   G V + W GVRN QARN M+ MRVGD+ FFYHS+ K   +V
Sbjct: 31  WLVKTEPDEFSLDDLRASPGGVAQ-WDGVRNAQARNLMKTMRVGDRAFFYHSSCKVPAVV 89

Query: 62  GIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIK----- 103
           G+ EV+   YPDPTA                  W CVD+  + +M   V+L  ++     
Sbjct: 90  GVCEVVKTAYPDPTALDPKAPGFDPKSDPTNPKWLCVDVKFIRAMRREVTLSELRREAAG 149

Query: 104 -------ANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
                      L+SM L+  +RLSVQPVT  E+  V R+ +   P
Sbjct: 150 DGVTGADGAKALASMTLLHRARLSVQPVTRAEWEHVLRLEEDEAP 194


>gi|218888067|ref|YP_002437388.1| hypothetical protein DvMF_2983 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218759021|gb|ACL09920.1| protein of unknown function DUF55 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 155

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 57/148 (38%), Positives = 75/148 (50%), Gaps = 14/148 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           +WL K+EP  +S            +W GVRNYQARN MR+MR+GD G FYHS     + G
Sbjct: 4   HWLFKTEPGCFSIAHLAALPGATSSWDGVRNYQARNFMREMRLGDLGLFYHSVTNPSVAG 63

Query: 63  IFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRLS 109
           + E++   YPD TA                  W  VD+  V +   PV L  ++  P L+
Sbjct: 64  VVEIVREAYPDHTAWDPEDRHFDPASTPDKPRWFMVDVRLVRTFAQPVPLALLRTLPELA 123

Query: 110 SM-ILIVSSRLSVQPVTTDEYLEVCRMG 136
            M +L   SRLSVQPV+  EY  V R+ 
Sbjct: 124 DMELLRKGSRLSVQPVSPQEYATVLRLA 151


>gi|170724188|ref|YP_001751876.1| hypothetical protein PputW619_5031 [Pseudomonas putida W619]
 gi|169762191|gb|ACA75507.1| protein of unknown function DUF55 [Pseudomonas putida W619]
          Length = 150

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 82/153 (53%), Gaps = 19/153 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E S    +  GR+GEA W GVRNYQARN +R M VGD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSI---EGLGRLGEARWDGVRNYQARNFLRAMNVGDEFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  +    YPDPTA              + + W  VD+  V +    + L  +K  
Sbjct: 58  GIAGIARITAAAYPDPTALDAQSHYYDAKATAEKNPWSAVDVAHVRTFRQVLGLGLLKQQ 117

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
             L  + L+   +RLSV PVT +++  +  + K
Sbjct: 118 SALEELPLVHKGTRLSVMPVTEEQWAAIIALSK 150


>gi|189425794|ref|YP_001952971.1| hypothetical protein Glov_2738 [Geobacter lovleyi SZ]
 gi|189422053|gb|ACD96451.1| protein of unknown function DUF55 [Geobacter lovleyi SZ]
          Length = 154

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 87/154 (56%), Gaps = 15/154 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGR- 58
           M YWL KSEP  +S++  Q +    E W GVRN+QARN +R +++ GD+  FYHS+    
Sbjct: 1   MRYWLFKSEPGCFSFQDLQARPNATEQWDGVRNFQARNFLRDEIKPGDRVLFYHSSIPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            ++G+  V+   YPD TA   +              W  VD+ A  ++P  V L  I+ +
Sbjct: 61  AVIGLCSVVREGYPDHTALDPAADHFDPKATPDKPIWYMVDVRADQALPSEVPLAVIREH 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLS 139
           P L+ M L+  SRLS+QP+T +++  + ++G L+
Sbjct: 121 PLLTGMPLVNRSRLSIQPLTKEQFETILQLGGLA 154


>gi|258546127|ref|ZP_05706361.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cardiobacterium
           hominis ATCC 15826]
 gi|258518552|gb|EEV87411.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cardiobacterium
           hominis ATCC 15826]
          Length = 158

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 81/151 (53%), Gaps = 15/151 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M YWL+KSEP  +S    + +    E W GVRN+QARN MR+MR GD+ FFYHSN K   
Sbjct: 1   MNYWLLKSEPGNFSLDDLRARPGQREPWDGVRNFQARNFMRQMRAGDRAFFYHSNAKPSG 60

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ E++    PDPT             +  +  W+ V +  V +    VSL  +K  P
Sbjct: 61  IVGVVEIVGEARPDPTQFDPESRYFDAKASLDAPRWDLVVVQFVRAFSAMVSLAQLKDVP 120

Query: 107 RLSSM-ILIVSSRLSVQPVTTDEYLEVCRMG 136
            L+ M ++   SRLSV PVT  E+  V  + 
Sbjct: 121 ALAGMEVVRKGSRLSVSPVTPAEWQAVLALA 151


>gi|153001165|ref|YP_001366846.1| hypothetical protein Shew185_2648 [Shewanella baltica OS185]
 gi|160875835|ref|YP_001555151.1| hypothetical protein Sbal195_2723 [Shewanella baltica OS195]
 gi|217972914|ref|YP_002357665.1| hypothetical protein Sbal223_1737 [Shewanella baltica OS223]
 gi|151365783|gb|ABS08783.1| protein of unknown function DUF55 [Shewanella baltica OS185]
 gi|160861357|gb|ABX49891.1| protein of unknown function DUF55 [Shewanella baltica OS195]
 gi|217498049|gb|ACK46242.1| protein of unknown function DUF55 [Shewanella baltica OS223]
 gi|315268026|gb|ADT94879.1| protein of unknown function DUF55 [Shewanella baltica OS678]
          Length = 153

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 85/153 (55%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR +M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQIEAWHGIRNYQARNFMRDEMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  VDI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTNAYPDSTAFDPESKYFDPKSDPTKPRWLRVDIRFVEKFNDIIPLSLIKNL 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGK 137
           P+L+ M L+   SRLS+QPVT +++  V  + +
Sbjct: 121 PQLADMYLVTKGSRLSIQPVTAEQWQAVLMLTR 153


>gi|70733257|ref|YP_263030.1| hypothetical protein PFL_5972 [Pseudomonas fluorescens Pf-5]
 gi|68347556|gb|AAY95162.1| Family of unknown function (DUF589) superfamily [Pseudomonas
           fluorescens Pf-5]
          Length = 149

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 80/150 (53%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E S +  Q  G+    W GVRNYQARN +R M VGD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDELSIQGLQQLGQA--RWDGVRNYQARNFLRAMAVGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +I   YPDPTA              + + W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGRIIKAAYPDPTALEPDSVYFDPKSSAEKNAWSAIDVAHVETFNKVLRLDYLKQQA 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L+ M L+   SRLSV PVT +++  V  +
Sbjct: 119 ALAEMPLVHKGSRLSVMPVTAEQWAAVLAL 148


>gi|322491283|emb|CBZ26551.1| conserved hypothetical protein [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 161

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 78/149 (52%), Gaps = 16/149 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP ++S  +     +    W GVRNY ARNNM  M VGDK  FYHSN K   + 
Sbjct: 13  YWLLKSEPQKFS--IDDLAKQKTSPWDGVRNYAARNNMCAMSVGDKVLFYHSNTKEPGVA 70

Query: 62  GIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ EV+   Y D TA             ++ + W+ VD+  V      ++L  +K+   L
Sbjct: 71  GLAEVVRLAYDDFTALDKTSEYFDPRATKEKNPWKMVDVKFVAKWDTVLTLHELKSRREL 130

Query: 109 SSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             M L   SRLSVQPV+  EY  + RM +
Sbjct: 131 QKMALFTQSRLSVQPVSASEYAYILRMNE 159


>gi|304409247|ref|ZP_07390868.1| protein of unknown function DUF55 [Shewanella baltica OS183]
 gi|307303250|ref|ZP_07583005.1| protein of unknown function DUF55 [Shewanella baltica BA175]
 gi|304353068|gb|EFM17465.1| protein of unknown function DUF55 [Shewanella baltica OS183]
 gi|306913610|gb|EFN44032.1| protein of unknown function DUF55 [Shewanella baltica BA175]
          Length = 153

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 84/151 (55%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR +M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWHGIRNYQARNFMRDEMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  VDI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTNAYPDSTAFDPESKYFDPKSDPTKPRWLRVDIRFVEKFNDIIPLSLIKNL 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRM 135
           P+L+ M L+   SRLS+QPVT +++  V  +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTAEQWQAVLML 151


>gi|39997373|ref|NP_953324.1| hypothetical protein GSU2275 [Geobacter sulfurreducens PCA]
 gi|39984264|gb|AAR35651.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298506310|gb|ADI85033.1| protein of unknown function DUF55 [Geobacter sulfurreducens KN400]
          Length = 163

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 84/154 (54%), Gaps = 15/154 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL KSEPS +S+     +    E W GVRN+QARN +R +++ GD   FYHSN     +
Sbjct: 7   YWLFKSEPSCFSFDDLGSRPNGTEHWDGVRNFQARNLLRDEIKPGDGVLFYHSNVPDPAV 66

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VGI  V+   YPD TA               +  W  VD+  V  +  PV+L  +K +P 
Sbjct: 67  VGIARVVREGYPDWTALDPAGEHFDPRAGRNNPIWYMVDVRYVKPLARPVTLAELKMHPE 126

Query: 108 LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
           ++ M+L+  SRLSVQPVT  ++  + R+G +  P
Sbjct: 127 VADMVLLQRSRLSVQPVTPAQWEFILRLGGIHEP 160


>gi|87199352|ref|YP_496609.1| hypothetical protein Saro_1331 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135033|gb|ABD25775.1| protein of unknown function DUF589 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 147

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 74/136 (54%), Gaps = 3/136 (2%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGI 63
           WL+KSEP  + W     +G     W GVRN+ A  N+R M+ GD  FFYHSN G EIVG+
Sbjct: 15  WLMKSEPDVYGWDDLVAEGE--GTWDGVRNHLAARNLRSMQPGDLAFFYHSNIGVEIVGV 72

Query: 64  FEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQP 123
             +      DPT +    W  V +  V  +P  V+L  +KA P L+ M LI  SRLSV  
Sbjct: 73  ITISVGGLTDPT-DPEGKWAAVKVKPVEKLPHTVTLKQVKATPELAEMDLIRLSRLSVGA 131

Query: 124 VTTDEYLEVCRMGKLS 139
           V  +E+  + +M  ++
Sbjct: 132 VRPEEWALILKMAGVN 147


>gi|220909340|ref|YP_002484651.1| hypothetical protein Cyan7425_3975 [Cyanothece sp. PCC 7425]
 gi|219865951|gb|ACL46290.1| protein of unknown function DUF55 [Cyanothece sp. PCC 7425]
          Length = 154

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 81/151 (53%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP+ +SW   +        W GVRNYQARN MR +MR+GD+ FFYHSN K +
Sbjct: 1   MNYWLMKSEPNVFSWDDLKAAPEQTTCWEGVRNYQARNFMRDQMRLGDRVFFYHSNVKPQ 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +V+   YPD  A              Q   W  VDI  +     P++L  +K  
Sbjct: 61  IIAGIAQVVREAYPDSFAFDSQSKYFDPKSSPQQPTWFMVDIQYLQDFTPPITLEELKKI 120

Query: 106 PRLSSMILIVSS-RLSVQPVTTDEYLEVCRM 135
             L SM+L+    RLSVQPVT  E+  +  +
Sbjct: 121 QTLESMMLLQKGCRLSVQPVTPAEWQTILNL 151


>gi|126174822|ref|YP_001050971.1| hypothetical protein Sbal_2609 [Shewanella baltica OS155]
 gi|125998027|gb|ABN62102.1| protein of unknown function DUF55 [Shewanella baltica OS155]
          Length = 153

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 83/151 (54%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWHGIRNYQARNFMRDAMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  VDI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTNAYPDSTAFDPESKYFDPKSDPTKPRWLRVDIRFVEKFNDIIPLSLIKNL 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRM 135
           P+L+ M L+   SRLS+QPVT +++  V  +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTAEQWQAVLML 151


>gi|146305360|ref|YP_001185825.1| hypothetical protein Pmen_0319 [Pseudomonas mendocina ymp]
 gi|145573561|gb|ABP83093.1| protein of unknown function DUF55 [Pseudomonas mendocina ymp]
          Length = 149

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     D  R+G+A W GVRNYQARN +R MR GD+ FFYHS+    
Sbjct: 1   MPYWLMKSEPDELSI---HDLQRLGKARWDGVRNYQARNFLRAMRPGDQFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  +   TYPDPTA              + + W  +D+  V +    + L  +K N
Sbjct: 58  GIAGIGRIAGETYPDPTALDPHSHYHDPKASAEKNPWSALDVEFVEAFAEVLPLQQLKNN 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           P L+ + L+   SRLSV PV+  E+  +  M
Sbjct: 118 PLLADLALVQRGSRLSVMPVSEAEWAAILAM 148


>gi|330812492|ref|YP_004356954.1| hypothetical protein PSEBR_a5437 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380600|gb|AEA71950.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 149

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 81/151 (53%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E S    Q   ++G+A W GVRNYQARN +R M VGD  FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSI---QGLEKLGQARWDGVRNYQARNFLRTMAVGDAFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            I GI  ++   YPDPTA +                W  +D+  V + P  + L  +K  
Sbjct: 58  GIAGIGRIVRAAYPDPTALEPDSHYFDPKAGPDKNPWTAIDVAHVETFPHVLKLDYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
             L+ M L+   SRLSV PVT +++  V  +
Sbjct: 118 TALAEMPLVQKGSRLSVMPVTAEQWAAVIAL 148


>gi|312963760|ref|ZP_07778231.1| protein of unknown function DUF589 [Pseudomonas fluorescens WH6]
 gi|311281795|gb|EFQ60405.1| protein of unknown function DUF589 [Pseudomonas fluorescens WH6]
          Length = 149

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 83/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E S    Q   ++GEA W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSI---QGLEKLGEARWDGVRNYQARNFLRAMAEGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +++   YPDPTA                + W  +D+  V + P  +SL  +K  
Sbjct: 58  GIAGIGKIVKTAYPDPTALEPEGHYFDAKATSDKNPWSAIDVSHVQTFPKVLSLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
             L+ + L+   SRLSV PVT +++  V  +
Sbjct: 118 TALAELPLVQKGSRLSVMPVTAEQWAAVLAL 148


>gi|302039338|ref|YP_003799660.1| hypothetical protein NIDE4066 [Candidatus Nitrospira defluvii]
 gi|300607402|emb|CBK43735.1| conserved protein of unknown function DUF589 [Candidatus Nitrospira
           defluvii]
          Length = 161

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 78/151 (51%), Gaps = 15/151 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-REIV 61
           YWL+KSEP  +S        +   +W GVRNYQARN MR M+VGD+  FYHSN     + 
Sbjct: 7   YWLMKSEPEVFSIDDLARSPKGTTSWDGVRNYQARNFMRAMKVGDQVLFYHSNANPPAVA 66

Query: 62  GIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ EV+   YPD T                   W+ VDI  +     P+SL  ++A   L
Sbjct: 67  GVAEVVKTAYPDATQFDKRDTHYDPASNPDEPRWDMVDIRFIRKFVAPLSLDLLRAQAGL 126

Query: 109 SSM-ILIVSSRLSVQPVTTDEYLEVCRMGKL 138
             M +L   SRLSVQPV   E+ EV R+ ++
Sbjct: 127 KGMELLRKGSRLSVQPVRAAEWNEVIRLAEV 157


>gi|308050506|ref|YP_003914072.1| hypothetical protein Fbal_2796 [Ferrimonas balearica DSM 9799]
 gi|307632696|gb|ADN76998.1| protein of unknown function DUF55 [Ferrimonas balearica DSM 9799]
          Length = 155

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 85/151 (56%), Gaps = 18/151 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S    + +G     W GVRNYQARN MR ++++GDK F YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFSIDTLKAQGT--SCWEGVRNYQARNLMRDEVKLGDKVFIYHSSCKHV 58

Query: 59  EIVGIFEVITCTYPD------------PTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI  V    YPD            P ++ ++  W  VD+     +P  VSL AIKAN
Sbjct: 59  GVAGIATVTREAYPDHHQFNPESPYFDPKSDPENPRWIMVDVAYQQHLPL-VSLKAIKAN 117

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
           P L+ M+L+  SRLS+QPVT  E+  +  M 
Sbjct: 118 PALAEMVLVNRSRLSIQPVTEAEWHNILAMA 148


>gi|77461661|ref|YP_351168.1| hypothetical protein Pfl01_5440 [Pseudomonas fluorescens Pf0-1]
 gi|77385664|gb|ABA77177.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 149

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 80/150 (53%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E S K  +  G+    W GVRNYQARN +R M VGD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDELSIKGLEKLGKA--RWDGVRNYQARNFLRAMAVGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++I   YPDPTA +                W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGKIIEAAYPDPTALEPQSHYYDPKATPDKNPWSAIDVAHVETFSRVLKLDYLKQQT 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            L+ M L+   SRLSV PVT +++  V  +
Sbjct: 119 ALAEMPLVQKGSRLSVMPVTAEQWAAVLGL 148


>gi|322504067|emb|CBZ39155.1| unnamed protein product [Leishmania donovani BPK282A1]
          Length = 204

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 79/151 (52%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           + YWL+KSEP ++S  +     +    W GVRNY ARNNM  M VGDK  FYHSN K   
Sbjct: 11  IHYWLLKSEPHKFS--IDDLAKQKTSPWDGVRNYAARNNMCAMSVGDKVLFYHSNTKEPG 68

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           + G+ EV+   Y D TA             ++ + W+ VD+  V      ++L  +K+  
Sbjct: 69  VAGLAEVVRLAYDDFTALERTSEYFDPKATKEKNPWKMVDVKFVAKWDTVLTLHELKSRR 128

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
            L  M L   SRLSVQPV+  EY  + RM +
Sbjct: 129 ELQKMALFTQSRLSVQPVSASEYAYILRMNE 159


>gi|146102710|ref|XP_001469397.1| hypothetical protein [Leishmania infantum]
 gi|134073767|emb|CAM72504.1| conserved hypothetical protein [Leishmania infantum JPCM5]
          Length = 204

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 79/151 (52%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           + YWL+KSEP ++S  +     +    W GVRNY ARNNM  M VGDK  FYHSN K   
Sbjct: 11  IHYWLLKSEPHKFS--IDDLAKQKTSPWDGVRNYAARNNMCAMSVGDKVLFYHSNTKEPG 68

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           + G+ EV+   Y D TA             ++ + W+ VD+  V      ++L  +K+  
Sbjct: 69  VAGLAEVVRLAYDDFTALEKTSEYFDPKATKEKNPWKMVDVKFVAKWDTVLTLHELKSRR 128

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
            L  M L   SRLSVQPV+  EY  + RM +
Sbjct: 129 ELQKMALFTQSRLSVQPVSASEYAYILRMNE 159


>gi|167036253|ref|YP_001671484.1| hypothetical protein PputGB1_5266 [Pseudomonas putida GB-1]
 gi|166862741|gb|ABZ01149.1| protein of unknown function DUF55 [Pseudomonas putida GB-1]
          Length = 153

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 84/154 (54%), Gaps = 19/154 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E S +     GR+GEA W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSIEA---LGRLGEARWDGVRNYQARNFLRAMSEGDEFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  +    YPDPTA                + W  VD+  V ++P  + L  +K  
Sbjct: 58  GIAGIARITRAAYPDPTALDPQSHYYDAKATADKNPWSAVDVAHVQTLPRVLELGWLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
             L+ + L+   SRLSV PVT +++  +  + ++
Sbjct: 118 AGLAELPLVQKGSRLSVMPVTPEQWAVIVALRQM 151


>gi|26991881|ref|NP_747306.1| hypothetical protein PP_5205 [Pseudomonas putida KT2440]
 gi|24987002|gb|AAN70770.1|AE016721_3 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 149

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 80/151 (52%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E S +      R+GEA W GVRNYQARN +R M VGD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSIEAL---ARLGEARWDGVRNYQARNFLRAMSVGDEFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  +    YPDPTA                + W  VD+  V + P  + L  +K  
Sbjct: 58  GIAGIARITRAAYPDPTALDPESHYHDAKATTDKNPWSAVDVAHVQTFPRVLELGRLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
             L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 AGLVELPLVQKGSRLSVMPVTPEQWAVIVAL 148


>gi|330971828|gb|EGH71894.1| hypothetical protein PSYAR_15172 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 149

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G+A W GVRNYQARN +R M  GDK FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGKARWDGVRNYQARNFLRTMAEGDKFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +V    YPDPTA             E+ + W  +D+  V      + L  +K  
Sbjct: 58  GIAGIGKVAKSAYPDPTALDPQSHYHDAKAPEEKNPWSAIDVEFVDIFKHVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|313501183|gb|ADR62549.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 149

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 80/151 (52%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E S +      R+GEA W GVRNYQARN +R M VGD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSIEAL---ARLGEARWDGVRNYQARNFLRAMSVGDEFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  +    YPDPTA                + W  VD+  V + P  + L  +K  
Sbjct: 58  GIAGIARITRAAYPDPTALDPESHYHDTKATTDKNPWSAVDVAHVQTFPRVLELGRLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
             L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 AGLVELPLVQKGSRLSVMPVTPEQWAVIVAL 148


>gi|171909809|ref|ZP_02925279.1| hypothetical protein VspiD_01515 [Verrucomicrobium spinosum DSM
           4136]
          Length = 161

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 84/152 (55%), Gaps = 16/152 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP  +S+   +++ +  E W GVRNYQ RN MR  M+VGD GFFYHS+    
Sbjct: 1   MRYWLLKSEPDVFSFDDLKNRPQRTEPWNGVRNYQVRNMMRDNMKVGDLGFFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + G+ ++ +   PDPT               ++  W  VD+     +   VSL A++  
Sbjct: 61  GVAGVIKIASEARPDPTQFEVGGEYHDPKSKPENPAWLLVDVAWEADLKGFVSLDALREE 120

Query: 106 PRLSS-MILIVSSRLSVQPVTTDEYLEVCRMG 136
           PRL+  +IL   +RLSV  V+  ++  +C+MG
Sbjct: 121 PRLADLLILRRGNRLSVTEVSKKDFDLICKMG 152


>gi|66043584|ref|YP_233425.1| hypothetical protein Psyr_0315 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254291|gb|AAY35387.1| Protein of unknown function DUF589 [Pseudomonas syringae pv.
           syringae B728a]
          Length = 149

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G+A W GVRNYQARN +R M  GDK FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGKARWDGVRNYQARNFLRTMAEGDKFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +V    YPDPTA             E+ + W  +D+  V      + L  +K  
Sbjct: 58  GIAGIGKVARSAYPDPTALDPQSHYHDAKATEEKNPWSAIDVEFVDIFKHVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|294867714|ref|XP_002765200.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239865195|gb|EEQ97917.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 209

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 82/152 (53%), Gaps = 25/152 (16%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGE---------AWTGVRNYQARNNMRKMRVGDKGFFYH 53
           ++L KSEP     K    K  + +          W GVRNYQARN MR+M+VGDKGFFYH
Sbjct: 37  FYLFKSEPESRIEKGVDMKFSIDDLAASPNGTAEWDGVRNYQARNLMREMKVGDKGFFYH 96

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   IVGI EV+  +YPD T              ++   W+ VDI  +  +   +SL
Sbjct: 97  SNCKPPGIVGIVEVVRESYPDDTQFDPKNPHFDPRSGKEEPKWDMVDIKFIRKLSRKISL 156

Query: 100 MAIKA--NPRLSSMILIVSSRLSVQPVTTDEY 129
             +KA  +  LSSM L  ++RLSVQ VT  E+
Sbjct: 157 DELKAYRDKELSSMGLFTTARLSVQRVTPAEW 188


>gi|78356404|ref|YP_387853.1| hypothetical protein Dde_1357 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218809|gb|ABB38158.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 155

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 80/153 (52%), Gaps = 15/153 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP  +S +   +       W GVRNYQARN MR +MR GDK  FYHS K   
Sbjct: 1   MRYWLMKSEPECFSLEDLVNAPEQTTPWDGVRNYQARNFMRDEMRPGDKVLFYHSGKNPA 60

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+ EV    YPD TA              ++  W  VD+  + +   P+ L  +K  P
Sbjct: 61  IAGLAEVSREAYPDHTAWDPENNHFDPRSTPEAPRWFMVDVKYIRTFSSPLPLAYLKTVP 120

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKL 138
            L  M L+   +RLSVQPVT +E+  +  + ++
Sbjct: 121 ELQDMALLRKGNRLSVQPVTENEFNVIMTLAEM 153


>gi|94986954|ref|YP_594887.1| hypothetical protein LI0511 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731203|emb|CAJ54565.1| conserved hypothetical protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 160

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 79/151 (52%), Gaps = 15/151 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M YWL KS+   +S    Q       +W GVRNYQARN MR +MR+GD GFFYHS K  E
Sbjct: 1   MQYWLFKSDTDCYSINDLQSAPNQTTSWDGVRNYQARNFMRDEMRIGDLGFFYHSGKLPE 60

Query: 60  IVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +V+  +YPD TA+             ++  W  VD+  V      +    ++   
Sbjct: 61  IAGIVKVVKESYPDHTAQDPENDHYDPSATPENPRWYMVDVQLVKVFHPTIPRNLLRLQH 120

Query: 107 RLSSM-ILIVSSRLSVQPVTTDEYLEVCRMG 136
            LS M +L   SRLS+QPV+ + +  + R+ 
Sbjct: 121 DLSGMELLKAGSRLSIQPVSQEHFNNIIRLA 151


>gi|220905579|ref|YP_002480891.1| hypothetical protein Ddes_2318 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869878|gb|ACL50213.1| protein of unknown function DUF55 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 158

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 78/153 (50%), Gaps = 15/153 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGREIV 61
           YWL+KSEP  +S      +     +W GVRN+QARN +R +M VGD   FYHS      V
Sbjct: 5   YWLLKSEPGCYSIDDLAAEPDQVTSWGGVRNFQARNFLRDQMAVGDMAIFYHSVTAPSAV 64

Query: 62  GIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+  V+   YPDPTA              +   W  VDI  V     PV L A++  P L
Sbjct: 65  GVARVVRTGYPDPTAWEPEDEHFDPRSTPEKPLWFAVDIRFVKKFANPVPLKAMRMVPAL 124

Query: 109 SSM-ILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
             M +L   SRLSV PV+ +E+  +C+MG   +
Sbjct: 125 FGMELLRKGSRLSVMPVSKEEFAVICKMGDAED 157


>gi|163848920|ref|YP_001636964.1| hypothetical protein Caur_3390 [Chloroflexus aurantiacus J-10-fl]
 gi|222526877|ref|YP_002571348.1| hypothetical protein Chy400_3654 [Chloroflexus sp. Y-400-fl]
 gi|163670209|gb|ABY36575.1| protein of unknown function DUF55 [Chloroflexus aurantiacus
           J-10-fl]
 gi|222450756|gb|ACM55022.1| protein of unknown function DUF55 [Chloroflexus sp. Y-400-fl]
          Length = 138

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 76/135 (56%), Gaps = 3/135 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL+K+EP+ +S+     +GR    W GV N  A  +MR+MR GD+   YH+   R+ VG
Sbjct: 4   YWLLKTEPTVYSFADLVREGRT--VWDGVSNNVALKHMREMRSGDEALIYHTGDERQAVG 61

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           + +V++  YPDP          VD+  + ++P PVSL  IKA+P  +   L+   RLSV 
Sbjct: 62  LAQVVSDPYPDPKQSDPRLI-VVDVVPLRALPHPVSLNDIKADPFFADFALVRQGRLSVV 120

Query: 123 PVTTDEYLEVCRMGK 137
           PV+  ++  +  M +
Sbjct: 121 PVSAAQWERLLAMAE 135


>gi|294867718|ref|XP_002765202.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239865197|gb|EEQ97919.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 209

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 82/152 (53%), Gaps = 25/152 (16%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGE---------AWTGVRNYQARNNMRKMRVGDKGFFYH 53
           ++L KSEP     K    K  + +          W GVRNYQARN MR+M++GDKGFFYH
Sbjct: 37  FYLFKSEPESRIEKGVDMKFSIDDLAASPNGTAEWDGVRNYQARNLMREMKIGDKGFFYH 96

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   IVGI EV+  +YPD T              ++   W+ VDI  +  +   +SL
Sbjct: 97  SNCKPPGIVGIVEVVRESYPDDTQFDPKNPHFDPRSGKEEPKWDMVDIKFIRKLSRKISL 156

Query: 100 MAIKA--NPRLSSMILIVSSRLSVQPVTTDEY 129
             +KA  +  LSSM L  ++RLSVQ VT  E+
Sbjct: 157 DELKAYRDKELSSMGLFTTARLSVQRVTPAEW 188


>gi|95928813|ref|ZP_01311559.1| protein of unknown function DUF589 [Desulfuromonas acetoxidans DSM
           684]
 gi|95135158|gb|EAT16811.1| protein of unknown function DUF589 [Desulfuromonas acetoxidans DSM
           684]
          Length = 154

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 76/145 (52%), Gaps = 16/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP  +     Q      E W GVRNYQARN MR  M++GD  FFYHSN    
Sbjct: 1   MNYWLMKSEPEAFGIDDLQQMPEQTEHWDGVRNYQARNMMRDDMKIGDLAFFYHSNCAEP 60

Query: 60  -IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+   YPD TA   +              W  VDI  V  +  P++L  +K  
Sbjct: 61  GIVGIMEVVKEGYPDFTAFDPNSKYFDAKSVGDKPRWFMVDIRYVRHLKRPIALKELKEY 120

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
           P+L  M IL   +RLS+ PV+ + +
Sbjct: 121 PQLDGMQILRKGNRLSITPVSKEHW 145


>gi|37521234|ref|NP_924611.1| hypothetical protein glr1665 [Gloeobacter violaceus PCC 7421]
 gi|35212230|dbj|BAC89606.1| glr1665 [Gloeobacter violaceus PCC 7421]
          Length = 175

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 78/153 (50%), Gaps = 17/153 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-RE 59
           MA WL KSEP  +S    +  G     W+GVRNYQARN M  MRVGD GFFYHSN     
Sbjct: 1   MARWLFKSEPGAYSIADLKADGTTD--WSGVRNYQARNFMLAMRVGDLGFFYHSNANPTG 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           + GI EV+   YPD TA   +              W+ VD+         V+L  ++A  
Sbjct: 59  VAGIVEVVREAYPDHTALDPASPYFDAKATAAKPIWQMVDVAFGAQFAEVVTLERLRATA 118

Query: 107 RLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGKL 138
            L  M +L   SRLSV PV+  E+  + ++ +L
Sbjct: 119 GLEQMPLLRRGSRLSVLPVSPGEWEIILKVARL 151


>gi|297624484|ref|YP_003705918.1| hypothetical protein Trad_2265 [Truepera radiovictrix DSM 17093]
 gi|297165664|gb|ADI15375.1| protein of unknown function DUF55 [Truepera radiovictrix DSM 17093]
          Length = 169

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 80/152 (52%), Gaps = 15/152 (9%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVG 62
           WL+K+EP  +S+            W GVRNYQARN +R+MR GD    YHSN + + +VG
Sbjct: 7   WLLKTEPEVFSFAELLAAPERTTVWDGVRNYQARNFLREMRRGDPVLIYHSNTRAKGVVG 66

Query: 63  IFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPRLS 109
           +  V+   +PDPT               ++  W  V + A C++P PVSL  +K +P L 
Sbjct: 67  LATVVREAFPDPTQFDPESPYVDPKATPEAPRWVAVAVRARCALPLPVSLQTLKTHPELQ 126

Query: 110 SMILI-VSSRLSVQPVTTDEYLEVCRMGKLSN 140
            + L+   +RLSV PV   E   + ++  +++
Sbjct: 127 GLPLVRRGNRLSVMPVGAAELEVILKLAGVTD 158


>gi|237798003|ref|ZP_04586464.1| hypothetical protein POR16_04079 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331020854|gb|EGI00911.1| hypothetical protein POR16_04079 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 149

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G+A W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGKARWDGVRNYQARNFLRAMAAGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI ++    YPDPTA             E+ + W  +D+  V      + L  +K  
Sbjct: 58  GIAGIGKIARVAYPDPTALDPDSHYHDAKATEEKNPWSAIDVEFVDIFKKVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|29654756|ref|NP_820448.1| hypothetical protein CBU_1465 [Coxiella burnetii RSA 493]
 gi|161830317|ref|YP_001597306.1| hypothetical protein COXBURSA331_A1642 [Coxiella burnetii RSA 331]
 gi|29542024|gb|AAO90962.1| hypothetical protein CBU_1465 [Coxiella burnetii RSA 493]
 gi|161762184|gb|ABX77826.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
          Length = 152

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 85/152 (55%), Gaps = 18/152 (11%)

Query: 1   MAYWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KG 57
           M YWL+KSEP+ +S   + ++K ++   W GVRNYQARN MR  M+ GD  FFYHSN + 
Sbjct: 1   MNYWLLKSEPTSYSIDDLFREKNKITR-WDGVRNYQARNFMRDGMKKGDLAFFYHSNCEK 59

Query: 58  REIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKA 104
             IVG+FEV+  +YPD TA               +  W  VDI      P  +SL  ++ 
Sbjct: 60  PGIVGVFEVVRESYPDLTALDPEDHHYDPKSTPDNPRWLMVDIKFRKKFPQVISLQELRQ 119

Query: 105 NPRLSS-MILIVSSRLSVQPVTTDEYLEVCRM 135
           NP+L   +IL   +RLS+ PV+   +  + ++
Sbjct: 120 NPKLKDLLILRKGNRLSITPVSKAHWDAIMKL 151


>gi|326389011|ref|ZP_08210593.1| hypothetical protein Y88_3756 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206611|gb|EGD57446.1| hypothetical protein Y88_3756 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 149

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/133 (40%), Positives = 71/133 (53%), Gaps = 3/133 (2%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGI 63
           WL+KSEP  +S+     +G     W GVRN+ A  N+R MR GD  FFYHSN GREIV +
Sbjct: 15  WLMKSEPDVYSYDDLVAEGE--GTWDGVRNHLAARNLRSMREGDLVFFYHSNIGREIVAV 72

Query: 64  FEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQP 123
             +      DPT +    W  V +  V  +  P++L  IKA P L+ M L+  SRLSV  
Sbjct: 73  ATISVPGLTDPT-DPEGKWAAVKLRPVAKLARPITLAEIKATPALAEMDLLRLSRLSVSS 131

Query: 124 VTTDEYLEVCRMG 136
           V   E+  +  M 
Sbjct: 132 VRPTEWALLLEMA 144


>gi|330900024|gb|EGH31443.1| hypothetical protein PSYJA_21697 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 149

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G A W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGNARWDGVRNYQARNFLRAMAKGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K  
Sbjct: 58  GIAGIGKIARSAYPDPTALDPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|229593254|ref|YP_002875373.1| hypothetical protein PFLU5887 [Pseudomonas fluorescens SBW25]
 gi|229365120|emb|CAY53346.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 149

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 83/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E S    +   ++GEA W GVRNYQARN +R M VGD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSINGLE---KLGEARWDGVRNYQARNFLRAMAVGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +++   YPDPTA              + + W  +++  V + P  + L  +K  
Sbjct: 58  GIAGIGKIVEAAYPDPTALEPQSHYFDAKATPEKNPWSAINVAHVQTFPKVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
             L+ + L+   SRLSV  VT +++  V  +
Sbjct: 118 TALAELPLVQKGSRLSVMAVTPEQWAAVINL 148


>gi|302186800|ref|ZP_07263473.1| hypothetical protein Psyrps6_10645 [Pseudomonas syringae pv.
           syringae 642]
          Length = 149

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G A W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGNARWDGVRNYQARNFLRAMTEGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K  
Sbjct: 58  GIAGIGKIARSAYPDPTALDPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|284108707|ref|ZP_06386434.1| protein containing DUF55 [Candidatus Poribacteria sp. WGA-A3]
 gi|283829875|gb|EFC34165.1| protein containing DUF55 [Candidatus Poribacteria sp. WGA-A3]
          Length = 161

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 85/159 (53%), Gaps = 17/159 (10%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-REI 60
            YWL+KSEPS +S        +    W GVRNYQARN +R M VGD  FFYHSN     I
Sbjct: 3   GYWLLKSEPSTFSIADLARSPKRTTCWEGVRNYQARNFLRAMAVGDLAFFYHSNADPPAI 62

Query: 61  VGIFEVITCTYP-------------DPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VGI E++   YP             D +++Q+  W  VD+     +  P+SL ++++   
Sbjct: 63  VGIVEIVKAAYPDYFAWRPGSRYFDDKSSKQNPRWVMVDVRLKEILRAPLSLESLRSVRG 122

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCRM--GKLSNPPL 143
           L  M +L   SRLSVQPV  +E+  + ++   K  +PPL
Sbjct: 123 LERMELLRKGSRLSVQPVRENEWKIIVQLSQAKPVSPPL 161


>gi|28872341|ref|NP_794960.1| hypothetical protein PSPTO_5229 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971852|ref|ZP_03399954.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301383389|ref|ZP_07231807.1| hypothetical protein PsyrptM_12161 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302134950|ref|ZP_07260940.1| hypothetical protein PsyrptN_26397 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28855596|gb|AAO58655.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213923398|gb|EEB56991.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|331016123|gb|EGH96179.1| hypothetical protein PLA106_08965 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 149

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G+A W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGKARWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +++   YPDPTA              + + W  +DI  V      + L  +K  
Sbjct: 58  GIAGIGKIVKTAYPDPTALDPDSHYHDAKATTEKNPWSALDIGFVDIFKNVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|330951217|gb|EGH51477.1| hypothetical protein PSYCIT7_07434 [Pseudomonas syringae Cit 7]
          Length = 149

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 81/151 (53%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G A W GVRNYQARN +R M  GD  FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGNARWDGVRNYQARNFLRAMTEGDAFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K  
Sbjct: 58  GIAGIAKIARSAYPDPTALDPESHYHDAKATEEKNPWSAIDVEFVENFKRVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|322821020|gb|EFZ27471.1| hypothetical protein TCSYLVIO_6321 [Trypanosoma cruzi]
          Length = 167

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 77/152 (50%), Gaps = 16/152 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHS-NKGREIV 61
           YWL+KS+   +S    +  G     W GVRNY ARNNMR M VGD+  FYHS  K   + 
Sbjct: 14  YWLMKSDFHTFSIDDLKKSG--CSPWDGVRNYAARNNMRAMNVGDRILFYHSCAKPAGVA 71

Query: 62  GIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+  V+   YPD TA             ++ + WE VDI      P  V+L  +KA   L
Sbjct: 72  GLAVVVKTAYPDHTALDPASPHYDVKATKEKNPWEMVDIQFEEKFPSLVTLERLKAEKEL 131

Query: 109 SSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
             M L   +RLSVQPVT  EY  V  +G+ S 
Sbjct: 132 RDMKLFSMARLSVQPVTRSEYEYVVWLGRGSK 163


>gi|302064082|ref|ZP_07255623.1| hypothetical protein PsyrptK_29210 [Pseudomonas syringae pv. tomato
           K40]
          Length = 149

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G+A W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSI---SDLQRLGKARWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +++   YPDPTA              + + W  +DI  V      + L  +K  
Sbjct: 58  GIAGIGKIVKTAYPDPTALDPDSHYHDAKATTEKNPWSALDIGFVDIFKNVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEKLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|330977242|gb|EGH77198.1| hypothetical protein PSYAP_11025 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 149

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 81/151 (53%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G A W GVRNYQARN +R M  GD  FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGNARWDGVRNYQARNFLRAMAEGDAFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K  
Sbjct: 58  GIAGIGKIARSAYPDPTALDPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILTL 148


>gi|297831924|ref|XP_002883844.1| hypothetical protein ARALYDRAFT_319455 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297329684|gb|EFH60103.1| hypothetical protein ARALYDRAFT_319455 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 155

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 78/136 (57%), Gaps = 7/136 (5%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+K+EPSEWSW  Q+  G + + W GV+N QA+ N++ M +GD  FFYHS  K R +V
Sbjct: 7   YWLLKTEPSEWSWSDQEANGGISK-WDGVKNKQAQKNLKSMTLGDLCFFYHSGTKARCVV 65

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPR-LSSMILIVSSRLS 120
           G+ EV    Y D    + +    VD+ A+  M   V L  +K +   + S +L    RLS
Sbjct: 66  GVVEVSREWYTDDDEGEGA----VDVKAIGEMRKCVDLKEMKGDKGIIKSFVLFRQPRLS 121

Query: 121 VQPVTTDEYLEVCRMG 136
           V PV  D + ++C +G
Sbjct: 122 VVPVEEDVWKKICELG 137


>gi|330965563|gb|EGH65823.1| hypothetical protein PSYAC_13076 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 149

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G++ W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGKSRWDGVRNYQARNFLRAMAEGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +++   YPDPTA              + + W  +DI  V      + L  +K  
Sbjct: 58  GIAGIGKIVKTAYPDPTALDPDSHYHDAKATTEKNPWSAIDIGFVDIFKNVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|148656611|ref|YP_001276816.1| hypothetical protein RoseRS_2489 [Roseiflexus sp. RS-1]
 gi|148568721|gb|ABQ90866.1| protein of unknown function DUF55 [Roseiflexus sp. RS-1]
          Length = 142

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 73/138 (52%), Gaps = 3/138 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           +WL+K+EP  ++W   +  GR    W GV N  A   +R+M+ GD+   YH+   R  VG
Sbjct: 5   FWLLKTEPDCYAWSDLERDGRT--VWDGVANNVALKYLREMQPGDEALIYHTGDERCAVG 62

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
             EVI+  YPDP          VDI  +  +P PVSL AIKA+P  +   L+  SRLSV 
Sbjct: 63  RAEVISAPYPDPQHNDPRM-VVVDIRPLAPLPRPVSLTAIKADPAFADFALVRQSRLSVV 121

Query: 123 PVTTDEYLEVCRMGKLSN 140
           PVT   +  +  M  + +
Sbjct: 122 PVTEAHWRRLLAMAGMES 139


>gi|330874061|gb|EGH08210.1| hypothetical protein PSYMP_05804 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 149

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G++ W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGKSRWDGVRNYQARNFLRAMAEGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +++   YPDPTA              + + W  +DI  V      + L  +K  
Sbjct: 58  GIAGIGKIVKNAYPDPTALDPDSHYHDAKATTEKNPWSAIDIGFVDIFKNVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  V  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAVLAL 148


>gi|330501292|ref|YP_004378161.1| hypothetical protein MDS_0378 [Pseudomonas mendocina NK-01]
 gi|328915578|gb|AEB56409.1| hypothetical protein MDS_0378 [Pseudomonas mendocina NK-01]
          Length = 149

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 79/151 (52%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     D  R+G+  W GVRNYQARN MR M+ GD  FFYHS+    
Sbjct: 1   MPYWLMKSEPDELSI---LDLQRLGKTRWDGVRNYQARNFMRAMKPGDLFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  +    YPDPTA              + + W  +D+  V +    + L  +K N
Sbjct: 58  GIAGIARIAGEVYPDPTALDPQSHYHDPKASAEKNPWSALDVEFVEAFGEVLPLQHLKNN 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           P L+ + L+   SRLSV PVT  E+  +  M
Sbjct: 118 PLLADLALVQRGSRLSVMPVTEAEWTAILAM 148


>gi|254452852|ref|ZP_05066289.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
 gi|198267258|gb|EDY91528.1| conserved hypothetical protein [Octadecabacter antarcticus 238]
          Length = 97

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 59/94 (62%), Gaps = 1/94 (1%)

Query: 43  MRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAI 102
           M  GD GFFYHS K + +VGI EV    +PD T +    W CVDI AV     PV L  I
Sbjct: 1   MARGDLGFFYHSQKEKAVVGIVEVCAPAHPDSTTDDDR-WACVDIKAVRPFAKPVKLEQI 59

Query: 103 KANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
           K + RL  M+L+ +SRLSVQPV+ DE+L +C +G
Sbjct: 60  KTHERLGEMVLVKNSRLSVQPVSKDEWLAICALG 93


>gi|330957121|gb|EGH57381.1| hypothetical protein PMA4326_00940 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 149

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  ++G+A W GVRNYQARN +R M VGD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSI---SDLKKLGKARWDGVRNYQARNFLRAMAVGDEFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI ++    YPDPTA              + + W  +D+  V      + L  +K  
Sbjct: 58  GIAGIGKIAKAAYPDPTALDPDSHYHDAKATTEKNPWSAIDVEFVDIFKNVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWSAILAL 148


>gi|152986473|ref|YP_001351288.1| hypothetical protein PSPA7_5972 [Pseudomonas aeruginosa PA7]
 gi|150961631|gb|ABR83656.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 152

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/152 (40%), Positives = 80/152 (52%), Gaps = 19/152 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           AYWL+KSEP E S     D  R+G A W GVRNYQARN MR M  GD  FFYHS+     
Sbjct: 3   AYWLMKSEPDELSI---LDLKRLGTARWDGVRNYQARNFMRSMNPGDLFFFYHSSCPQPG 59

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +    YPDPTA              + + W   D+  V +    V L  +KA  
Sbjct: 60  IAGIARIEGEAYPDPTALDPASPYHDPKASAEKNPWSARDVSFVEAFAEVVPLARLKAQE 119

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
            L+++ L+   SRLSV PV+ +E+  +  +GK
Sbjct: 120 ALANLALVQKGSRLSVMPVSAEEWQAILPLGK 151


>gi|302608306|emb|CBW44759.1| conserved hypothetical protein [Marinobacter hydrocarbonoclasticus]
          Length = 152

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 83/152 (54%), Gaps = 19/152 (12%)

Query: 1   MAYWLVKSEPSEWSWK--MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGR 58
           MA WLVK+EPSE       +Q +G +   W GVRNYQARN + KM+VGD  F YHS+  R
Sbjct: 1   MAKWLVKTEPSECGIDDFARQPEGVI--PWDGVRNYQARNFLAKMQVGDLVFIYHSSCKR 58

Query: 59  -EIVGIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKA 104
             I GI  V+   YPDP             +  ++  W+ VD+     +P  +SL  +KA
Sbjct: 59  IGIAGIVRVVKSAYPDPSQFNPESPYYDPKSTAENPRWQAVDLQFERKLPALISLDTLKA 118

Query: 105 NPRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            P LS + L+   SRLSV PV+  E+ ++  +
Sbjct: 119 MPELSELPLVRRGSRLSVMPVSDAEWQQILHL 150


>gi|331009494|gb|EGH89550.1| hypothetical protein PSYTB_07351 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 149

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E+S    Q++G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQNRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPASHYHDAKATADKNPWSAIDVEFVDVFKSVLGLGYLKQQS 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|257481859|ref|ZP_05635900.1| hypothetical protein PsyrptA_01243 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 149

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E+S    Q++G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQNRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKATADKNPWSAIDVEFVDVFKSVLGLGYLKQQS 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|289610010|emb|CBI60342.1| unnamed protein product [Sordaria macrospora]
          Length = 132

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 69/137 (50%), Gaps = 6/137 (4%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+KSEP  + W      G  G  W GVRN+ A  ++R M  GD+  FYHS K +  
Sbjct: 1   MAYWLLKSEPDSYGWDDLVRDG--GTEWDGVRNHAAAKHLRAMAAGDRALFYHSGKDKAA 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI  +         A+    W  V +     +P PV+L  +KA   L  M ++  SRLS
Sbjct: 59  VGIARIARTA----QADGDEGWVSVLVEPDHPLPRPVTLKTMKAAEGLQDMAMLRQSRLS 114

Query: 121 VQPVTTDEYLEVCRMGK 137
           V PVT  E+  V  + K
Sbjct: 115 VSPVTEAEWKVVMGLAK 131


>gi|156742339|ref|YP_001432468.1| hypothetical protein Rcas_2368 [Roseiflexus castenholzii DSM 13941]
 gi|156233667|gb|ABU58450.1| protein of unknown function DUF55 [Roseiflexus castenholzii DSM
           13941]
          Length = 142

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 3/138 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           +WL+K+EP  ++W      GR    W GV N  A  ++R+M+ GD+   YH+   R  VG
Sbjct: 5   FWLLKTEPDCYAWSDLVRDGRT--VWDGVANNVALKHLREMQPGDEALIYHTGDERRAVG 62

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
             EVI+  YPDP          VD+  +  +P PV+L  IKA+P  +   L+  SRLSV 
Sbjct: 63  RAEVISTPYPDPHQSDPRLI-VVDVRPLAPLPRPVALADIKADPAFADFALVRQSRLSVV 121

Query: 123 PVTTDEYLEVCRMGKLSN 140
           PVT  ++  +  M  +++
Sbjct: 122 PVTEAQWQRLLAMAGVAS 139


>gi|77918916|ref|YP_356731.1| hypothetical protein Pcar_1312 [Pelobacter carbinolicus DSM 2380]
 gi|77544999|gb|ABA88561.1| uncharacterized conserved protein [Pelobacter carbinolicus DSM
           2380]
          Length = 165

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 85/156 (54%), Gaps = 16/156 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL+KSEP  +S    +D       W GVRNYQARN +R +++ GD   FYHSN +   I
Sbjct: 7   YWLMKSEPGCFSIDDLKDCPDGISPWDGVRNYQARNLLRDEIKAGDGVLFYHSNIREPAI 66

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VG+  V+   YPD TA             + +  W  VD+  V  +  P++   ++ +PR
Sbjct: 67  VGVARVVRAGYPDHTARDPQSEHFDPRSTDAAPIWYMVDVQYVAHLVRPLTRDDLRQHPR 126

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCRMGKLSNPP 142
           L  M +L   +RLSVQPV+ +++ +V R G +S  P
Sbjct: 127 LMDMAVLKRGNRLSVQPVSEEQWRDVLRFGGMSELP 162


>gi|159897234|ref|YP_001543481.1| hypothetical protein Haur_0705 [Herpetosiphon aurantiacus ATCC
           23779]
 gi|159890273|gb|ABX03353.1| protein of unknown function DUF55 [Herpetosiphon aurantiacus ATCC
           23779]
          Length = 133

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 73/130 (56%), Gaps = 5/130 (3%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           MA+WL+K+EP+E+SW   +D  R G   W GV N QA  N+R M++ D+   YHS   R 
Sbjct: 1   MAFWLLKTEPNEFSW---EDLLRDGSTVWNGVTNAQALINLRAMQLDDQCLIYHSGDVRA 57

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
            VGI  V    YPDP +E       V+I  V  +  PVSL  IKA P L+   L+  SRL
Sbjct: 58  AVGIARVSRTAYPDPNSENPKH-VVVEIEPVGPLAQPVSLAQIKAEPSLADWALVRQSRL 116

Query: 120 SVQPVTTDEY 129
           SV P   +++
Sbjct: 117 SVVPCNPEQW 126


>gi|71747986|ref|XP_823048.1| hypothetical protein [Trypanosoma brucei TREU927]
 gi|70832716|gb|EAN78220.1| hypothetical protein, conserved [Trypanosoma brucei]
 gi|261332909|emb|CBH15904.1| hypothetical protein, conserved [Trypanosoma brucei gambiense
           DAL972]
          Length = 161

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 79/148 (53%), Gaps = 15/148 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP+++S  +   K      W GVRNY ARNNM+ M+VGD   FYHSN K   +V
Sbjct: 14  YWLMKSEPNKFS--IDDLKKCTRSPWDGVRNYAARNNMKLMKVGDCVLFYHSNAKPSGVV 71

Query: 62  GIFEVITCTYPDPT------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPRLS 109
           G+  V+   YPD T            A + + WE VD+         VSL  +K   +L 
Sbjct: 72  GLASVVKTAYPDHTALDPKSEYYDARASKKNPWEMVDVQFEEKFASIVSLEELKKEKKLQ 131

Query: 110 SMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           +M L   SRLSVQPV   EY  V  +G+
Sbjct: 132 AMQLFSQSRLSVQPVEKSEYDHVVSLGR 159


>gi|330938766|gb|EGH42300.1| hypothetical protein PSYPI_07710 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 149

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E+S    Q  G     W GVRNYQARN +R M  GD  FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQGLGNA--RWDGVRNYQARNFLRAMTEGDAFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGKIARSAYPDPTALNPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQS 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|332531865|ref|ZP_08407750.1| hypothetical protein PH505_aa01720 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038841|gb|EGI75283.1| hypothetical protein PH505_aa01720 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 152

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 78/152 (51%), Gaps = 15/152 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S    ++  +    W GVRNYQARN MR  ++VGD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDAFSLDDLKNAPKQTTLWEGVRNYQARNFMRDGVKVGDSVMIYHSSCKHV 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            + GI EV    YPDPT    S              W  V++     +   +SL  IKAN
Sbjct: 61  GVAGIAEVTKEAYPDPTQFNLSSDYYDAKATSDKPRWVVVEVTYQSHLKKLISLKDIKAN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             ++ + L    RLS+ PVT +++ E+ +M +
Sbjct: 121 DNITEIALKKGGRLSIMPVTKNDWDEIIKMAQ 152


>gi|71666736|ref|XP_820324.1| hypothetical protein [Trypanosoma cruzi strain CL Brener]
 gi|70885664|gb|EAN98473.1| hypothetical protein, conserved [Trypanosoma cruzi]
          Length = 167

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 77/149 (51%), Gaps = 16/149 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHS-NKGREIV 61
           YWL+KS+   +S    +  G     W GVRNY ARNNMR M+VGD+  FYHS  K   + 
Sbjct: 14  YWLMKSDFHTFSIDDLKKSG--CSPWDGVRNYAARNNMRAMKVGDRILFYHSCAKPAGVA 71

Query: 62  GIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+  V+   YPD TA             ++ + WE VD+      P  V+L  +KA   L
Sbjct: 72  GLAVVVRTAYPDHTALDPASPYYDVRATKEKNPWEMVDVQFEEKFPSLVTLERLKAEKEL 131

Query: 109 SSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             M L   +RLSVQPVT  EY  V  +G+
Sbjct: 132 RDMKLFSMARLSVQPVTRSEYECVVWLGR 160


>gi|289625067|ref|ZP_06458021.1| hypothetical protein PsyrpaN_08017 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|298485171|ref|ZP_07003265.1| hypothetical protein PSA3335_0583 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160283|gb|EFI01310.1| hypothetical protein PSA3335_0583 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330870345|gb|EGH05054.1| hypothetical protein PSYAE_24448 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 149

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E+S    Q +G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVRNYQARNFLRSMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKASADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|320322152|gb|EFW78248.1| hypothetical protein PsgB076_25224 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331806|gb|EFW87744.1| hypothetical protein PsgRace4_02055 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 149

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E+S    Q +G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKATADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|212212171|ref|YP_002303107.1| hypothetical protein CbuG_0543 [Coxiella burnetii CbuG_Q212]
 gi|212010581|gb|ACJ17962.1| hypothetical protein CbuG_0543 [Coxiella burnetii CbuG_Q212]
          Length = 152

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 18/152 (11%)

Query: 1   MAYWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KG 57
           M YWL+KSEP+ +S   + ++K ++   W GVRNYQARN MR  M+ GD  FFYHSN + 
Sbjct: 1   MNYWLLKSEPTSYSIDDLFREKNKITR-WDGVRNYQARNFMRDGMKKGDLAFFYHSNCEK 59

Query: 58  REIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKA 104
             IVG+ EV+  +YPD TA               +  W  VDI      P  +SL  ++ 
Sbjct: 60  PGIVGVVEVVRESYPDLTALDPKDHHYDPKSTPDNPRWLMVDIKFRKKFPQVISLQELRQ 119

Query: 105 NPRLSS-MILIVSSRLSVQPVTTDEYLEVCRM 135
           NP+L   +IL   +RLS+ PV+   +  + ++
Sbjct: 120 NPKLKDLLILRKGNRLSITPVSKAHWDAIMKL 151


>gi|330886082|gb|EGH19983.1| hypothetical protein PSYMO_00195 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330987956|gb|EGH86059.1| hypothetical protein PLA107_23235 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 149

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E+S    Q +G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKASADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|154707774|ref|YP_001423923.1| hypothetical protein CBUD_0509 [Coxiella burnetii Dugway 5J108-111]
 gi|161349750|ref|ZP_02097132.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165919395|ref|ZP_02219461.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212219189|ref|YP_002305976.1| hypothetical protein CbuK_1696 [Coxiella burnetii CbuK_Q154]
 gi|154357060|gb|ABS78522.1| hypothetical protein CBUD_0509 [Coxiella burnetii Dugway 5J108-111]
 gi|164601659|gb|EDQ95189.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165916911|gb|EDR35515.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212013451|gb|ACJ20831.1| hypothetical protein CbuK_1696 [Coxiella burnetii CbuK_Q154]
          Length = 152

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 84/152 (55%), Gaps = 18/152 (11%)

Query: 1   MAYWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KG 57
           M YWL+KSEP+ +S   + ++K ++   W GVRNYQARN MR  M+ GD  FFYHSN + 
Sbjct: 1   MNYWLLKSEPTSYSIDDLFREKNKITR-WDGVRNYQARNFMRDGMKKGDLAFFYHSNCEK 59

Query: 58  REIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKA 104
             IVG+ EV+  +YPD TA               +  W  VDI      P  +SL  ++ 
Sbjct: 60  PGIVGVVEVVRESYPDLTALDPEDHHYDPKSTPDNPRWLMVDIKFRKKFPQVISLQELRQ 119

Query: 105 NPRLSS-MILIVSSRLSVQPVTTDEYLEVCRM 135
           NP+L   +IL   +RLS+ PV+   +  + ++
Sbjct: 120 NPKLKDLLILRKGNRLSITPVSKAHWDAIMKL 151


>gi|93279841|pdb|2G2X|A Chain A, X-Ray Crystal Structure Protein Q88ch6 From Pseudomonas
           Puti Northeast Structural Genomics Consortium Target
           Ppr72.
 gi|93279842|pdb|2G2X|B Chain B, X-Ray Crystal Structure Protein Q88ch6 From Pseudomonas
           Puti Northeast Structural Genomics Consortium Target
           Ppr72.
 gi|93279843|pdb|2G2X|C Chain C, X-Ray Crystal Structure Protein Q88ch6 From Pseudomonas
           Puti Northeast Structural Genomics Consortium Target
           Ppr72
          Length = 157

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 77/150 (51%), Gaps = 19/150 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           AYWL KSEP E S +      R+GEA W GVRNYQARN +R   VGD+ FFYHS+     
Sbjct: 2   AYWLXKSEPDELSIEAL---ARLGEARWDGVRNYQARNFLRAXSVGDEFFFYHSSCPQPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +    YPDPTA                + W  VD+  V + P  + L  +K   
Sbjct: 59  IAGIARITRAAYPDPTALDPESHYHDAKATTDKNPWSAVDVAHVQTFPRVLELGRLKQQA 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 GLVELPLVQKGSRLSVXPVTPEQWAVIVAL 148


>gi|148550313|ref|YP_001270415.1| hypothetical protein Pput_5113 [Pseudomonas putida F1]
 gi|148514371|gb|ABQ81231.1| protein of unknown function DUF55 [Pseudomonas putida F1]
          Length = 149

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E S +      R+GEA W GVRNYQARN +R M VGD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSIEAL---ARLGEARWDGVRNYQARNFLRAMSVGDEFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTA-EQSSCWE------------CVDICAVCSMPCPVSLMAIKAN 105
            I GI ++    YPDPTA +  S +              VD+  V + P  + L  +K  
Sbjct: 58  GIAGIAKITRAAYPDPTALDPESHYHDAKATIDKNPRSAVDVAHVQTFPRVLELGWLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
             L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 AGLVELPLVQKGSRLSVMPVTPEQWAVIVAL 148


>gi|254468075|ref|ZP_05081481.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [beta
           proteobacterium KB13]
 gi|207086885|gb|EDZ64168.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [beta
           proteobacterium KB13]
          Length = 151

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 88/154 (57%), Gaps = 19/154 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEPS++S    +  G +   W G+RNYQARN MR  M++GD  FFYHSN K  
Sbjct: 1   MKYWLMKSEPSDYSIDDLERDGSID--WYGIRNYQARNFMRDDMQIGDLAFFYHSNCKEP 58

Query: 59  EIVGIFEVITCTYP------------DPTAEQSSC-WECVDICAVCSMPCPVSLMAIKAN 105
            IVGI +V    YP            DP ++ ++  W  VD+  V  +P  VSL  ++ +
Sbjct: 59  GIVGIMKVSKLAYPDKLQFIEGHKYHDPKSDPNNPRWVNVDVAFVKKIPL-VSLNELRQH 117

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGKL 138
            +L ++ IL   +RLS+ P+T DE+  + ++  +
Sbjct: 118 QQLETLKILQRGNRLSITPLTEDEWNYINQINTI 151


>gi|119509561|ref|ZP_01628708.1| hypothetical protein N9414_08345 [Nodularia spumigena CCY9414]
 gi|119465750|gb|EAW46640.1| hypothetical protein N9414_08345 [Nodularia spumigena CCY9414]
          Length = 137

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 74/126 (58%), Gaps = 5/126 (3%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           MAYWL+K+EP ++S+  ++QD   V   W GV N  A  ++R M +GD  F YH+ + R+
Sbjct: 1   MAYWLLKTEPEKYSYFNLEQDGSTV---WDGVNNALALKHLRNMLLGDLAFIYHTGQERQ 57

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
           I+GI EV++  Y DPT   +     VD+ A+  +  P+ L  IK N + +   L+   RL
Sbjct: 58  IIGIAEVVSQPYADPTLNDAKR-VVVDVKALRRVSVPLPLSQIKQNGQFTDFDLLRLPRL 116

Query: 120 SVQPVT 125
           SV PV+
Sbjct: 117 SVVPVS 122


>gi|330872728|gb|EGH06877.1| hypothetical protein Pgy4_03377 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 149

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 74/143 (51%), Gaps = 17/143 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E+S    Q +G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKATADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDE 128
           +L  + L+   SRLSV PVT ++
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQ 141


>gi|73667539|ref|YP_303555.1| hypothetical protein Ecaj_0926 [Ehrlichia canis str. Jake]
 gi|72394680|gb|AAZ68957.1| conserved hypothetical protein [Ehrlichia canis str. Jake]
          Length = 135

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 79/138 (57%), Gaps = 7/138 (5%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M+YWL+K+EP ++SW  M  DK  V   W  V NYQA+N ++ M+  D  FFYHS K + 
Sbjct: 1   MSYWLLKTEPKDFSWDNMVHDKVTV---WDNVLNYQAQNYLKAMKYNDLAFFYHSGKEKV 57

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
           I+GI  +    Y     + ++ +  V++     +   VSL  IK+N  L +MI++   RL
Sbjct: 58  IIGIVAIYKEFY---ITDINNKFGVVEVKTNKKLNKTVSLKDIKSNSTLKNMIVLKQPRL 114

Query: 120 SVQPVTTDEYLEVCRMGK 137
           SV P+T  E+  + ++G+
Sbjct: 115 SVSPITEQEWYCILQLGE 132


>gi|219847193|ref|YP_002461626.1| hypothetical protein Cagg_0242 [Chloroflexus aggregans DSM 9485]
 gi|219541452|gb|ACL23190.1| protein of unknown function DUF55 [Chloroflexus aggregans DSM 9485]
          Length = 138

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 75/135 (55%), Gaps = 3/135 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL+K+EPS +S+     +GR    W GV N  A  ++R +R GD    YH+   R+ VG
Sbjct: 4   YWLLKTEPSVYSFADLVREGRT--VWDGVENTVALKHLRAIRQGDVALIYHTGDERQAVG 61

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           + ++++  YPDP  +       VD+  +  +  PV+L AIKA+P  +   L+   RLSV 
Sbjct: 62  LAQIVSDPYPDPK-QHDPRLVVVDVVPLQPLNRPVTLAAIKADPFFADFALVRQGRLSVV 120

Query: 123 PVTTDEYLEVCRMGK 137
           PVT+ ++  +  M +
Sbjct: 121 PVTSAQWERLLVMAE 135


>gi|83643671|ref|YP_432106.1| hypothetical protein HCH_00785 [Hahella chejuensis KCTC 2396]
 gi|83631714|gb|ABC27681.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396]
          Length = 151

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 77/151 (50%), Gaps = 15/151 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MAYWL+K+EP  +S     +       W GVRNYQARN MR  M+VGD+ F YHS+    
Sbjct: 1   MAYWLMKTEPDAFSIDDLANSPDGVSGWDGVRNYQARNFMRDDMKVGDQVFIYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI EV    YPDP++             E++  W CV +  V  +   V L  +K N
Sbjct: 61  GVAGIAEVCREAYPDPSSFDPESPYYDPKSTEENPRWWCVSVRFVRKLNKVVPLAEMKLN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
           P L  M L+  SRLSV PV   E+  +  M 
Sbjct: 121 PALQDMALVKRSRLSVMPVQPHEWETIMAMA 151


>gi|116053376|ref|YP_793701.1| hypothetical protein PA14_69050 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296392087|ref|ZP_06881562.1| hypothetical protein PaerPAb_28207 [Pseudomonas aeruginosa PAb1]
 gi|313110300|ref|ZP_07796192.1| hypothetical protein PA39016_002330013 [Pseudomonas aeruginosa
           39016]
 gi|115588597|gb|ABJ14612.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310882694|gb|EFQ41288.1| hypothetical protein PA39016_002330013 [Pseudomonas aeruginosa
           39016]
          Length = 152

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 80/152 (52%), Gaps = 19/152 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           AYWL+KSEP E S +   D  R+G A W GVRNYQARN +R M  GD  FFYHS+     
Sbjct: 3   AYWLMKSEPDELSIR---DLQRLGTARWDGVRNYQARNFIRSMNPGDLFFFYHSSCPQPG 59

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +    YPDPTA              + + W   D+  V +    V L  +KA  
Sbjct: 60  IAGIARIEGEAYPDPTALDPASPYHDPKASAEKNPWSARDVSFVEAFAEVVPLARLKAQD 119

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
            L+++ L+   SRLSV PV+ +E+  +  + K
Sbjct: 120 ALANLALVQKGSRLSVMPVSAEEWQAILPLAK 151


>gi|332188843|ref|ZP_08390551.1| hypothetical protein SUS17_3962 [Sphingomonas sp. S17]
 gi|332011109|gb|EGI53206.1| hypothetical protein SUS17_3962 [Sphingomonas sp. S17]
          Length = 133

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 70/139 (50%), Gaps = 7/139 (5%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           MAYWL+KSEP  + W    D  R G   W GVRN  A  ++R M+ GD   FYHS K + 
Sbjct: 1   MAYWLLKSEPDSYGW---DDLVRDGATEWDGVRNAAAAKHLRAMQPGDSALFYHSGKDKA 57

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
            VGI  +      D    +   W  V +     +P PV L A+KA  +L+ + ++  SRL
Sbjct: 58  AVGIATITRAAQAD---GEDGRWVSVAVAPDRPLPQPVPLAAMKAEAKLADLPMLRQSRL 114

Query: 120 SVQPVTTDEYLEVCRMGKL 138
           SV PV   E+  +  M  L
Sbjct: 115 SVSPVGDTEWAILMTMAGL 133


>gi|119468284|ref|ZP_01611410.1| hypothetical protein ATW7_15371 [Alteromonadales bacterium TW-7]
 gi|119448277|gb|EAW29541.1| hypothetical protein ATW7_15371 [Alteromonadales bacterium TW-7]
          Length = 152

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 77/152 (50%), Gaps = 15/152 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S    +        W GVRNYQARN +R  ++ GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDAFSIDDLKHAPNQTTLWEGVRNYQARNFLRDDVKEGDLVMIYHSSCKNV 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI ++ +  YPDPT                S  W  VD+     +   VSL +IKAN
Sbjct: 61  GVAGIAKITSAAYPDPTQFDLNSDYYDPKATSDSPRWVVVDVTYHQHLNKLVSLKSIKAN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             ++ + L  + RLSV PVT  ++ E+ +M K
Sbjct: 121 DSITELALKKAGRLSVMPVTEHDWNEIIKMAK 152


>gi|152981413|ref|YP_001352318.1| hypothetical protein mma_0628 [Janthinobacterium sp. Marseille]
 gi|151281490|gb|ABR89900.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 152

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 81/149 (54%), Gaps = 17/149 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M YWL+KSEPSE S        +   AWTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPSEVSIDDAWSAPKRTVAWTGVRNYQARNFMRDAMQLGDGVLFYHSSCAEP 60

Query: 60  -IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ EV +  YPD T              +++  W  VD+  +      +SL  ++  
Sbjct: 61  GIVGLAEVASTAYPDHTQFEPDSHYYDPKATQETPRWVMVDV-RIRKKTRLLSLAEMRTM 119

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVC 133
           P LS M+L+   SRLS+ PVT DE+  +C
Sbjct: 120 PELSGMVLLQRGSRLSITPVTADEWDFIC 148


>gi|78067258|ref|YP_370027.1| hypothetical protein Bcep18194_A5789 [Burkholderia sp. 383]
 gi|77968003|gb|ABB09383.1| protein of unknown function DUF589 [Burkholderia sp. 383]
          Length = 153

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 78/145 (53%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLANAPQRSLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT              +++  W  VD+C V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVCYVKKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEW 144


>gi|320101709|ref|YP_004177300.1| hypothetical protein Isop_0154 [Isosphaera pallida ATCC 43644]
 gi|319748991|gb|ADV60751.1| protein of unknown function DUF55 [Isosphaera pallida ATCC 43644]
          Length = 163

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 81/157 (51%), Gaps = 20/157 (12%)

Query: 1   MAYWLVKSEPSEWSWK--MQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKG 57
           MAYWL KSEPS +S+   M     R G  W GVRN+QARN +R +++VGD   FYHSN  
Sbjct: 1   MAYWLFKSEPSVFSFADLMAAPDRRTG--WDGVRNHQARNFLRDQIQVGDGILFYHSNAD 58

Query: 58  -REIVGIFEVITCTYPDPTAEQSS-------------CWECVDICAVCSMPCPVSLMAIK 103
              IVG+  V    +PDPTA                  W  V+I  + ++  P+ L  ++
Sbjct: 59  PPAIVGVARVTRAGHPDPTAFNPDDPHFDPKSDPARPTWYQVEIEGIVAIAPPLELPRLR 118

Query: 104 ANPRLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGKLS 139
              RL  M +L   SRLSVQPV+ + +  +  +  L 
Sbjct: 119 KETRLEGMELLRKGSRLSVQPVSPEHFEVIMNLAGLD 155


>gi|326796260|ref|YP_004314080.1| hypothetical protein Marme_3023 [Marinomonas mediterranea MMB-1]
 gi|326547024|gb|ADZ92244.1| Uncharacterized protein family UPF0310 [Marinomonas mediterranea
           MMB-1]
          Length = 150

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 80/146 (54%), Gaps = 18/146 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M YWL+KSEP  +S  +   K      W GVRNYQARN M++M++GD  FFYHS+ K   
Sbjct: 1   MNYWLMKSEPDAFS--IDDLKNLKTSPWDGVRNYQARNFMKEMKMGDTVFFYHSSCKVPA 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+  V    YPD T+   +              W  VDI  +  +P P++L  +K +P
Sbjct: 59  IVGLASVNKEAYPDNTSWDETSPYFDLKSTPDNPRWFMVDIEFISKLPTPLTLKDMKNDP 118

Query: 107 RLSSMILIVS-SRLSVQPVTTDEYLE 131
            LS   L+   SRLS+ P+ +DE+ +
Sbjct: 119 VLSGFKLLQKGSRLSIIPL-SDEHAQ 143


>gi|254243889|ref|ZP_04937211.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|126197267|gb|EAZ61330.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
          Length = 152

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 79/152 (51%), Gaps = 19/152 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           AYWL+KSEP E S +   D  R+G A W GVRNYQARN +R M  GD  FFYHS+     
Sbjct: 3   AYWLMKSEPDELSIR---DLQRLGTARWDGVRNYQARNFIRSMNSGDLFFFYHSSCPQPG 59

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +    YPDPTA   +              W   D+  V +    V L  +KA  
Sbjct: 60  IAGIARIEGEAYPDPTALDPASPYHDPKASAGKNPWSARDVSFVEAFAEVVPLARLKAQD 119

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
            L+++ L+   SRLSV PV+ +E+  +  + K
Sbjct: 120 ALANLALVQKGSRLSVMPVSAEEWQAILPLAK 151


>gi|118575282|ref|YP_875025.1| hypothetical protein CENSYa_0076 [Cenarchaeum symbiosum A]
 gi|118193803|gb|ABK76721.1| conserved hypothetical protein [Cenarchaeum symbiosum A]
          Length = 148

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 76/145 (52%), Gaps = 8/145 (5%)

Query: 1   MAYWLVKSEPSE---WSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK 56
           MAYWLVK EP     +S  +MQ+DK  V   W GVRN  A  ++R M+ GD   +YH+  
Sbjct: 5   MAYWLVKQEPGGPRGYSLDQMQKDKKTV---WDGVRNNLALKHIRNMKKGDLAMYYHTGT 61

Query: 57  GREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVS 116
            R+ VGI EV T  YPDP AE    +  VD+     +  PV+L  +K         L+  
Sbjct: 62  ERQAVGIIEVTTAPYPDPGAENER-FVVVDVKFKSRLKRPVTLDEMKGEKAFKDWELVRI 120

Query: 117 SRLSVQPVTTDEYLEVCRMGKLSNP 141
           SRLSV PV    +  +  + +LS P
Sbjct: 121 SRLSVMPVPKGIWDRIMTLSRLSPP 145


>gi|160872258|ref|ZP_02062390.1| thymocyte nuclear protein 1 (Thymocyte protein Thy28) (mThy28)
           [Rickettsiella grylli]
 gi|159121057|gb|EDP46395.1| thymocyte nuclear protein 1 (Thymocyte protein Thy28) (mThy28)
           [Rickettsiella grylli]
          Length = 166

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 81/143 (56%), Gaps = 14/143 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           M YWL+KSEP+ +S      + +  E W GVRNYQARN ++ M+ GD  FFYHS+  +  
Sbjct: 1   MNYWLMKSEPTCFSIYDLAKRPQQREPWDGVRNYQARNFLKAMKKGDLAFFYHSSCPQPG 60

Query: 60  IVGIFEVITCTYPDPTA----EQSSC--------WECVDICAVCSMPCPVSLMAIKANPR 107
           IVGI +++   YPD TA    + S          W  VD+  V      ++L +++  P+
Sbjct: 61  IVGIIKIVKTAYPDKTAAFPLDHSHHPKNTTKPRWYAVDVQLVRIFKSIITLESLRKEPQ 120

Query: 108 LSSMILIVS-SRLSVQPVTTDEY 129
           L +M L+   +RLSV P+TT E+
Sbjct: 121 LKTMRLLQKGNRLSVMPLTTLEW 143


>gi|256830966|ref|YP_003159694.1| hypothetical protein Dbac_3203 [Desulfomicrobium baculatum DSM
           4028]
 gi|256580142|gb|ACU91278.1| protein of unknown function DUF55 [Desulfomicrobium baculatum DSM
           4028]
          Length = 153

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 76/152 (50%), Gaps = 15/152 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M YWL+K+EP  +S            +W GVRN+QARN MR  M VGD   FYHS K   
Sbjct: 1   MKYWLMKTEPGCFSIDDLAAAPNQTSSWDGVRNFQARNFMRDDMSVGDLILFYHSVKNPG 60

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           +VGI  V   +YPD TA              +   W  VD+  V   P PV L +++   
Sbjct: 61  VVGIARVARESYPDHTAWNPADRHFDPRSTPEKPLWFMVDVQFVEKFPHPVPLASLRGVK 120

Query: 107 RLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGK 137
            L  M +L   SRLSV PVT +E+  V R+ +
Sbjct: 121 GLEMMELLKKGSRLSVTPVTDEEFKIVTRLAR 152


>gi|71735027|ref|YP_272604.1| hypothetical protein PSPPH_0300 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555580|gb|AAZ34791.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 149

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP E+S    Q +G     W GV NYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVHNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKATADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|15600422|ref|NP_253916.1| hypothetical protein PA5229 [Pseudomonas aeruginosa PAO1]
 gi|254238074|ref|ZP_04931397.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|9951537|gb|AAG08614.1|AE004935_11 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126170005|gb|EAZ55516.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 152

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 60/152 (39%), Positives = 79/152 (51%), Gaps = 19/152 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           AYWL+KSEP E S +   D  R+G A W GVRNYQARN +R M  GD  FFYHS+     
Sbjct: 3   AYWLMKSEPDELSIR---DLQRLGTARWDGVRNYQARNFIRSMNPGDLFFFYHSSCPQPG 59

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +    YPDPTA   +              W   D+  V +    V L  +KA  
Sbjct: 60  IAGIARIEGEAYPDPTALDPASPYHDPKASAGKNPWSARDVSFVEAFAEVVPLARLKAQD 119

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
            L+++ L+   SRLSV PV+ +E+  +  + K
Sbjct: 120 ALANLALVQKGSRLSVMPVSAEEWQAILPLAK 151


>gi|18397592|ref|NP_565364.1| unknown protein [Arabidopsis thaliana]
 gi|3810594|gb|AAC69376.1| expressed protein [Arabidopsis thaliana]
 gi|149944293|gb|ABR46189.1| At2g14660 [Arabidopsis thaliana]
 gi|330251223|gb|AEC06317.1| uncharacterized protein [Arabidopsis thaliana]
          Length = 158

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 76/137 (55%), Gaps = 5/137 (3%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+K+EP+EWSW  Q+  G + + W GV+N QA+ N++ M +GD  FFYHS  K R +V
Sbjct: 7   YWLLKTEPNEWSWSDQESNGGISK-WDGVKNKQAQKNLKSMTLGDLCFFYHSGTKSRCVV 65

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRL--SSMILIVSSRL 119
           G+ EV    Y D  AE       VD+ A+  M   V L  +K +  +     +L    RL
Sbjct: 66  GVVEVSREWYTDD-AEGVEGEGAVDVKAIGEMRKCVDLKEMKGDKGIITKGFVLFRQPRL 124

Query: 120 SVQPVTTDEYLEVCRMG 136
           SV PV  D +  +C +G
Sbjct: 125 SVVPVEEDVWNMICELG 141


>gi|148554238|ref|YP_001261820.1| hypothetical protein Swit_1317 [Sphingomonas wittichii RW1]
 gi|148499428|gb|ABQ67682.1| protein of unknown function DUF55 [Sphingomonas wittichii RW1]
          Length = 148

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 82/135 (60%), Gaps = 3/135 (2%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           ++WLVKSEP+ +S+   +  GR    W GVRN  A  +++ M+ GD+  FYHS +G  +V
Sbjct: 16  SHWLVKSEPNSYSYADLERDGRT--VWDGVRNNAAALHLKAMKEGDEVLFYHSQEGLAVV 73

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           G+  V+   +PD T + +  +  V++  + ++  PV+L A+KA P L+ M ++  SRLSV
Sbjct: 74  GVARVVRTAFPDAT-DPAGRFVAVELAPIRALAKPVTLAAMKAEPALAGMAMLRQSRLSV 132

Query: 122 QPVTTDEYLEVCRMG 136
            PV+  E+  + +M 
Sbjct: 133 SPVSDAEWDVILKMA 147


>gi|77359112|ref|YP_338687.1| hypothetical protein PSHAa0140 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874023|emb|CAI85244.1| conserved protein of unknown function [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 153

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 76/152 (50%), Gaps = 15/152 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S    ++       W GVRNYQARN MR +++VGD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDAFSIDDLKNAQNQTTLWEGVRNYQARNFMRDEVKVGDLVMIYHSSCKLV 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            +VGI  V    Y DPT    S              W  V++     +   VSL  IKAN
Sbjct: 61  GVVGIAVVTKAAYQDPTQFDLSSDYYDAKATSDNPRWVVVEVTYQSHLDSLVSLKEIKAN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           PR++ + L    RLS+ PVT  ++  +  M +
Sbjct: 121 PRITDIALKKGGRLSIMPVTKSDWQIITHMAE 152


>gi|83754987|pdb|2EVE|A Chain A, X-Ray Crystal Structure Of Protein Pspto5229 From
           Pseudomona Syringae. Northeast Structural Genomics
           Consortium Target P
          Length = 157

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 79/150 (52%), Gaps = 19/150 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           AYWL KSEP E+S     D  R+G+A W GVRNYQARN +R    GD+ FFYHS+     
Sbjct: 2   AYWLXKSEPDEFSIS---DLQRLGKARWDGVRNYQARNFLRTXAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +++   YPDPTA              + + W  +DI  V      + L  +K   
Sbjct: 59  IAGIGKIVKTAYPDPTALDPDSHYHDAKATTEKNPWSALDIGFVDIFKNVLGLGYLKQQS 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVXPVTAEQWAAILAL 148


>gi|296121294|ref|YP_003629072.1| hypothetical protein Plim_1030 [Planctomyces limnophilus DSM 3776]
 gi|296013634|gb|ADG66873.1| protein of unknown function DUF55 [Planctomyces limnophilus DSM
           3776]
          Length = 160

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 78/150 (52%), Gaps = 16/150 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHS-NKGREI 60
           YWL KSEPS +S        +    W GVRNYQARN +R  ++ GD  FFYHS  +   I
Sbjct: 7   YWLFKSEPSAFSIDDLAASPKQTALWDGVRNYQARNFLRDDVQTGDLVFFYHSREEPLGI 66

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
           VG  +V+   YPDPT    +              W  VD+  +   P  V+   + A+P+
Sbjct: 67  VGTMKVVRAGYPDPTQFNPASKYYDAKSPPDAPRWIGVDVQLMQKFPAVVTRDQLAAHPK 126

Query: 108 LSSMILIVSS-RLSVQPVTTDEYLEVCRMG 136
            +SM+++    RLS+QPVT  E+L V ++ 
Sbjct: 127 TASMLVMKRGMRLSIQPVTRSEWLHVHQLA 156


>gi|289674535|ref|ZP_06495425.1| hypothetical protein PsyrpsF_14822 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 149

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 80/151 (52%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP E+S     D  R+G A W GVRNYQARN +R M  GD  FFYHS+    
Sbjct: 1   MAYWLMKSEPDEFSIS---DLQRLGSARWDGVRNYQARNFLRAMAEGDAFFFYHSSCPEP 57

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI ++     PDPTA             E+ + W  +D+  V +    + L  +K  
Sbjct: 58  GIAGIGKIARSACPDPTALDPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQ 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            +L  + L+   SRLSV PVT +++  +  +
Sbjct: 118 SQLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|226355330|ref|YP_002785070.1| hypothetical protein Deide_04810 [Deinococcus deserti VCD115]
 gi|226317320|gb|ACO45316.1| Conserved hypothetical protein [Deinococcus deserti VCD115]
          Length = 161

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 77/154 (50%), Gaps = 17/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M +WL+KSEP  + +     +GR  E W GVRNYQARN +R MR GD   FYHSN +   
Sbjct: 1   MRFWLIKSEPDVFGFAELMRRGR--EPWNGVRNYQARNFLRDMREGDLCLFYHSNARPPG 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           + G+  V    YPD     S               W  VD+  + + P  V+L A++  P
Sbjct: 59  VAGVARVCRAAYPDDLQFDSGSSYFDPKSDPAQPRWSMVDVEPLVAFPALVTLEALRRLP 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLS 139
             +   L    SRLSV PVT++++ +V     LS
Sbjct: 119 DWADSPLTRKGSRLSVLPVTSEQFWDVLDAAGLS 152


>gi|152996918|ref|YP_001341753.1| hypothetical protein Mmwyl1_2907 [Marinomonas sp. MWYL1]
 gi|150837842|gb|ABR71818.1| protein of unknown function DUF55 [Marinomonas sp. MWYL1]
          Length = 152

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 80/151 (52%), Gaps = 19/151 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREI 60
           YWL+KSEP  +S     D  R+  + W GVRNYQARN M++M  GD  FFYHS+     I
Sbjct: 4   YWLMKSEPDAFS---IDDLKRLKHSPWDGVRNYQARNFMKEMNEGDLVFFYHSSCSPAGI 60

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ +V    YPD T+  +S              W  VD+  V   P  ++L  +K NP 
Sbjct: 61  VGVAKVCKSAYPDHTSWDASSPYFDAKSTPENPRWYMVDVEFVEKWPSILTLAELKQNPE 120

Query: 108 LSSMILIVS-SRLSVQPVTTDEYLEVCRMGK 137
           L+ M+L    SRLSV P+T  E+  +  + K
Sbjct: 121 LTEMLLTKKGSRLSVMPITQSEWEYISTILK 151


>gi|120556052|ref|YP_960403.1| hypothetical protein Maqu_3142 [Marinobacter aquaeolei VT8]
 gi|120325901|gb|ABM20216.1| protein of unknown function DUF55 [Marinobacter aquaeolei VT8]
          Length = 152

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 83/153 (54%), Gaps = 21/153 (13%)

Query: 1   MAYWLVKSEPSEWSWK--MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KG 57
           MA WLVK+EPSE       +Q +G +   W GVRNYQARN + +M+ GD  F YHS+ K 
Sbjct: 1   MAKWLVKTEPSECGIDDFARQPEGVI--PWDGVRNYQARNFLAQMQEGDLVFIYHSSCKR 58

Query: 58  REIVGIFEVITCTYPDP--------------TAEQSSCWECVDICAVCSMPCPVSLMAIK 103
             I GI  V+   YPDP              TAE+   W+ VD+     +P  + L ++K
Sbjct: 59  IGIAGIVRVVKSAYPDPSQFNPESPYYDPKSTAEKPR-WQAVDLQFERKLPALIPLDSLK 117

Query: 104 ANPRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           A P LS + L+   SRLSV PV+  E+ ++  +
Sbjct: 118 AMPELSELALVRRGSRLSVMPVSDAEWQQILHL 150


>gi|307825867|ref|ZP_07656083.1| protein of unknown function DUF55 [Methylobacter tundripaludum
           SV96]
 gi|307733175|gb|EFO04036.1| protein of unknown function DUF55 [Methylobacter tundripaludum
           SV96]
          Length = 163

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 78/145 (53%), Gaps = 16/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP  +      +K    E W GVRNYQARN MR  M++GD+ FFYHSN +  
Sbjct: 12  MNYWLMKSEPDTFGINDLYNKPNQTEHWDGVRNYQARNMMRDDMKLGDRVFFYHSNCEMP 71

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI E++   YPD +A              +   W  VD+  V ++   ++L  +K  
Sbjct: 72  GIVGIMEIVKEGYPDFSAFDPDDKHFDPKSDHEHPRWMMVDVKYVRTLSRTITLKELKHQ 131

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEY 129
             L+ + L+   +RLS+ PV+  E+
Sbjct: 132 EELAGLALVRRGNRLSIMPVSKGEW 156


>gi|255020904|ref|ZP_05292960.1| hypothetical protein ACA_1126 [Acidithiobacillus caldus ATCC 51756]
 gi|254969695|gb|EET27201.1| hypothetical protein ACA_1126 [Acidithiobacillus caldus ATCC 51756]
          Length = 152

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 79/148 (53%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           MA+WL+K+EP  +S  +   K R  E W G+RNYQARN +R+MRVGD+ F YHS      
Sbjct: 1   MAHWLLKTEPEAFS--LDDLKARGQEPWDGIRNYQARNFLRQMRVGDEVFIYHSRVPVPG 58

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI  ++T  +PDPT             +     W+ VDI  +      VSL +++  P
Sbjct: 59  IVGIARIVTEAHPDPTQFDPQSPYYDAGSSPADPRWDLVDIAYLAHCVPAVSLESLREMP 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVC 133
             +   L+   +RLS+ P++  ++  V 
Sbjct: 119 EFADNPLVRKGNRLSIVPISESQWQAVL 146


>gi|296162285|ref|ZP_06845079.1| protein of unknown function DUF55 [Burkholderia sp. Ch1-1]
 gi|295887439|gb|EFG67263.1| protein of unknown function DUF55 [Burkholderia sp. Ch1-1]
          Length = 152

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR +M+VGD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANAPHRTLPWTGVRNYQARNFMRDQMQVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT             +++S  W  VD+     +P  + L A++ +
Sbjct: 61  GIAGIAEVSSTAYPDPTQFDRKSPYYDAKSSQESPRWVLVDVVFRKKIPL-IPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L  M +L   +RLS+ PVT  E+  + +
Sbjct: 120 DELKDMRVLAKGNRLSITPVTEAEWRFITK 149


>gi|241663798|ref|YP_002982158.1| hypothetical protein Rpic12D_2212 [Ralstonia pickettii 12D]
 gi|240865825|gb|ACS63486.1| protein of unknown function DUF55 [Ralstonia pickettii 12D]
          Length = 178

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 82/148 (55%), Gaps = 29/148 (19%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+KSEP E S     DKG +   WTGVRNYQARN MR +MR+GD   FYHS+  +  I
Sbjct: 27  YWLMKSEPDEASIDTLHDKGTL--PWTGVRNYQARNFMRDRMRIGDGVLFYHSSCPQPGI 84

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDI-----CAVCSMPCPVSLMAI 102
            G+ EV + +YPDPT               ++  W  VD+     CA+  +P       +
Sbjct: 85  AGLAEVCSTSYPDPTQFDAKSHYHDPASKPEAPRWMLVDVKFVRKCALIDLP------TL 138

Query: 103 KANPRLSSM-ILIVSSRLSVQPVTTDEY 129
           +A+ +L+ M +L   +RLS+ PVT  ++
Sbjct: 139 RAHEQLADMTVLQRGNRLSITPVTAAQW 166


>gi|320335645|ref|YP_004172356.1| hypothetical protein Deima_3062 [Deinococcus maricopensis DSM
           21211]
 gi|319756934|gb|ADV68691.1| Uncharacterized protein family UPF0310 [Deinococcus maricopensis
           DSM 21211]
          Length = 159

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 72/143 (50%), Gaps = 19/143 (13%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-REI 60
           YWL+KSEP  + +    D  RVG E W GVRNYQARN +R M VGD   FYHSN     +
Sbjct: 6   YWLLKSEPDVFGYA---DLERVGVEPWNGVRNYQARNFLRAMEVGDLALFYHSNATPAGV 62

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
            G+  V+   YPD     S               W  VD+  V + P  +SL  ++A P 
Sbjct: 63  AGVARVVRAAYPDDLQFDSGSAYFDARSSALEPRWSMVDVAPVQAFPRVLSLAEVRALPA 122

Query: 108 LSSMILIV-SSRLSVQPVTTDEY 129
            +   L+   +RLSV PVT  ++
Sbjct: 123 WAESPLVQRGTRLSVLPVTALQF 145


>gi|21592505|gb|AAM64455.1| unknown [Arabidopsis thaliana]
          Length = 158

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 77/139 (55%), Gaps = 9/139 (6%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+K+EPSEWS   Q+  G + + W GV+N QA+ N++ M +GD  FFYHS  K R +V
Sbjct: 7   YWLLKTEPSEWSLSDQESNGGISK-WDGVKNKQAQKNLKSMTLGDLCFFYHSGTKARSVV 65

Query: 62  GIFEVIT--CTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSS--MILIVSS 117
           G+ EV     T  D   E       VD+ A+  M   V L  +K +  +S+   +L    
Sbjct: 66  GLVEVSREWYTGDDEGVEGEG---AVDVKAIGEMRKCVDLKEMKGDKGISTKGFVLFRQP 122

Query: 118 RLSVQPVTTDEYLEVCRMG 136
           RLSV PV  D + ++C +G
Sbjct: 123 RLSVVPVEEDVWNKICELG 141


>gi|187922993|ref|YP_001894635.1| hypothetical protein Bphyt_0992 [Burkholderia phytofirmans PsJN]
 gi|187714187|gb|ACD15411.1| protein of unknown function DUF55 [Burkholderia phytofirmans PsJN]
          Length = 152

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M+VGD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANAPHRTLPWTGVRNYQARNFMRDMMQVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT             ++++  W  VD+     +P  + L A++ +
Sbjct: 61  GIAGIAEVSSTAYPDPTQFDKKSPYYDAKSSQETPRWVLVDVVFKKKIPL-IPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  + +
Sbjct: 120 DELADMRVLAKGNRLSITPVTEAEWRFITK 149


>gi|297601459|ref|NP_001050888.2| Os03g0676100 [Oryza sativa Japonica Group]
 gi|108710370|gb|ABF98165.1| expressed protein [Oryza sativa Japonica Group]
 gi|125545232|gb|EAY91371.1| hypothetical protein OsI_12991 [Oryza sativa Indica Group]
 gi|255674778|dbj|BAF12802.2| Os03g0676100 [Oryza sativa Japonica Group]
          Length = 175

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 70/146 (47%), Gaps = 14/146 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKG---R 58
           YWL+K+EP EWSW  Q      G A W GVRN QA N +R MRVGD+  FYHS  G   R
Sbjct: 19  YWLLKTEPGEWSWSDQARAPGGGVAPWDGVRNRQAVNGLRAMRVGDRCLFYHSGAGAASR 78

Query: 59  EIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIK--------ANPRLSS 110
            +VG+ EV    Y       S     VD+ AV     PV+L  IK            +  
Sbjct: 79  RVVGVVEVAREWYEGEGEAASGG--AVDVRAVGEFRRPVALGEIKKAAGGGGGEVEGMRE 136

Query: 111 MILIVSSRLSVQPVTTDEYLEVCRMG 136
             L+   RLSV PV    +  +C MG
Sbjct: 137 FALLRQPRLSVMPVPAKVWDWICEMG 162


>gi|198283960|ref|YP_002220281.1| hypothetical protein Lferr_1853 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218665804|ref|YP_002426595.1| hypothetical protein AFE_2196 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|198248481|gb|ACH84074.1| protein of unknown function DUF55 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518017|gb|ACK78603.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 150

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 78/151 (51%), Gaps = 17/151 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+K+EP  +S +  Q +G+  E W G+RNYQARN +R M+ GD+ F YHS      
Sbjct: 1   MAYWLMKTEPDAFSLQDLQRRGQ--EPWDGIRNYQARNFLRSMQTGDEVFIYHSRVPAPG 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG  EV+   YPDPT                   W+ V++    +    ++L  ++  P
Sbjct: 59  IVGTAEVVCAAYPDPTQFDPQSKYYDPASHPDRPRWDLVEVAYRRTFAQGIALDTLRTIP 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRMG 136
             S   LI   +RLS+ P+T+ ++  + +  
Sbjct: 119 EFSDSPLIRKGNRLSILPITSSQWQYILQYA 149


>gi|110834336|ref|YP_693195.1| hypothetical protein ABO_1475 [Alcanivorax borkumensis SK2]
 gi|110647447|emb|CAL16923.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 159

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 75/150 (50%), Gaps = 15/150 (10%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREIV 61
           WL+K+EP  +S    +D       W GVRNYQARN +R +M+ GD    YHS+     IV
Sbjct: 5   WLLKTEPDAFSIDDLRDSKNATSGWDGVRNYQARNRLRDEMKAGDTVLIYHSSCAVPAIV 64

Query: 62  GIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G   V +  YPDPT              +    W   D+  VC  P P++L  I+ +P  
Sbjct: 65  GEAVVTSDPYPDPTQFDPASDGYDARSRQDHPRWYQADVQYVCHYPHPLTLKQIQHHPEF 124

Query: 109 SSMILIVSSRLSVQPVTTDEYLEVCRMGKL 138
           + M L+V  RLSVQ V+  +   + +M +L
Sbjct: 125 ADMELVVRPRLSVQKVSERQLQLIRQMCQL 154


>gi|295675794|ref|YP_003604318.1| protein of unknown function DUF55 [Burkholderia sp. CCGE1002]
 gi|295435637|gb|ADG14807.1| protein of unknown function DUF55 [Burkholderia sp. CCGE1002]
          Length = 152

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M+VGD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLANAPHRTLPWTGVRNYQARNFMRDVMQVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT             + ++  W  VD+     +P  +SL A++ +
Sbjct: 61  GIAGIAEVSSTAYPDPTQFDKKSPYYDAKSSPETPRWMLVDVVFKKKIPL-ISLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L +M +L   +RLS+ PVT  E+  + +
Sbjct: 120 AELQNMRVLAKGNRLSITPVTDAEWRFITK 149


>gi|149376027|ref|ZP_01893793.1| hypothetical protein MDG893_03575 [Marinobacter algicola DG893]
 gi|149359664|gb|EDM48122.1| hypothetical protein MDG893_03575 [Marinobacter algicola DG893]
          Length = 151

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 76/144 (52%), Gaps = 15/144 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MA WLVK+EPSE S    ++       W GVRNYQARN +++M  GD  F YHS+ K   
Sbjct: 1   MAKWLVKTEPSECSIDDFENAQVQTIPWDGVRNYQARNFLQEMAEGDDVFVYHSSCKHIG 60

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           + GI  V+T  YPDPT  ++               W+ VD+     +P  + L  IK+ P
Sbjct: 61  VAGIVRVVTSAYPDPTQFRADSPYYDPKSTPEKPRWQAVDMAFEKKLPRLIPLDEIKSLP 120

Query: 107 RLSSMILI-VSSRLSVQPVTTDEY 129
            L  + LI   +RLSV PVT  ++
Sbjct: 121 GLEGLALIRRGNRLSVMPVTEQQW 144


>gi|189351224|ref|YP_001946852.1| hypothetical protein BMULJ_02422 [Burkholderia multivorans ATCC
           17616]
 gi|221211534|ref|ZP_03584513.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|189335246|dbj|BAG44316.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|221168895|gb|EEE01363.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 153

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 77/145 (53%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLAHAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT             + +S  W  VD+  V   P  VSL A++ +
Sbjct: 61  GIAGLAEVASTPYPDPTQFDPKSPYYDPKSSPESPRWLLVDVRFVKKTPL-VSLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEW 144


>gi|168704182|ref|ZP_02736459.1| hypothetical protein GobsU_31899 [Gemmata obscuriglobus UQM 2246]
          Length = 135

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/124 (38%), Positives = 70/124 (56%), Gaps = 3/124 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL K EP  +S+   Q  G+    WTGV N  A+ ++R ++ GD  FFY + K + +
Sbjct: 1   MARWLFKEEPETYSFADLQRDGQA--TWTGVSNALAQKHLRAVKKGDLVFFYATGKIKAV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EVI    PDPT +   C   V +  + ++  PV L  +KA+P  +S  L+  +RLS
Sbjct: 59  VGVVEVIGDPSPDPTDDTGKC-VAVTVKPLRALAKPVLLATVKADPAFASWELVKQARLS 117

Query: 121 VQPV 124
           V PV
Sbjct: 118 VMPV 121


>gi|167569167|ref|ZP_02362041.1| hypothetical protein BoklC_04940 [Burkholderia oklahomensis C6786]
          Length = 153

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 76/145 (52%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAASDHTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT              +++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVCSTPYPDPTQFDPQSPYHDPKSTQETPRWVLVDVRFVRKTPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT DE+
Sbjct: 120 DALADMRVLAKGNRLSITPVTPDEW 144


>gi|94986125|ref|YP_605489.1| hypothetical protein Dgeo_2026 [Deinococcus geothermalis DSM 11300]
 gi|94556406|gb|ABF46320.1| protein of unknown function DUF589 [Deinococcus geothermalis DSM
           11300]
          Length = 189

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 76/143 (53%), Gaps = 19/143 (13%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREI 60
           +WL+KSEP  + +    D  R+G E W GVRNYQARN +R+MR GD   FYHSN K   +
Sbjct: 16  FWLLKSEPHVFGYP---DLVRLGREPWNGVRNYQARNFLREMRAGDLCLFYHSNAKPAGV 72

Query: 61  VGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            G+ +V+   YPD              +  ++  W  VD+  V + P  + L  ++A P 
Sbjct: 73  AGVAQVVREAYPDNLQFDPESPYYDPKSTPENPRWSMVDVAPVLAFPAVLPLDTLRALPE 132

Query: 108 LSSMILI-VSSRLSVQPVTTDEY 129
                LI   +RLSV PVT +++
Sbjct: 133 WQDSPLIRKGNRLSVLPVTEEQF 155


>gi|170692013|ref|ZP_02883177.1| protein of unknown function DUF55 [Burkholderia graminis C4D1M]
 gi|170143297|gb|EDT11461.1| protein of unknown function DUF55 [Burkholderia graminis C4D1M]
          Length = 152

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 76/145 (52%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANAAHRTLPWTGVRNYQARNFMRDGMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT             ++++  W  VD+     +P  + L A++ +
Sbjct: 61  GIAGLAEVASTAYPDPTQFDSKSPYYDPKSSQETPRWLLVDVVFKKKIPL-IPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L  M +L   +RLS+ PVT  E+
Sbjct: 120 EELKDMRVLARGNRLSITPVTEAEW 144


>gi|167561915|ref|ZP_02354831.1| hypothetical protein BoklE_05080 [Burkholderia oklahomensis EO147]
          Length = 153

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 76/145 (52%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASINDLAAASDHTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT              +++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVCSTPYPDPTQFDPQSPYHDPKSTQETPRWVLVDVRFVRKTPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT DE+
Sbjct: 120 DALADMRVLAKGNRLSITPVTPDEW 144


>gi|317969025|ref|ZP_07970415.1| hypothetical protein SCB02_05778 [Synechococcus sp. CB0205]
          Length = 152

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 75/139 (53%), Gaps = 17/139 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP  +  +  Q +G     W G+RNYQARN MR M +GD+ FFYHSN K   
Sbjct: 1   MAYWLMKSEPDVYGIQHLQREGTT--LWDGIRNYQARNFMRSMSIGDRAFFYHSNAKPPG 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ EVI     DP+   S               W+CV +  V +    +SL A++   
Sbjct: 59  IVGMMEVIETGITDPSQFDSENKYFDPKSKPEAPRWDCVRLKYVGTFGAMLSLDALREQF 118

Query: 107 RLSSMILIVS-SRLSVQPV 124
            +  + ++ + +RLS+ PV
Sbjct: 119 SVEELPVVRNGNRLSILPV 137


>gi|325522892|gb|EGD01350.1| hypothetical protein B1M_27014 [Burkholderia sp. TJI49]
          Length = 153

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 77/145 (53%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLASAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT             +++S  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPESPYYDPKSSQESPRWLLVDVRFVKKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEW 144


>gi|254251674|ref|ZP_04944992.1| hypothetical protein BDAG_00866 [Burkholderia dolosa AUO158]
 gi|124894283|gb|EAY68163.1| hypothetical protein BDAG_00866 [Burkholderia dolosa AUO158]
          Length = 153

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 77/145 (53%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLANAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT              +++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVASTPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVRFVKKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEW 144


>gi|256823686|ref|YP_003147649.1| hypothetical protein Kkor_2472 [Kangiella koreensis DSM 16069]
 gi|256797225|gb|ACV27881.1| protein of unknown function DUF55 [Kangiella koreensis DSM 16069]
          Length = 154

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 77/145 (53%), Gaps = 16/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP  +  +  +   +  + W GVRNYQARN MR +M+ GDK FFYHSN K  
Sbjct: 1   MNYWLMKSEPDVFGIEHLKALPKKTDHWDGVRNYQARNMMRDEMKKGDKVFFYHSNCKPP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+   Y D TA               +  W  VD+  V  +   + L  +K  
Sbjct: 61  AIVGIMEVVKEGYVDHTAFDPDQKYYDPKSNPDNPRWYMVDVKHVRDLKREIPLDELKQY 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEY 129
             L+ M L+   +RLS+ PVT +E+
Sbjct: 121 TELADMKLVQKGNRLSIMPVTKEEW 145


>gi|124026533|ref|YP_001015648.1| hypothetical protein NATL1_18281 [Prochlorococcus marinus str.
           NATL1A]
 gi|123961601|gb|ABM76384.1| Uncharacterized conserved protein [Prochlorococcus marinus str.
           NATL1A]
          Length = 157

 Score = 87.4 bits (215), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 72/148 (48%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           + YWL+KSEP  +S K  + +      W G+RNYQARN MR M +GD+ FFYHSN K   
Sbjct: 6   INYWLMKSEPDAYSIKDLEKEEET--LWDGIRNYQARNFMRSMEIGDQAFFYHSNTKPPG 63

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ E+I     DP     S              W+CV    +C     ++L  +    
Sbjct: 64  IVGLMEIIEKNLIDPFQFDESSKYFDKKSKRDNPRWDCVKTKYICEFKSMITLKELSETY 123

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVC 133
               + L+   +RLS+ P+  D  LE+ 
Sbjct: 124 TSEELTLVRKGNRLSIMPINKDIALELL 151


>gi|107023396|ref|YP_621723.1| hypothetical protein Bcen_1847 [Burkholderia cenocepacia AU 1054]
 gi|116690478|ref|YP_836101.1| hypothetical protein Bcen2424_2458 [Burkholderia cenocepacia
           HI2424]
 gi|170733799|ref|YP_001765746.1| hypothetical protein Bcenmc03_2463 [Burkholderia cenocepacia MC0-3]
 gi|206561006|ref|YP_002231771.1| hypothetical protein BCAL2668 [Burkholderia cenocepacia J2315]
 gi|254247480|ref|ZP_04940801.1| hypothetical protein BCPG_02278 [Burkholderia cenocepacia PC184]
 gi|105893585|gb|ABF76750.1| protein of unknown function DUF589 [Burkholderia cenocepacia AU
           1054]
 gi|116648567|gb|ABK09208.1| protein of unknown function DUF55 [Burkholderia cenocepacia HI2424]
 gi|124872256|gb|EAY63972.1| hypothetical protein BCPG_02278 [Burkholderia cenocepacia PC184]
 gi|169817041|gb|ACA91624.1| protein of unknown function DUF55 [Burkholderia cenocepacia MC0-3]
 gi|198037048|emb|CAR52969.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 153

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 77/145 (53%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLANAPQRSLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT              +++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVRFVKKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEW 144


>gi|254428848|ref|ZP_05042555.1| conserved hypothetical protein [Alcanivorax sp. DG881]
 gi|196195017|gb|EDX89976.1| conserved hypothetical protein [Alcanivorax sp. DG881]
          Length = 159

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 74/149 (49%), Gaps = 15/149 (10%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREIV 61
           WL+K+EP  +S    ++       W GVRNYQARN +R +M+ GD    YHS+     IV
Sbjct: 5   WLLKTEPDAFSIDDLRNCKNATSGWDGVRNYQARNRLRDEMKAGDTVLIYHSSCAVPAIV 64

Query: 62  GIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRL 108
           G   V +  YPDPT    +              W   DI   C  P P++L  IK +P  
Sbjct: 65  GEARVTSDPYPDPTQFDPAADGYDPRSTREMPRWYQADIQFACHYPQPLTLKQIKHHPEF 124

Query: 109 SSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           + M L+V  RLSVQ V+  +   + +MG+
Sbjct: 125 ADMELVVRPRLSVQKVSERQLQLIRQMGQ 153


>gi|299065998|emb|CBJ37179.1| conserved protein of unknown function [Ralstonia solanacearum
           CMR15]
          Length = 156

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 29/146 (19%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           + YWL+KSEP E S    Q +G +   WTGVRNYQARN MR +MR+GD   FYHS+  + 
Sbjct: 3   IQYWLMKSEPDEASIDTLQTEGTL--PWTGVRNYQARNFMRDRMRIGDGVLFYHSSCPQP 60

Query: 60  -IVGIFEVITCTYPDPT-------------AEQSSCWECVDI-----CAVCSMPCPVSLM 100
            I G+ EV + +YPDPT              +++  W  VD+     CA+  +P      
Sbjct: 61  GIAGLAEVCSTSYPDPTQFDSKSPYYDPAAKQETPRWMLVDVRYVRKCALIDLPT----- 115

Query: 101 AIKANPRLSSM-ILIVSSRLSVQPVT 125
            ++A   L+ M IL  S+RLS+ PVT
Sbjct: 116 -LRAQEPLADMTILQRSNRLSITPVT 140


>gi|161524015|ref|YP_001579027.1| hypothetical protein Bmul_0836 [Burkholderia multivorans ATCC
           17616]
 gi|160341444|gb|ABX14530.1| protein of unknown function DUF55 [Burkholderia multivorans ATCC
           17616]
          Length = 194

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 77/145 (53%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 42  MQFWLMKSEPDEASIDDLAHAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 101

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT             + +S  W  VD+  V   P  VSL A++ +
Sbjct: 102 GIAGLAEVASTPYPDPTQFDPKSPYYDPKSSPESPRWLLVDVRFVKKTPL-VSLAALREH 160

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 161 DELADMRVLARGNRLSITPVTRAEW 185


>gi|209521441|ref|ZP_03270150.1| protein of unknown function DUF55 [Burkholderia sp. H160]
 gi|209498127|gb|EDZ98273.1| protein of unknown function DUF55 [Burkholderia sp. H160]
          Length = 152

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLANAPHRTLPWTGVRNYQARNFMRDVMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT             + ++  W  VD+     +P  +SL A++ +
Sbjct: 61  GIAGIAEVSSTAYPDPTQFDKKSPYYDAKSSPETPRWLLVDVVFKKKIPL-ISLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L  M +L   +RLS+ PVT  E+  + +
Sbjct: 120 AELEDMRVLAKGNRLSITPVTEAEWRFITK 149


>gi|307728905|ref|YP_003906129.1| hypothetical protein BC1003_0854 [Burkholderia sp. CCGE1003]
 gi|307583440|gb|ADN56838.1| protein of unknown function DUF55 [Burkholderia sp. CCGE1003]
          Length = 152

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 76/145 (52%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M+VGD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANARHRTLPWTGVRNYQARNFMRDAMQVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT             ++++  W  VD+     +P  + L A++ +
Sbjct: 61  GIAGLAEVASTAYPDPTQFDSKSPYYDPKSSQETPRWLLVDVVFKKKIPL-IPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L  M +L   +RLS+ PVT  E+
Sbjct: 120 EELKDMRVLARGNRLSITPVTEAEW 144


>gi|207742616|ref|YP_002259008.1| protein of unknown function duf589 [Ralstonia solanacearum IPO1609]
 gi|206594010|emb|CAQ60937.1| protein of unknown function duf589 [Ralstonia solanacearum IPO1609]
          Length = 168

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 79/141 (56%), Gaps = 23/141 (16%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+KSEP E S    Q +G +   WTGVRNYQARN MR +MR+GD   FYHS+  +  I
Sbjct: 17  YWLMKSEPDEASIDTLQTEGTL--PWTGVRNYQARNFMRDRMRIGDGVLFYHSSCAQPGI 74

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAV--CSMPCPVSLMAIKAN 105
            G+ EV + +YPDPT              +++  W  VD+  V  C++   + L  ++A 
Sbjct: 75  AGLAEVCSTSYPDPTQFDSKSPYYDPAAKQETPRWMLVDVRFVRKCTL---IDLPTLRAQ 131

Query: 106 PRLSSM-ILIVSSRLSVQPVT 125
             L  M IL   +RLS+ PVT
Sbjct: 132 DPLGDMTILQRGNRLSITPVT 152


>gi|167835797|ref|ZP_02462680.1| hypothetical protein Bpse38_04850 [Burkholderia thailandensis
           MSMB43]
          Length = 153

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 77/145 (53%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP+E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPNEASIDDLAAAPDQTLPWTGVRNYQARNFMRDMMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ +V +  YPDPT               +S  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAQVSSTPYPDPTQFDSQSPYHDPKSTRESPRWVLVDVRFVRKSPL-VPLAALRGH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT DE+
Sbjct: 120 DALANMRVLAKGNRLSITPVTPDEW 144


>gi|207721403|ref|YP_002251844.1| protein of unknown function duf589 [Ralstonia solanacearum MolK2]
 gi|206586562|emb|CAQ17149.1| protein of unknown function duf589 [Ralstonia solanacearum MolK2]
          Length = 168

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 79/141 (56%), Gaps = 23/141 (16%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+KSEP E S    Q +G +   WTGVRNYQARN MR +MR+GD   FYHS+  +  I
Sbjct: 17  YWLMKSEPDEASIDTLQTEGTL--PWTGVRNYQARNFMRDRMRIGDGVLFYHSSCAQPGI 74

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAV--CSMPCPVSLMAIKAN 105
            G+ EV + +YPDPT              +++  W  VD+  V  C++   + L  ++A 
Sbjct: 75  AGLAEVCSTSYPDPTQFDSKSPYYDPAAKQETPRWMLVDVRFVRKCTL---IDLPTLRAQ 131

Query: 106 PRLSSM-ILIVSSRLSVQPVT 125
             L  M IL   +RLS+ PVT
Sbjct: 132 EPLGDMTILQRGNRLSITPVT 152


>gi|171321005|ref|ZP_02909993.1| protein of unknown function DUF55 [Burkholderia ambifaria MEX-5]
 gi|171093725|gb|EDT38868.1| protein of unknown function DUF55 [Burkholderia ambifaria MEX-5]
          Length = 153

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 76/145 (52%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S        +    WTGVRNYQARN MR  M+VGD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLVHAPQHSLPWTGVRNYQARNFMRDTMKVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT              +++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSAPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVRFVKKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEW 144


>gi|115352558|ref|YP_774397.1| hypothetical protein Bamb_2507 [Burkholderia ambifaria AMMD]
 gi|170697643|ref|ZP_02888731.1| protein of unknown function DUF55 [Burkholderia ambifaria IOP40-10]
 gi|172061417|ref|YP_001809069.1| hypothetical protein BamMC406_2375 [Burkholderia ambifaria MC40-6]
 gi|115282546|gb|ABI88063.1| protein of unknown function DUF55 [Burkholderia ambifaria AMMD]
 gi|170137391|gb|EDT05631.1| protein of unknown function DUF55 [Burkholderia ambifaria IOP40-10]
 gi|171993934|gb|ACB64853.1| protein of unknown function DUF55 [Burkholderia ambifaria MC40-6]
          Length = 153

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 76/145 (52%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLAHAPQHSLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT              +++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVRFVKKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEW 144


>gi|323525113|ref|YP_004227266.1| hypothetical protein BC1001_0752 [Burkholderia sp. CCGE1001]
 gi|323382115|gb|ADX54206.1| protein of unknown function DUF55 [Burkholderia sp. CCGE1001]
          Length = 152

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANAPHRTLPWTGVRNYQARNLMRDVMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT             ++++  W  VD+     +P  + L A++ +
Sbjct: 61  GIAGLAEVASTAYPDPTQFDSKSPYYDPKSSQETPRWLLVDVVFKKKIPL-IPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L  M +L   +RLS+ PVT  E+  + +
Sbjct: 120 EELKDMRVLARGNRLSITPVTEAEWRFITK 149


>gi|68171525|ref|ZP_00544905.1| Protein of unknown function DUF589 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88658034|ref|YP_507938.1| hypothetical protein ECH_1154 [Ehrlichia chaffeensis str. Arkansas]
 gi|67999053|gb|EAM85724.1| Protein of unknown function DUF589 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599491|gb|ABD44960.1| conserved hypothetical protein [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 135

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 77/138 (55%), Gaps = 7/138 (5%)

Query: 1   MAYWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M+YWL+K+EP ++SW  M +D   V   W  V NYQA+N ++ M+  D  FFYHS K + 
Sbjct: 1   MSYWLLKTEPQDFSWDDMVRDNVTV---WDNVLNYQAQNYLKTMKYNDLAFFYHSGKEKG 57

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
           I+GI  +    Y   T   ++ +  V++     +   V L  IK+NP L +M+++   RL
Sbjct: 58  IIGIVSIDKEFYLPNT---NNKFGVVEVKTHIKLNKTVFLKDIKSNPTLKTMLILKQPRL 114

Query: 120 SVQPVTTDEYLEVCRMGK 137
           SV  VT  E+  +  +G+
Sbjct: 115 SVSQVTEQEWNCILHLGE 132


>gi|73954572|ref|XP_546386.2| PREDICTED: similar to thymocyte protein thy28 isoform 1 [Canis
           familiaris]
          Length = 243

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 80/159 (50%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           +YWL+KSEP          ++S +  + + +    W GVRNYQARN +R M++  K FFY
Sbjct: 73  SYWLMKSEPQSRIEKGVDVKFSIEDLKAEPKQTACWDGVRNYQARNFLRAMKLEQKAFFY 132

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T              E +  W  VD+  V  M   ++
Sbjct: 133 HSNCKEPGIAGLVKIVKEAYPDHTQFEKNNPYYDPSSKEDNPKWSMVDVQFVRLMKRYIT 192

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +KAN +        L +M L    RLSVQP+T +E+
Sbjct: 193 LTELKANHQAHKATGGPLKNMALFTHPRLSVQPLTPEEF 231


>gi|121997970|ref|YP_001002757.1| hypothetical protein Hhal_1180 [Halorhodospira halophila SL1]
 gi|121589375|gb|ABM61955.1| protein of unknown function DUF55 [Halorhodospira halophila SL1]
          Length = 154

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 79/153 (51%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M  W++KSEP  +         +  + W GVRNYQ RN +R  MR GD  FFYHSN +  
Sbjct: 1   MNRWVMKSEPDVFGIDDLAAAPQGTDRWDGVRNYQVRNMIRDHMRPGDAAFFYHSNTRPP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VG+ EV++  YPDPTA              ++  W CVD+     +P  V+L  ++  
Sbjct: 61  GVVGVMEVVSGPYPDPTAFDPDDLHYDPKSTPEAPRWYCVDVRFRERLPRQVTLQELREC 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
           P L    LI   +RLS+ PVT  ++  + R+ +
Sbjct: 121 PDLEGFPLIRRGNRLSIVPVTEAQWAVIRRLAE 153


>gi|221199316|ref|ZP_03572360.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221205782|ref|ZP_03578797.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221174620|gb|EEE07052.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221180601|gb|EEE13004.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 153

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 76/145 (52%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLAHAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT             + +S  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVASTPYPDPTQFDPKSPYYDPKSSPESPRWLLVDVRFVKKTPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEW 144


>gi|89073815|ref|ZP_01160322.1| hypothetical protein SKA34_16820 [Photobacterium sp. SKA34]
 gi|89050350|gb|EAR55851.1| hypothetical protein SKA34_16820 [Photobacterium sp. SKA34]
          Length = 152

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 85/151 (56%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   K +    W GVRNYQARN +R ++++GD+ F YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IDTLKLQKVSPWEGVRNYQARNMLRDEVKLGDQVFIYHSSCKDV 58

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI  VI  +YP            DP ++ ++  W  VDI     +   VSL  +KAN
Sbjct: 59  GVVGIATVIKASYPDHFQFDPESPYFDPKSDPENPRWFMVDIEYQRHLRL-VSLKRMKAN 117

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRM 135
           P L+ M L+   SRLSV PVT  ++ E+  M
Sbjct: 118 PALAEMSLVKKGSRLSVMPVTDTQWQEILTM 148


>gi|332264024|ref|XP_003281048.1| PREDICTED: thymocyte nuclear protein 1-like isoform 1 [Nomascus
           leucogenys]
 gi|332264026|ref|XP_003281049.1| PREDICTED: thymocyte nuclear protein 1-like isoform 2 [Nomascus
           leucogenys]
          Length = 225

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 81/159 (50%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + R    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPRQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I GI +++   YPD T              E +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGIMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +K+  +        L +M+L    RLSVQP+T +E+
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSVQPLTQEEF 213


>gi|300703345|ref|YP_003744947.1| hypothetical protein RCFBP_11018 [Ralstonia solanacearum CFBP2957]
 gi|299071008|emb|CBJ42317.1| conserved protein of unknown function [Ralstonia solanacearum
           CFBP2957]
          Length = 156

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 78/144 (54%), Gaps = 29/144 (20%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+KSEP E S    Q +G +   WTGVRNYQARN MR +MR+GD   FYHS+  +  I
Sbjct: 5   YWLMKSEPDEASIDTLQTEGTL--PWTGVRNYQARNFMRDRMRIGDGVLFYHSSCAQPGI 62

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDI-----CAVCSMPCPVSLMAI 102
            G+ EV + +YPDPT              +++  W  VD+     CA+  +P       +
Sbjct: 63  AGLAEVCSTSYPDPTQFDSKSPYYDPAAKQETPRWMLVDVRFVRKCALIDLPT------L 116

Query: 103 KANPRLSSMILIV-SSRLSVQPVT 125
           +A   L  M L+   +RLS+ PVT
Sbjct: 117 RAQEPLGDMTLLQRGNRLSITPVT 140


>gi|260835998|ref|XP_002612994.1| hypothetical protein BRAFLDRAFT_120829 [Branchiostoma floridae]
 gi|229298376|gb|EEN69003.1| hypothetical protein BRAFLDRAFT_120829 [Branchiostoma floridae]
          Length = 243

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/174 (37%), Positives = 82/174 (47%), Gaps = 35/174 (20%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEA---------WTGVRNYQARNNMR-KMRVGDKGFF 51
           ++WL+KSEP     K    K  + E          W GVRNYQARN MR +MRVG K FF
Sbjct: 31  SHWLMKSEPESRIEKGIDVKFGITELKAEPNQTACWDGVRNYQARNFMRDQMRVGHKAFF 90

Query: 52  YHSN-KGREIVGIFEVITCTYPDPTAEQSS-------------CWECVDICAVCSMPCPV 97
           YHSN K   I GI E++  +YPD T   S               W  VD+  V  +   +
Sbjct: 91  YHSNCKEPGIAGIVEIVKESYPDHTQFDSKDPHYDSSSKKDNPKWFMVDVKFVRMLKRFI 150

Query: 98  SLMAIKA--------NPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL 143
            L  +KA           L +M L   +RLSVQPVT +E+  V     L  PPL
Sbjct: 151 PLSELKALHLEHKSTGGALQNMALFTRARLSVQPVTKEEFDFVV---SLEGPPL 201


>gi|192359197|ref|YP_001982555.1| hypothetical protein CJA_2090 [Cellvibrio japonicus Ueda107]
 gi|190685362|gb|ACE83040.1| Family of unknown function (DUF589) superfamily [Cellvibrio
           japonicus Ueda107]
          Length = 154

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 72/142 (50%), Gaps = 15/142 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL K+EP  +  +      +    W G+RNYQARN +R ++ VGD+ F YHS+ K   I
Sbjct: 6   YWLFKAEPHIYGIEHLAAAPQKTGRWDGIRNYQARNFLRDQVAVGDEVFIYHSSCKQVGI 65

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VG   V+   YPDPT               ++  W  VDI         + L  IKA P 
Sbjct: 66  VGTARVVKAAYPDPTQFDPESPYYDPKATPENPRWVSVDIKLSNIFSRLIPLAEIKAQPA 125

Query: 108 LSSMILIVSSRLSVQPVTTDEY 129
           L +M+L+  SRLS QPV+  E+
Sbjct: 126 LENMVLLKQSRLSTQPVSAHEW 147


>gi|260099885|pdb|3EOP|A Chain A, Crystal Structure Of The Duf55 Domain Of Human Thymocyte
           Nuclear Protein 1
 gi|260099886|pdb|3EOP|B Chain B, Crystal Structure Of The Duf55 Domain Of Human Thymocyte
           Nuclear Protein 1
          Length = 176

 Score = 85.9 bits (211), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 82/160 (51%), Gaps = 31/160 (19%)

Query: 1   MAYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFF 51
           M++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FF
Sbjct: 1   MSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFF 60

Query: 52  YHSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPV 97
           YHSN K   I G+ +++   YPD T              E +  W  VD+  V  M   +
Sbjct: 61  YHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFI 120

Query: 98  SLMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
            L  +K+  +        L +M+L    RLS+QP+T +E+
Sbjct: 121 PLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEF 160


>gi|167580147|ref|ZP_02373021.1| hypothetical protein BthaT_18480 [Burkholderia thailandensis TXDOH]
 gi|167618253|ref|ZP_02386884.1| hypothetical protein BthaB_18241 [Burkholderia thailandensis Bt4]
 gi|257139939|ref|ZP_05588201.1| hypothetical protein BthaA_12175 [Burkholderia thailandensis E264]
          Length = 153

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 75/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ +V +  YPDPT               +S  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAQVSSTPYPDPTQFDPQSPYHDPKSTRESPRWVLVDVRFVRKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT DE+
Sbjct: 120 DALADMRVLAKGNRLSITPVTPDEW 144


>gi|308081315|ref|NP_001183709.1| hypothetical protein LOC100502302 [Zea mays]
 gi|238014048|gb|ACR38059.1| unknown [Zea mays]
          Length = 180

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 70/141 (49%), Gaps = 8/141 (5%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG---RE 59
           YWL+K+EP EWSW  Q         W GVRN QA +++R MR GD+  FYHS  G   R 
Sbjct: 23  YWLLKTEPGEWSWSDQARAPGGVAPWDGVRNRQAMSSLRAMRPGDRCLFYHSGAGAASRR 82

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANP----RLSSMILIV 115
           +VG+ EV    Y +   E++     VD+ AV     PV L  IK        +    L+ 
Sbjct: 83  VVGVVEVARPWY-EGEGEEAVAGGAVDVRAVGEFRNPVPLGVIKKAAGEVEGMKDFALLR 141

Query: 116 SSRLSVQPVTTDEYLEVCRMG 136
            +RLSV PV    +  VC  G
Sbjct: 142 QARLSVMPVPAKIWDWVCDAG 162


>gi|149921080|ref|ZP_01909539.1| hypothetical protein PPSIR1_09565 [Plesiocystis pacifica SIR-1]
 gi|149818084|gb|EDM77541.1| hypothetical protein PPSIR1_09565 [Plesiocystis pacifica SIR-1]
          Length = 169

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/154 (39%), Positives = 81/154 (52%), Gaps = 23/154 (14%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL+KSEP  +S +  +  G+  E W GVRNYQARN+MR +M VGD   FYHSN K   +
Sbjct: 8   YWLMKSEPEVYSIEDLERDGQ--EPWDGVRNYQARNSMRDEMAVGDLVLFYHSNAKPPGV 65

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIK---- 103
            G+  V T  YPDPTA              ++  W  VD+  V      VSL A+K    
Sbjct: 66  AGVARVCTAAYPDPTAFDPGSDYYDPKSDPEAPRWWMVDVEFVERFDALVSLDALKAEGD 125

Query: 104 -ANPRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            A+  L+ M++I    RLSVQ V    +  V ++
Sbjct: 126 GADAPLAGMLVIRRGQRLSVQAVEAAHFAHVLKI 159


>gi|15805593|ref|NP_294289.1| hypothetical protein DR_0566 [Deinococcus radiodurans R1]
 gi|6458261|gb|AAF10146.1|AE001914_8 conserved hypothetical protein [Deinococcus radiodurans R1]
          Length = 163

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 83/158 (52%), Gaps = 19/158 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           A+WL+KSEP  +S+    D  RVG E W GVRNYQARN +R+M  GD   FYHSN +   
Sbjct: 3   AFWLLKSEPDVFSYA---DLMRVGREPWNGVRNYQARNFLRQMEEGDLCLFYHSNARPPG 59

Query: 60  IVGIFEVITCTYP-----DPTAE--------QSSCWECVDICAVCSMPCPVSLMAIKANP 106
           + G+ +V+   YP     DP +E        ++  W  VD+  V ++P  + L  ++  P
Sbjct: 60  LAGVAQVVRVAYPDDLQFDPASEYYDPRSDPENPRWSMVDVAPVLALPRLLPLDELRELP 119

Query: 107 R-LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL 143
               S +    +RLSV PVT +++        +  PPL
Sbjct: 120 EWHDSPLTRKGTRLSVFPVTPEQWRAALAAVGVELPPL 157


>gi|291286060|ref|YP_003502876.1| hypothetical protein Dacet_0114 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290883220|gb|ADD66920.1| protein of unknown function DUF55 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 155

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/153 (37%), Positives = 77/153 (50%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGR- 58
           M YWL+KSEP  +S    ++     E W G+RNYQARN MR  M +GD+  FYHSN    
Sbjct: 1   MRYWLMKSEPESFSIDDLKNCKNSTEHWDGIRNYQARNFMRDDMVIGDRVLFYHSNTDEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            +VGI EV +  Y D TA  S               W  VDI  V      V+L  +K+ 
Sbjct: 61  GVVGIAEVASEPYADYTAFDSGSKYYDRQSTKENPRWVMVDIRFVEKFDRTVTLKEMKSM 120

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
             L+ M L+   +RLS+ PV  +E+  +  M K
Sbjct: 121 YNLAGMKLLQRGNRLSIMPVGKNEFETIVSMSK 153


>gi|83720482|ref|YP_441387.1| hypothetical protein BTH_I0831 [Burkholderia thailandensis E264]
 gi|83654307|gb|ABC38370.1| Family of unknown function (DUF589) superfamily [Burkholderia
           thailandensis E264]
          Length = 170

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 75/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 18  MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 77

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ +V +  YPDPT               +S  W  VD+  V   P  V L A++ +
Sbjct: 78  GIAGLAQVSSTPYPDPTQFDPQSPYHDPKSTRESPRWVLVDVRFVRKSPL-VPLAALREH 136

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT DE+
Sbjct: 137 DALADMRVLAKGNRLSITPVTPDEW 161


>gi|53802490|ref|YP_112885.1| hypothetical protein MCA0353 [Methylococcus capsulatus str. Bath]
 gi|53756251|gb|AAU90542.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 152

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 78/145 (53%), Gaps = 16/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+K+EP E+       +    E W GVRNYQARN MR +M+VGD   FYHSN    
Sbjct: 1   MRYWLMKTEPGEFGIDDLAARPAQTEPWDGVRNYQARNMMRDEMKVGDGVLFYHSNCDVP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI E+    YPD TA              ++  W  VD+  V  +   ++L  ++  
Sbjct: 61  GVVGIAEIAREAYPDFTAFDPDHKHYDPASKPEAPRWFMVDVRFVRKLRRTIALSELRDR 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEY 129
           P L+ + L+  ++RLSV PV+ D++
Sbjct: 121 PELAGLALVRKANRLSVMPVSPDQW 145


>gi|78779905|ref|YP_398017.1| hypothetical protein PMT9312_1521 [Prochlorococcus marinus str. MIT
           9312]
 gi|78713404|gb|ABB50581.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9312]
          Length = 152

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 74/142 (52%), Gaps = 17/142 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           + YWL+KSEP  +S    ++ G     W G+RNYQARN MR M +GDK FFYHSN K   
Sbjct: 4   INYWLMKSEPDAYSIDNLKNDGIT--LWDGIRNYQARNFMRNMNIGDKVFFYHSNCKPPG 61

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ EVI+    DPT    +              W+CV +  +      +SL  +KA  
Sbjct: 62  IVGLMEVISLKIVDPTQFDKASKYFDPKSKPNNPRWDCVKVKYISKSNKMLSLPELKALF 121

Query: 107 RLSSMILIVS-SRLSVQPVTTD 127
               ++++   +RLS+ P+  D
Sbjct: 122 SEDELLVVKKGNRLSILPIRND 143


>gi|330818010|ref|YP_004361715.1| hypothetical protein bgla_1g31520 [Burkholderia gladioli BSR3]
 gi|327370403|gb|AEA61759.1| hypothetical protein bgla_1g31520 [Burkholderia gladioli BSR3]
          Length = 153

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLAAAPKHTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT               +   W  VD+  V   P  + L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPASPYHDPKSKREEPRWSLVDVRFVKKTPL-IPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELAEMRVLARGNRLSITPVTRAEW 144


>gi|109896368|ref|YP_659623.1| hypothetical protein Patl_0037 [Pseudoalteromonas atlantica T6c]
 gi|109698649|gb|ABG38569.1| protein of unknown function DUF55 [Pseudoalteromonas atlantica T6c]
          Length = 157

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 16/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL K+EP  +S      K    E W G+RNYQARN +R +++ GDK F YHS+ K  
Sbjct: 5   MQYWLFKTEPDAFSIDDLAAKPEQTEHWDGIRNYQARNFLRDQVKQGDKVFIYHSSCKDV 64

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV+   YPD T             +  +  W  VD+  V   P  +SL  IK+ 
Sbjct: 65  GIAGLAEVVKEAYPDHTQFDPESHYYDPKSSPDNPRWVMVDVRFVEKFPAILSLKKIKSM 124

Query: 106 PRLSSMILIVSS-RLSVQPVTTDEY 129
           P ++ + LI    RLS+ PV   E+
Sbjct: 125 PEINEIGLIKKGYRLSIMPVNEHEF 149


>gi|21362343|ref|NP_653126.1| thymocyte nuclear protein 1 [Mus musculus]
 gi|81879701|sp|Q91YJ3|THYN1_MOUSE RecName: Full=Thymocyte nuclear protein 1; AltName: Full=Thymocyte
           protein Thy28; Short=mThy28
 gi|16741578|gb|AAH16594.1| Thymocyte nuclear protein 1 [Mus musculus]
 gi|23978374|dbj|BAC21100.1| thymocyte protein mThy28 [Mus musculus]
          Length = 226

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 77/158 (48%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP        +  + ++  K +  +   W GVRNYQARN +R M++ D+ FFYH
Sbjct: 57  YWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFYH 116

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   IVG+ +++   YPD T              E    W  VD+  V  M   + L
Sbjct: 117 SNCKQPGIVGLMKIVKEAYPDHTQFEKSNPHYDPSSKEDDPKWSMVDVQFVRMMKRFIPL 176

Query: 100 MAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
             +K   +        L SM L    RLSVQP+T +E+
Sbjct: 177 EELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEF 214


>gi|83746697|ref|ZP_00943746.1| Hypothetical protein RRSL_03608 [Ralstonia solanacearum UW551]
 gi|83726650|gb|EAP73779.1| Hypothetical protein RRSL_03608 [Ralstonia solanacearum UW551]
          Length = 233

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 79/141 (56%), Gaps = 23/141 (16%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+KSEP E S    Q +G +   WTGVRNYQARN MR +MR+GD   FYHS+  +  I
Sbjct: 82  YWLMKSEPDEASIDTLQTEGTL--PWTGVRNYQARNFMRDRMRIGDGVLFYHSSCAQPGI 139

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAV--CSMPCPVSLMAIKAN 105
            G+ EV + +YPDPT              +++  W  VD+  V  C++   + L  ++A 
Sbjct: 140 AGLAEVCSTSYPDPTQFDSKSPYYDPAAKQETPRWMLVDVRFVRKCTL---IDLPTLRAQ 196

Query: 106 PRLSSM-ILIVSSRLSVQPVT 125
             L  M IL   +RLS+ PVT
Sbjct: 197 DPLGDMTILQRGNRLSITPVT 217


>gi|90581446|ref|ZP_01237241.1| hypothetical protein VAS14_21987 [Vibrio angustum S14]
 gi|90437423|gb|EAS62619.1| hypothetical protein VAS14_21987 [Vibrio angustum S14]
          Length = 152

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 83/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   K +    W GVRNYQARN +R ++++GD+ F YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IDTLKSQKVSPWEGVRNYQARNMLRDEVKLGDQVFIYHSSCKDV 58

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI  V+  +YPD              +  ++  W  VDI     +   VSL  +KAN
Sbjct: 59  GVVGIATVVKASYPDHFQFDPESPYFDPKSNPENPRWFMVDIEYQRHLRL-VSLKRMKAN 117

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRM 135
           P L+ M L+   SRLSV PVT  ++ E+  M
Sbjct: 118 PALAEMPLVKKGSRLSVMPVTDAQWQEILTM 148


>gi|148693367|gb|EDL25314.1| thymocyte nuclear protein 1, isoform CRA_c [Mus musculus]
          Length = 249

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 77/158 (48%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP        +  + ++  K +  +   W GVRNYQARN +R M++ D+ FFYH
Sbjct: 80  YWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFYH 139

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   IVG+ +++   YPD T              E    W  VD+  V  M   + L
Sbjct: 140 SNCKQPGIVGLMKIVKEAYPDHTQFEKSNPHYDPSSKEDDPKWSMVDVQFVRMMKRFIPL 199

Query: 100 MAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
             +K   +        L SM L    RLSVQP+T +E+
Sbjct: 200 EELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEF 237


>gi|12039290|gb|AAG46080.1|AC079830_20 hypothetical protein [Oryza sativa Japonica Group]
          Length = 409

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 71/145 (48%), Gaps = 14/145 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKG---R 58
           YWL+K+EP EWSW  Q      G A W GVRN QA N +R MRVGD+  FYHS  G   R
Sbjct: 57  YWLLKTEPGEWSWSDQARAPGGGVAPWDGVRNRQAVNGLRAMRVGDRCLFYHSGAGAASR 116

Query: 59  EIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIK--------ANPRLSS 110
            +VG+ EV    Y      +++    VD+ AV     PV+L  IK            +  
Sbjct: 117 RVVGVVEVAREWYEG--EGEAASGGAVDVRAVGEFRRPVALGEIKKAAGGGGGEVEGMRE 174

Query: 111 MILIVSSRLSVQPVTTDEYLEVCRM 135
             L+   RLSV PV    +  +C M
Sbjct: 175 FALLRQPRLSVMPVPAKVWDWICEM 199


>gi|318042233|ref|ZP_07974189.1| hypothetical protein SCB01_11017 [Synechococcus sp. CB0101]
          Length = 152

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 79/139 (56%), Gaps = 17/139 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MA+WL+KSEP  +  +  + +G     W G+RNYQARN MR M++GD+ FFYHSN K   
Sbjct: 1   MAFWLMKSEPDVYGIEHLKQEGTT--LWDGIRNYQARNFMRAMQIGDRAFFYHSNAKPPG 58

Query: 60  IVGIFEVI------------TCTYPDP-TAEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ EVI            T  Y DP ++ +   W+CV +  V S    +SL A++   
Sbjct: 59  IVGLMEVIETGLVDPSQFDPTNKYFDPKSSPEKPRWDCVRLRYVGSFGELLSLDALREQF 118

Query: 107 RLSSMILIVS-SRLSVQPV 124
            +  + ++ + +RLS+ PV
Sbjct: 119 SVEELPVVRNGNRLSILPV 137


>gi|310794875|gb|EFQ30336.1| hypothetical protein GLRG_05480 [Glomerella graminicola M1.001]
          Length = 321

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 78/160 (48%), Gaps = 25/160 (15%)

Query: 3   YWLVKSEPS-----EWSWKMQQDK---GRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHS 54
           YWL+KSEP       +  K   D     +  E W G+RNY ARNN+R MR GDK FFYHS
Sbjct: 138 YWLMKSEPDVRVEDGYEIKFSIDDLAAKKTPEGWEGIRNYVARNNLRSMRKGDKAFFYHS 197

Query: 55  N-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVD--ICAVCSMPCPVS 98
           N K   +VGI  ++    PD  A                S W  V   I    S   P+S
Sbjct: 198 NCKEPGVVGIMSIVKEHSPDWNACINDNPYYDAAAPHDGSKWSLVHVKIEHKFSRIVPLS 257

Query: 99  LM-AIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L+ A++    L  M L+  +RLSV  VT +E+ EV RM +
Sbjct: 258 LLKALRGGGPLRDMELLRLARLSVTKVTPEEWDEVIRMAR 297


>gi|194213007|ref|XP_001505163.2| PREDICTED: similar to thymocyte nuclear protein 1 [Equus caballus]
          Length = 242

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 81/159 (50%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           +YWL+KSEP          ++S +  + + +    W GVRNYQARN +R M++ ++ FFY
Sbjct: 72  SYWLMKSEPESRLAKGVDVKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEEEAFFY 131

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T              E +  W  VD+  V  M   +S
Sbjct: 132 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIS 191

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +K + +        L +M+L    RLS+QPVT +E+
Sbjct: 192 LAELKTHHQAHKATGGPLKNMVLFTRQRLSIQPVTQEEF 230


>gi|148693365|gb|EDL25312.1| thymocyte nuclear protein 1, isoform CRA_a [Mus musculus]
          Length = 261

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 77/158 (48%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP        +  + ++  K +  +   W GVRNYQARN +R M++ D+ FFYH
Sbjct: 92  YWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFYH 151

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   IVG+ +++   YPD T              E    W  VD+  V  M   + L
Sbjct: 152 SNCKQPGIVGLMKIVKEAYPDHTQFEKSNPHYDPSSKEDDPKWSMVDVQFVRMMKRFIPL 211

Query: 100 MAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
             +K   +        L SM L    RLSVQP+T +E+
Sbjct: 212 EELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEF 249


>gi|186476968|ref|YP_001858438.1| hypothetical protein Bphy_2217 [Burkholderia phymatum STM815]
 gi|184193427|gb|ACC71392.1| protein of unknown function DUF55 [Burkholderia phymatum STM815]
          Length = 156

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 77/150 (51%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLANAPQRTLPWTGVRNYQARNFMRDIMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT               ++  W  VD+     +   + L  ++ +
Sbjct: 61  GIAGIAEVSSTPYPDPTQFDPKSPYYDERSNRETPRWTLVDVVFKKKIAL-IPLAELREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
           P L+ M +L   +RLS+ PVT  E+  + +
Sbjct: 120 PELADMRVLAKGNRLSITPVTEAEWAFITK 149


>gi|302832740|ref|XP_002947934.1| hypothetical protein VOLCADRAFT_46120 [Volvox carteri f.
           nagariensis]
 gi|300266736|gb|EFJ50922.1| hypothetical protein VOLCADRAFT_46120 [Volvox carteri f.
           nagariensis]
          Length = 152

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 82/151 (54%), Gaps = 18/151 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           Y+L+KSEP E+S      K      W GVRN QARN MR MR+GD+ FFYHS+ K   +V
Sbjct: 1   YFLMKSEPEEFSLDDLAAKPNQTSHWEGVRNAQARNIMRSMRLGDEAFFYHSSCKVPAVV 60

Query: 62  GIFEVITCTYPDPTA--------EQSSC-----WECVDICAVCSMPCPVSLMAIKAN--- 105
           G+  V+   YPD  A        + SS      W  VD+  V  M  PV+L  ++     
Sbjct: 61  GVVRVVREAYPDHFAFDKGSKYYDPSSTPDGPKWWMVDVKLVRRMSRPVTLAELRQEGTK 120

Query: 106 -PRLSSMILIVSSRLSVQPVTTDEYLEVCRM 135
            P +  M+LI  SRLSVQPVT++++  +  +
Sbjct: 121 GPPIRDMVLINKSRLSVQPVTSEQWQRILEL 151


>gi|42522836|ref|NP_968216.1| hypothetical protein Bd1315 [Bdellovibrio bacteriovorus HD100]
 gi|39574032|emb|CAE79209.1| conserved hypothetical protein [Bdellovibrio bacteriovorus HD100]
          Length = 152

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 79/152 (51%), Gaps = 18/152 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M YWL+KSEP  +S  + Q K      WTGVRNYQARN M K M+VGD+  FYHSN    
Sbjct: 1   MKYWLMKSEPDVFS--LDQLKKDKTTWWTGVRNYQARNFMMKDMQVGDEVLFYHSNATPP 58

Query: 60  -IVGIFEVITCTYP------------DPTA-EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI  +     P            DP A ++   W CV +  V      +SL  ++ N
Sbjct: 59  GVAGIARISKVAEPDKEQFDKKSEYFDPKATKEKPIWFCVQVEYVAHFKNYISLPELRDN 118

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRMG 136
            +L+ M+++   SRLS+QPV    +  + ++G
Sbjct: 119 AKLADMLVLQKGSRLSIQPVEKKHFDILTKLG 150


>gi|218894331|ref|YP_002443201.1| hypothetical protein PLES_56231 [Pseudomonas aeruginosa LESB58]
 gi|218774560|emb|CAW30377.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
          Length = 152

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 75/151 (49%), Gaps = 17/151 (11%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREI 60
           AYWL+KSEP E S +  Q  G     W GVRNYQARN +R M  GD  FFYHS+     I
Sbjct: 3   AYWLMKSEPDELSIRDLQHLGTA--RWDGVRNYQARNFIRSMNSGDLFFFYHSSCPQPGI 60

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
            GI  +    YPD TA   +              W   D+  V +    V L  +KA   
Sbjct: 61  AGIARIEGEAYPDLTALDPASPYHDPKASAGKNPWSARDVSFVEAFAEVVPLARLKAQDA 120

Query: 108 LSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
           L+++ L+   SRLSV PV+ +E+  +  + K
Sbjct: 121 LANLALVQKGSRLSVMPVSAEEWQAILPLAK 151


>gi|113953459|ref|YP_731462.1| hypothetical protein sync_2265 [Synechococcus sp. CC9311]
 gi|113880810|gb|ABI45768.1| conserved hypothetical protein [Synechococcus sp. CC9311]
          Length = 156

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 81/148 (54%), Gaps = 17/148 (11%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREI 60
           +YWL+KSEP+ +   ++  +      W G+RNYQARN MRKM+VGD+ FFYHSN K   I
Sbjct: 5   SYWLMKSEPNVYG--IEHLRNEKVTLWDGIRNYQARNFMRKMKVGDQAFFYHSNCKPPGI 62

Query: 61  VGIFEV------------ITCTYPDPTAEQSS-CWECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ EV                Y DP ++Q S  W+CV +         ++L  ++ + +
Sbjct: 63  VGLMEVTETGLVDPTQFDTNSKYYDPASKQDSPRWDCVKLAYRGQFSDMLTLDDLRESYQ 122

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCR 134
              + ++   +RLS+ PV T+  +++ R
Sbjct: 123 ADELTVVRRGNRLSILPVDTEIAMDLLR 150


>gi|262200007|ref|YP_003271216.1| hypothetical protein Hoch_6859 [Haliangium ochraceum DSM 14365]
 gi|262083354|gb|ACY19323.1| protein of unknown function DUF55 [Haliangium ochraceum DSM 14365]
          Length = 156

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 78/152 (51%), Gaps = 20/152 (13%)

Query: 3   YWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGRE 59
           YWL+K+EP  +S   + +D+  +   W GVRNYQARN MR  MR GD    YHSN K   
Sbjct: 5   YWLMKTEPDVFSIDDLARDQTTL---WEGVRNYQARNFMRDDMRKGDGVLLYHSNAKPSG 61

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           + GI  +   +YPDPTA              ++  W  VD+  V      V L  ++   
Sbjct: 62  VAGIARITRTSYPDPTAFDPDSAYHDPKSDPENPRWLVVDVGFVERFAAVVPLATLRETR 121

Query: 107 RLSSMILIVSS-RLSVQPVTTDEYLEVCRMGK 137
            L  M++I    RLSVQPV+  E+  V R+G+
Sbjct: 122 GLEDMMVIKKGMRLSVQPVSAAEWKIVLRLGR 153


>gi|114563494|ref|YP_751007.1| hypothetical protein Sfri_2323 [Shewanella frigidimarina NCIMB 400]
 gi|114334787|gb|ABI72169.1| protein of unknown function DUF55 [Shewanella frigidimarina NCIMB
           400]
          Length = 155

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 82/154 (53%), Gaps = 16/154 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP ++S    Q   +   AW G+RNYQARN +R ++ +GD   FYHS+ K  
Sbjct: 1   MNYWLMKSEPDDFSIDNLQMSEQQTVAWQGIRNYQARNYIRDQIALGDVVLFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ ++ +    D +A  +               W  VDI  +     PVSL  +KA+
Sbjct: 61  AIVGLAKISSDAQIDISAFDNRSPYYDVKSNTNTPRWWQVDIQFMAKFSKPVSLKQLKAD 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGKL 138
             L  M+L+   +RLSVQPVT  +Y  + ++  L
Sbjct: 121 LALQDMVLVAKGARLSVQPVTPLQYQHIMQLTIL 154


>gi|72382799|ref|YP_292154.1| hypothetical protein PMN2A_0960 [Prochlorococcus marinus str.
           NATL2A]
 gi|72002649|gb|AAZ58451.1| conserved hypothetical protein [Prochlorococcus marinus str.
           NATL2A]
          Length = 157

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 69/142 (48%), Gaps = 17/142 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           + YWL+KSEP  +S K  + +      W G+RNYQARN MR M +GD+ FFYHSN K   
Sbjct: 6   INYWLMKSEPDAYSIKDLEKEEET--LWDGIRNYQARNFMRSMEIGDQAFFYHSNTKPPG 63

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ E+I     DP     S              W+CV    +C     ++L  +    
Sbjct: 64  IVGLMEIIEKNLIDPFQFDESSKYFDKKSKRDNPRWDCVKTKYICEFKSMITLKDLSETY 123

Query: 107 RLSSMILI-VSSRLSVQPVTTD 127
               + L+   +RLS+ P+  D
Sbjct: 124 TSEELTLVRKGNRLSIMPINKD 145


>gi|123969162|ref|YP_001010020.1| hypothetical protein A9601_16301 [Prochlorococcus marinus str.
           AS9601]
 gi|123199272|gb|ABM70913.1| Uncharacterized conserved protein [Prochlorococcus marinus str.
           AS9601]
          Length = 152

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 74/142 (52%), Gaps = 17/142 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           + YWL+KSEP  +S    ++ G     W G+RNYQARN MRKM  GDK FFYHSN K   
Sbjct: 4   INYWLMKSEPDAYSIDNLKNDGVT--LWDGIRNYQARNFMRKMNKGDKVFFYHSNCKPPG 61

Query: 60  IVGIFEVITCTYPDPTA-EQSSC------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ EVI     DPT  +Q S             W+CV +  +      +SL  +K   
Sbjct: 62  IVGLMEVIDLNIIDPTQFDQDSKYFDQKSKPDNPRWDCVKVKYISKSNKILSLPELKILF 121

Query: 107 RLSSMILIVS-SRLSVQPVTTD 127
               ++++   +RLS+ PV  D
Sbjct: 122 NEDDLLVVKKGNRLSILPVRND 143


>gi|22298285|ref|NP_681532.1| hypothetical protein tlr0743 [Thermosynechococcus elongatus BP-1]
 gi|22294464|dbj|BAC08294.1| tlr0743 [Thermosynechococcus elongatus BP-1]
          Length = 180

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/142 (40%), Positives = 74/142 (52%), Gaps = 16/142 (11%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKG-REIV 61
           WL+KSEPS +SW+  +   +    W GVRNYQARN MR  M+VGD+  FYHSN     I+
Sbjct: 30  WLLKSEPSVFSWEDLKAAPQQTTCWEGVRNYQARNFMRDHMQVGDRVLFYHSNANPPAIM 89

Query: 62  GIFEVITCTYPD--------PTAEQSSC-----WECVDICAVCSMPCPVSLMAIKANPRL 108
           GI EV+   YPD        P  +  S      W  VDI        P+ L  ++    L
Sbjct: 90  GIAEVVRPAYPDHFAWNPDSPYFDPKSTPDNPRWLMVDIQYRRDFLPPLPLSELRQTRGL 149

Query: 109 SSMILIVSS-RLSVQPVTTDEY 129
             M+L+    RLSVQPVT  E+
Sbjct: 150 EGMLLLQKGCRLSVQPVTESEW 171


>gi|87123640|ref|ZP_01079490.1| hypothetical protein RS9917_08531 [Synechococcus sp. RS9917]
 gi|86168209|gb|EAQ69466.1| hypothetical protein RS9917_08531 [Synechococcus sp. RS9917]
          Length = 153

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 76/140 (54%), Gaps = 19/140 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP  +S    +D  R     W G+RNYQARN MR M VGD+ FFYHSN K  
Sbjct: 1   MAYWLMKSEPDAYSI---EDLARDSTTLWDGIRNYQARNFMRSMNVGDRAFFYHSNCKPP 57

Query: 59  EIVGIFEVI------------TCTYPDPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ EV+            +  Y DP ++ +S  W+CV +  +      +SL A++  
Sbjct: 58  GIVGLMEVVETGLVDPSQFDPSSKYHDPASKPESPRWDCVKLRYLGVFSAILSLEALRNT 117

Query: 106 PRLSSMILI-VSSRLSVQPV 124
                + ++   +RLS+ PV
Sbjct: 118 YSDDDLAVVRRGNRLSILPV 137


>gi|300690727|ref|YP_003751722.1| hypothetical protein RPSI07_1066 [Ralstonia solanacearum PSI07]
 gi|299077787|emb|CBJ50425.1| conserved protein of unknown function [Ralstonia solanacearum
           PSI07]
          Length = 160

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 81/148 (54%), Gaps = 29/148 (19%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+KSEP E S    Q +G +   WTGVRNYQARN MR +MR+GD   FYH++  +  I
Sbjct: 9   YWLMKSEPDEASIDTLQTEGTL--PWTGVRNYQARNFMRDRMRIGDGVLFYHASCPQPGI 66

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDI-----CAVCSMPCPVSLMAI 102
            G+ EV + +YPDPT              +++  W  VD+     CA+  +P       +
Sbjct: 67  AGLAEVCSTSYPDPTQFNSKSPYYDPAAKQETPRWMLVDVRFVRKCALIDLPT------L 120

Query: 103 KANPRLSSM-ILIVSSRLSVQPVTTDEY 129
           +A   L+ M +L   +RLS+ PVT  ++
Sbjct: 121 RAQEPLADMTVLQRGNRLSITPVTAAQW 148


>gi|116073648|ref|ZP_01470910.1| hypothetical protein RS9916_34397 [Synechococcus sp. RS9916]
 gi|116068953|gb|EAU74705.1| hypothetical protein RS9916_34397 [Synechococcus sp. RS9916]
          Length = 167

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 78/152 (51%), Gaps = 18/152 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP  +   +   K      W G+RNYQARN MR M VGD+ FFYHSN K   IV
Sbjct: 17  YWLMKSEPDVYG--IHHLKSEQTTLWDGIRNYQARNFMRTMAVGDQAFFYHSNCKPPGIV 74

Query: 62  GIFEVI------------TCTYPDPTAE-QSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ EV             T  Y DP ++ +S  W+CV +  V      +SL A+K     
Sbjct: 75  GLMEVTELGIVDPTQFDPTSKYHDPASKPESPRWDCVRLRYVGEFESMLSLDALKEAYTA 134

Query: 109 SSMILI-VSSRLSVQPVTTDEYLEVC-RMGKL 138
             + ++   +RLS+ PV T    ++  R+G L
Sbjct: 135 EQLTVVRRGNRLSIMPVATTIATDLLERLGPL 166


>gi|33241030|ref|NP_875972.1| hypothetical protein Pro1581 [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|33238559|gb|AAQ00625.1| Uncharacterized conserved protein [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 157

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 72/140 (51%), Gaps = 17/140 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           ++YWL+KSEPS +  K  Q++      W G+RNYQARN MR M+ GD  FFYHSN K   
Sbjct: 6   ISYWLMKSEPSAYGIKDLQNEKET--LWDGIRNYQARNFMRSMQKGDLTFFYHSNCKPPG 63

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ EVI     DPT   S+              W+C  +  + +    ++L  I    
Sbjct: 64  IVGLMEVIDTHLIDPTQFDSNSKYFDPKSDQKKPRWDCAKLKYIKTYNKILTLKEINEKF 123

Query: 107 RLSSMILI-VSSRLSVQPVT 125
               +ILI   +RLS+ P+ 
Sbjct: 124 NSEELILIRKGNRLSIMPIN 143


>gi|126441012|ref|YP_001058075.1| hypothetical protein BURPS668_1025 [Burkholderia pseudomallei 668]
 gi|254196383|ref|ZP_04902807.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|126220505|gb|ABN84011.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|169653126|gb|EDS85819.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
          Length = 153

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSHSPYHDPKSTREAPRWMLVDVRFVRKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEW 144


>gi|56090477|ref|NP_001007662.1| thymocyte nuclear protein 1 [Rattus norvegicus]
 gi|81885165|sp|Q6P3E0|THYN1_RAT RecName: Full=Thymocyte nuclear protein 1
 gi|39795639|gb|AAH64031.1| Thymocyte nuclear protein 1 [Rattus norvegicus]
 gi|149027880|gb|EDL83340.1| thymocyte nuclear protein 1, isoform CRA_b [Rattus norvegicus]
 gi|149027881|gb|EDL83341.1| thymocyte nuclear protein 1, isoform CRA_b [Rattus norvegicus]
          Length = 226

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 78/158 (49%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP          ++S +  Q + +    W GVRNYQA N +R M++ D+ FFYH
Sbjct: 57  YWLMKSEPESRLEKGIDMKFSIEDLQAQPKQTTCWDGVRNYQAWNFLRAMKLEDEAFFYH 116

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   IVG+ +++   YPD T              E +  W  VD+  V  M   +SL
Sbjct: 117 SNCKQPGIVGLMKIVKEAYPDHTQFEKNDPHYDPSSKEDNPKWSMVDVQFVRMMKRFISL 176

Query: 100 MAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
             +K   +        L SM L    RLSVQP+T +E+
Sbjct: 177 DELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEF 214


>gi|126452025|ref|YP_001065312.1| hypothetical protein BURPS1106A_1032 [Burkholderia pseudomallei
           1106a]
 gi|167844718|ref|ZP_02470226.1| hypothetical protein BpseB_05463 [Burkholderia pseudomallei B7210]
 gi|242317666|ref|ZP_04816682.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|126225667|gb|ABN89207.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126953063|gb|ABO28367.1| protein 3SC1 [Burkholderia pseudomallei]
 gi|242140905|gb|EES27307.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 153

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 75/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT               ++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWMLVDVRFVRKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEW 144


>gi|261855312|ref|YP_003262595.1| hypothetical protein Hneap_0697 [Halothiobacillus neapolitanus c2]
 gi|261835781|gb|ACX95548.1| protein of unknown function DUF55 [Halothiobacillus neapolitanus
           c2]
          Length = 155

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 81/155 (52%), Gaps = 18/155 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M +WL+K EP  +S     +K +V E W G+RNYQARN MR  M++GD  FFYHSN K  
Sbjct: 1   MNHWLMKCEPDVFSID-DLEKQKV-EGWYGIRNYQARNMMRDAMKIGDLVFFYHSNVKVP 58

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EVI+  YPDPT               ++  W  VD+  V      ++L  +K +
Sbjct: 59  GIVGIMEVISAPYPDPTQFDPKHRYFDPKSTPENPRWVQVDVQYVRHTKRNITLQELKED 118

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLS 139
             L  + L+   +RLS+ P++   +  +     L+
Sbjct: 119 ETLEDLPLVRRGNRLSIMPISAQSWTRILARENLT 153


>gi|134281102|ref|ZP_01767811.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|134247408|gb|EBA47493.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
          Length = 153

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 75/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT               ++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWVLVDVRFVRKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEW 144


>gi|17547122|ref|NP_520524.1| hypothetical protein RSc2403 [Ralstonia solanacearum GMI1000]
 gi|17429424|emb|CAD16110.1| hypothetical protein of unknown function duf589 [Ralstonia
           solanacearum GMI1000]
          Length = 168

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 79/141 (56%), Gaps = 23/141 (16%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+KSEP E S    Q +  V   WTGVRNYQARN MR +MR+GD   FYHS+  +  I
Sbjct: 17  YWLMKSEPDEASIDTLQTE--VTLPWTGVRNYQARNFMRDRMRIGDGVLFYHSSCPQPGI 74

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAV--CSMPCPVSLMAIKAN 105
            G+ EV + +YPDPT              +++  W  VD+  V  C++   + L  ++A 
Sbjct: 75  AGLAEVCSTSYPDPTQFDSKSPYYDPAAKQETPRWMLVDVRFVRKCAL---IDLPTLRAQ 131

Query: 106 PRLSSM-ILIVSSRLSVQPVT 125
             L+ M IL   +RLS+ PVT
Sbjct: 132 EPLAEMTILQRGNRLSITPVT 152


>gi|62204514|gb|AAH93074.1| Thymocyte nuclear protein 1 [Homo sapiens]
          Length = 225

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 81/159 (50%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T              E +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +K+  +        L +M+L    RLS+QP+T +E+
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEF 213


>gi|33861984|ref|NP_893545.1| hypothetical protein PMM1428 [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|33640352|emb|CAE19887.1| conserved hypothetical protein [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 153

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 70/140 (50%), Gaps = 17/140 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP  +S    +  G     W G+RNYQARN MR+M +GDK FFYHSN K   IV
Sbjct: 6   YWLMKSEPDAYSIDTLKKDGVT--LWDGIRNYQARNFMRRMSLGDKVFFYHSNCKPPGIV 63

Query: 62  GIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRL 108
           G  EVI     DPT  Q                W+CV +  +      +SL  +K     
Sbjct: 64  GFMEVIDLNIIDPTQFQKESKYYDPKSSQEEPRWDCVKVKYLFKANKFLSLTELKILFNE 123

Query: 109 SSMILIVS-SRLSVQPVTTD 127
             ++L+   +RLS+ P+  +
Sbjct: 124 EELLLVKKGNRLSIIPIKKE 143


>gi|7661804|ref|NP_054893.1| thymocyte nuclear protein 1 isoform 1 [Homo sapiens]
 gi|40806221|ref|NP_954995.1| thymocyte nuclear protein 1 isoform 1 [Homo sapiens]
 gi|83267861|ref|NP_001032382.1| thymocyte nuclear protein 1 isoform 1 [Homo sapiens]
 gi|74734762|sp|Q9P016|THYN1_HUMAN RecName: Full=Thymocyte nuclear protein 1; AltName: Full=Thymocyte
           protein Thy28
 gi|6841510|gb|AAF29108.1|AF161493_1 HSPC144 [Homo sapiens]
 gi|33150614|gb|AAP97185.1|AF087886_1 thymocyte protein Thy28kD [Homo sapiens]
 gi|119588232|gb|EAW67828.1| thymocyte nuclear protein 1, isoform CRA_a [Homo sapiens]
 gi|119588234|gb|EAW67830.1| thymocyte nuclear protein 1, isoform CRA_a [Homo sapiens]
 gi|119588235|gb|EAW67831.1| thymocyte nuclear protein 1, isoform CRA_a [Homo sapiens]
          Length = 225

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 81/159 (50%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T              E +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +K+  +        L +M+L    RLS+QP+T +E+
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEF 213


>gi|55637391|ref|XP_508871.1| PREDICTED: thymocyte nuclear protein 1 isoform 4 [Pan troglodytes]
 gi|332838238|ref|XP_003313468.1| PREDICTED: thymocyte nuclear protein 1 isoform 1 [Pan troglodytes]
          Length = 225

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 81/159 (50%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T              E +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +K+  +        L +M+L    RLS+QP+T +E+
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEF 213


>gi|307102702|gb|EFN50971.1| hypothetical protein CHLNCDRAFT_28531 [Chlorella variabilis]
          Length = 156

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 71/139 (51%), Gaps = 19/139 (13%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIF 64
           +KSEP  +S      K    E W GVR++QA+  M+ MRVGD+ FFYHSN K   IVGI 
Sbjct: 1   MKSEPDVFSLDDLAAKPAQTEHWDGVRSHQAKKVMQSMRVGDRAFFYHSNAKPPGIVGIV 60

Query: 65  EVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK-----ANP 106
           EV+   YPD T               +S  W  VD+  V  +   + L  +K     A+ 
Sbjct: 61  EVVREAYPDHTQFDRASQYYDAGSKAESPRWFMVDVRLVRRLARQIPLEELKSHGASASA 120

Query: 107 RLSSMILIVSSRLSVQPVT 125
            L+ M LI   RLSVQPVT
Sbjct: 121 PLADMALIKHGRLSVQPVT 139


>gi|12001950|gb|AAG43118.1|AF059619_1 My005 protein [Homo sapiens]
          Length = 225

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 81/159 (50%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T              E +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +K+  +        L +M+L    RLS+QP+T +E+
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEF 213


>gi|87306612|ref|ZP_01088759.1| hypothetical protein DSM3645_09772 [Blastopirellula marina DSM
           3645]
 gi|87290791|gb|EAQ82678.1| hypothetical protein DSM3645_09772 [Blastopirellula marina DSM
           3645]
          Length = 173

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 80/151 (52%), Gaps = 16/151 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL+K+EP  +S     ++ +    W+GVRNYQARN MR  M+VGD+ FFYHSN K   I
Sbjct: 17  YWLLKTEPESYSIDDLANEKKQTTFWSGVRNYQARNFMRDDMKVGDEVFFYHSNAKPPAI 76

Query: 61  VGIFEVITCTYPDPTA---------EQSS----CWECVDICAVCSMPCPVSLMAIKANPR 107
           VG  +++  +YPD T+         E+S+     W  VDI         +    +     
Sbjct: 77  VGTAKIVKESYPDHTSWDKKNHHFDEKSTPDAPRWFMVDIQLTEIFDEALGRDQLSGVAA 136

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
           L+ M L+   SRLSVQPV   E+  + ++ K
Sbjct: 137 LAEMELMRKGSRLSVQPVKKSEWDAILKLAK 167


>gi|134296640|ref|YP_001120375.1| hypothetical protein Bcep1808_2542 [Burkholderia vietnamiensis G4]
 gi|134139797|gb|ABO55540.1| protein of unknown function DUF55 [Burkholderia vietnamiensis G4]
          Length = 153

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLAHAPQRSLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT               ++  W  VD+  V      V L A++ +
Sbjct: 61  GIAGLAEVASAPYPDPTQFDPKSPYYDPKSTHETPRWLLVDVRFVKKSAL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEW 144


>gi|224105753|ref|XP_002313921.1| predicted protein [Populus trichocarpa]
 gi|222850329|gb|EEE87876.1| predicted protein [Populus trichocarpa]
          Length = 151

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 66/133 (49%), Gaps = 6/133 (4%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL+K+EP EWSW  Q   G +   W GV+N QA+ N++ M++ D  FFYHS      V 
Sbjct: 7   YWLLKTEPGEWSWDDQASNGGISN-WDGVKNKQAQKNLKAMKLNDLCFFYHSGSNARRVV 65

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
               +   + D   E       VD+ AV  M  P+ L  +K +  L    L    RLSV 
Sbjct: 66  GVVTVVREWYDEGGEG-----VVDVKAVGEMRRPLDLKELKGDEGLKGFQLFRQPRLSVV 120

Query: 123 PVTTDEYLEVCRM 135
           PV+ + +  VC +
Sbjct: 121 PVSKEVWERVCEL 133


>gi|254565929|ref|XP_002490075.1| hypothetical protein [Pichia pastoris GS115]
 gi|238029871|emb|CAY67794.1| hypothetical protein PAS_chr1-1_0502 [Pichia pastoris GS115]
 gi|328350478|emb|CCA36878.1| Thymocyte nuclear protein 1 [Pichia pastoris CBS 7435]
          Length = 213

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 79/164 (48%), Gaps = 35/164 (21%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG---------------EAWTGVRNYQARNNMRKMRVGD 47
           YWL+KSEP        +  GR G               E W GVRN++A+ NM  M  GD
Sbjct: 34  YWLIKSEP------HSRIDGRTGRDLKFSLEDLSLVDSEPWDGVRNHEAKRNMLDMSPGD 87

Query: 48  KGFFYHSN-KGREIVGIFEVITCTYPDPT---------AEQSS----CWECVDICAVCSM 93
              FYHSN     IVG+ EV+   +PD +         A +S+     W CVD+      
Sbjct: 88  VCLFYHSNCPTPGIVGLAEVVCYAHPDESQFDRASPYFASKSTRSNPHWWCVDVKFKRRF 147

Query: 94  PCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
              V+L ++KA+  L  M+L+  SRLSV PVT+ EY  +  + K
Sbjct: 148 RAKVTLRSLKADKNLQHMVLVRRSRLSVTPVTSSEYSYIIELEK 191


>gi|332710421|ref|ZP_08430368.1| hypothetical protein LYNGBM3L_50950 [Lyngbya majuscula 3L]
 gi|332350752|gb|EGJ30345.1| hypothetical protein LYNGBM3L_50950 [Lyngbya majuscula 3L]
          Length = 157

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 80/158 (50%), Gaps = 21/158 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M YWL+KSEP  +S    + +G+    W GVRNYQARN +R+M+ GD  FFYHSN K   
Sbjct: 1   MNYWLMKSEPQVYSITDLEKEGKT--IWDGVRNYQARNFLREMKEGDLAFFYHSNTKPPG 58

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ E+I     DPT             + +S  W  V +  V   P  + L  +K   
Sbjct: 59  IVGLMEIIKSEVVDPTQFDQTSRYYDPKSSVESPRWHTVLVQFVEVFPHFLELSTLKQE- 117

Query: 107 RLSSMILIVS---SRLSVQPVTTDEYLEVCRMGKLSNP 141
             S   L V+   +RLSV PV+     ++  + + +NP
Sbjct: 118 -FSDQELWVTRRGNRLSVMPVSQAVAQKILEISQATNP 154


>gi|104784226|ref|YP_610724.1| hypothetical protein PSEEN5321 [Pseudomonas entomophila L48]
 gi|95113213|emb|CAK17941.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 144

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 74/146 (50%), Gaps = 19/146 (13%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGI 63
           +KSEP E S +      R+GEA W GVRNYQARN +R M VGD+  FYHS      + GI
Sbjct: 1   MKSEPDELSIEAL---ARLGEARWDGVRNYQARNFLRAMSVGDEFLFYHSRCPQPGVAGI 57

Query: 64  FEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRLSS 110
             +    YPDPTA              + + W  VD+  V +    + L  +K    L +
Sbjct: 58  ARITAAAYPDPTALDPESHYFDAKASTEKNPWSAVDVAHVQTFRRVLGLGLLKQQAALEA 117

Query: 111 MILIV-SSRLSVQPVTTDEYLEVCRM 135
           + L+   +RLSV PVT D++  +  +
Sbjct: 118 LPLVQKGTRLSVMPVTPDQWAAILAL 143


>gi|88812442|ref|ZP_01127691.1| hypothetical protein NB231_13166 [Nitrococcus mobilis Nb-231]
 gi|88790228|gb|EAR21346.1| hypothetical protein NB231_13166 [Nitrococcus mobilis Nb-231]
          Length = 152

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M+YW++KSEPS +       +    + W GVRNYQARN +R +MR GD    YHSN    
Sbjct: 1   MSYWVMKSEPSVYGIDDLAAQPSQTDHWEGVRNYQARNMLRDQMRPGDLALLYHSNCPQP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            +VGI E++   YPD TA                  W  VD+     +   + L  +KAN
Sbjct: 61  GVVGIMEIVRAGYPDHTAFDPESKYFDPKSDPDRPRWYMVDVRFKRRLARTIPLTELKAN 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           P L+   LI   +RLS+ PV+ + +  +  M
Sbjct: 121 PALAETPLIRRGNRLSIMPVSAEHWQAILDM 151


>gi|221133890|ref|ZP_03560195.1| hypothetical protein GHTCC_03099 [Glaciecola sp. HTCC2999]
          Length = 154

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 70/154 (45%), Gaps = 14/154 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M YWLVKSEP E          +    W GVRN+QARN +++M +GD    YHS+ +   
Sbjct: 1   MQYWLVKSEPDECGIDDFLHSPKTSIPWDGVRNFQARNFLKQMGLGDAVILYHSSCRHIG 60

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           I G  +V    Y DP   Q                W  VD+         V L  +K  P
Sbjct: 61  ISGQLQVTRTAYDDPLQFQLDSPYFDAKSTLERPRWVAVDMVYTHKFTTLVPLATLKLQP 120

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
            LS   L+   RLSV P+T  E+  + ++G L++
Sbjct: 121 ALSECYLLTHKRLSVMPLTFTEFTLMQKLGGLTH 154


>gi|332992841|gb|AEF02896.1| hypothetical protein ambt_06805 [Alteromonas sp. SN2]
          Length = 155

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 78/155 (50%), Gaps = 16/155 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S      +    E W GVRNYQARN +R K+ +GD+ F YHS+ K  
Sbjct: 1   MAYWLFKTEPDAFSIDDLNSRPDQTEPWDGVRNYQARNFLRDKVAIGDQVFIYHSSCKIV 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV+   YPD T               ++  W  VD+  V      + L  IKA 
Sbjct: 61  GIAGVAEVVKAGYPDETQFNPESNYYDPKSTRENPRWFRVDVKFVEKFESVLPLSVIKAM 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLS 139
           P ++ + L+    RLS+ PV   E+ ++    K++
Sbjct: 121 PNITEIGLVKKGGRLSIMPVEETEWQQLYTTAKMN 155


>gi|304309965|ref|YP_003809563.1| protein of unknown function DUF589 [gamma proteobacterium HdN1]
 gi|301795698|emb|CBL43897.1| protein of unknown function DUF589 [gamma proteobacterium HdN1]
          Length = 152

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 78/151 (51%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYW+ K+EP+ +S    + + + GE W GVRNYQARN +R   RVGD  F YHSN K  
Sbjct: 1   MAYWVFKTEPNVFSIDDLKARDKQGEIWDGVRNYQARNMLRDDTRVGDLVFVYHSNCKIP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  +I     DPT             +  +  W  V +     +  P++L  +K +
Sbjct: 61  GIYGIGRIIETKVVDPTQFLPESHYFDLKSSPDAPRWFTVKLAYERHLERPITLTELKDH 120

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           P L  M L+   +RLS+ PV+  ++  + R+
Sbjct: 121 PELQEMQLVKRGNRLSILPVSNAQWAIMSRL 151


>gi|224011100|ref|XP_002294507.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220970002|gb|EED88341.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 185

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 81/159 (50%), Gaps = 27/159 (16%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           + Y+L+KSEPS++S   +Q D+    + W G+RNYQARN +R M+V D+ FFYHS   + 
Sbjct: 22  LQYFLLKSEPSDYSISDLQNDQT---DEWNGIRNYQARNYLRSMKVNDRAFFYHSKASKP 78

Query: 60  ----IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAI 102
               IVG   +     PD TA  +               W  V +    + P  +SL  +
Sbjct: 79  SLTGIVGTVRIARTAQPDMTAFDTKSEYYDAKCTKEDCKWSSVLMEYEQTFPVVLSLKEL 138

Query: 103 K----ANPR--LSSMILIVSSRLSVQPVTTDEYLEVCRM 135
           K      P   ++ M L+  SRLSV P+T +E+ EV R+
Sbjct: 139 KDIAAKEPEGIIAGMGLLKQSRLSVVPLTFEEWGEVMRL 177


>gi|315125258|ref|YP_004067261.1| hypothetical protein PSM_A0152 [Pseudoalteromonas sp. SM9913]
 gi|315013771|gb|ADT67109.1| conserved hypothetical protein [Pseudoalteromonas sp. SM9913]
          Length = 151

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 73/151 (48%), Gaps = 15/151 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MA+WL K+EP  +S    +        W GVRNYQARN +R  ++ GD    YHS+ K  
Sbjct: 1   MAFWLFKTEPDAFSIDDLKYAPEQTTLWEGVRNYQARNFIRDDVKQGDLVMIYHSSCKQV 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            + GI  V    YPDPT    S              W  V++     +   VSL AIKAN
Sbjct: 61  GVAGIGIVTKAAYPDPTQFDLSSDYYDAKATVETPRWFVVEVTYHSHLSSIVSLQAIKAN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
             ++ + L    RLSV PVT +++ E+  M 
Sbjct: 121 ESVTDIALKKGGRLSVMPVTENDWNEILNMA 151


>gi|187929741|ref|YP_001900228.1| hypothetical protein Rpic_2670 [Ralstonia pickettii 12J]
 gi|309781544|ref|ZP_07676279.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
 gi|187726631|gb|ACD27796.1| protein of unknown function DUF55 [Ralstonia pickettii 12J]
 gi|308919649|gb|EFP65311.1| conserved hypothetical protein [Ralstonia sp. 5_7_47FAA]
          Length = 156

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 79/141 (56%), Gaps = 23/141 (16%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+KSEP E S      +G +   WTGVRNYQARN MR +MR+GD   FYHS+  +  I
Sbjct: 5   YWLMKSEPDEASIDTLHAEGTL--PWTGVRNYQARNFMRDRMRIGDGVLFYHSSCPQPGI 62

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAV--CSMPCPVSLMAIKAN 105
            G+ EV + +YPDPT               ++  W  VD+  V  C++   + L  ++A 
Sbjct: 63  AGLAEVCSTSYPDPTQFDAKSHYHDPASKPEAPRWMLVDVKFVRKCAL---IDLPTLRAQ 119

Query: 106 PRLSSM-ILIVSSRLSVQPVT 125
            +L+ M +L   +RLS+ P+T
Sbjct: 120 EQLADMTVLQRGNRLSITPIT 140


>gi|325927882|ref|ZP_08189106.1| hypothetical protein XPE_3146 [Xanthomonas perforans 91-118]
 gi|325541722|gb|EGD13240.1| hypothetical protein XPE_3146 [Xanthomonas perforans 91-118]
          Length = 158

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 73/143 (51%), Gaps = 22/143 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  RVG E W GVRNYQARN MR  M+VGD  FFYHSN K   
Sbjct: 7   YWLMKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMQVGDGVFFYHSNCKVPG 63

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIK--A 104
           IVGI +V +  YPD T    S              W  VD+     +   +SL  IK  A
Sbjct: 64  IVGIAKVASAAYPDDTQFDPSSDYHDPKSTREDPRWMLVDVAFERKLARTISLDEIKQEA 123

Query: 105 NPRLSSMILIV-SSRLSVQPVTT 126
           +       LI   +RLS+ PVT 
Sbjct: 124 DALGEGFALIARGNRLSILPVTA 146


>gi|87301214|ref|ZP_01084055.1| hypothetical protein WH5701_15051 [Synechococcus sp. WH 5701]
 gi|87284182|gb|EAQ76135.1| hypothetical protein WH5701_15051 [Synechococcus sp. WH 5701]
          Length = 153

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 80/156 (51%), Gaps = 20/156 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP  +     + +G     W G+RNYQARN MR M +GD+ FFYHSN K   
Sbjct: 1   MAYWLMKSEPDVYGISHLEREGNT--LWDGIRNYQARNFMRSMAIGDQAFFYHSNTKPPG 58

Query: 60  IVGIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I+G+ EVI     DP             +  ++  W+CV +    + P  +SL  +++  
Sbjct: 59  IIGLMEVIETGLIDPSQFDPASKYFDAASTPEAPRWDCVRLAYRRTYPQLLSLEELRSAF 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLSNP 141
               + ++   +RLS+ PV     L   R+ KL +P
Sbjct: 119 DEQELPVVRRGNRLSILPVPEATAL---RLLKLLDP 151


>gi|119483384|ref|ZP_01618798.1| hypothetical protein L8106_05006 [Lyngbya sp. PCC 8106]
 gi|119458151|gb|EAW39273.1| hypothetical protein L8106_05006 [Lyngbya sp. PCC 8106]
          Length = 154

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 75/140 (53%), Gaps = 19/140 (13%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP+ +S  KMQQ+K  +   W GVRNYQARN +R+M  GD  FFYHSN K  
Sbjct: 1   MNYWLMKSEPNVYSIEKMQQEKSCI---WDGVRNYQARNFLRRMARGDLVFFYHSNTKYP 57

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            I G+ +VI     DPT   ++              W+ V +  V   P  ++L  +K  
Sbjct: 58  GITGLVKVIETEIIDPTQFDTNSQYYDPKSTSENPRWQTVRVEFVEQFPSVITLAQLKQE 117

Query: 106 PRLSSMILI-VSSRLSVQPV 124
                ++L+   +RLSV P+
Sbjct: 118 FTPDDLLLVRRGNRLSVMPI 137


>gi|193222249|emb|CAL60905.2| conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 154

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 79/156 (50%), Gaps = 19/156 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M YWL+KSEP E S            AWTGVRNYQARN MR  M+ GD   FYHS+    
Sbjct: 1   MRYWLMKSEPGEVSIDDALAAPNQTVAWTGVRNYQARNFMRDAMQPGDGVLFYHSSCAEP 60

Query: 60  -IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPD T               ++  W  VD+  +      +SL  ++  
Sbjct: 61  GIAGLAEVASTPYPDETQFDPASHYFDPKATRETPRWMLVDV-RIRKKTRLLSLAELRTR 119

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKLSN 140
           P L+ M+++   SRLS+ PVT  E+  +C+  KL N
Sbjct: 120 PELADMVVLQKGSRLSITPVTAQEWQFICK--KLLN 153


>gi|330447199|ref|ZP_08310849.1| putative uncharacterized protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491390|dbj|GAA05346.1| putative uncharacterized protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 152

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/151 (39%), Positives = 83/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   K      W GVRNYQARN +R ++++GD+ F YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IDTLKQMKVSPWEGVRNYQARNMLRDEVKLGDQIFIYHSSCKDV 58

Query: 59  EIVGIFEVITCTYP------------DPTAEQSSC-WECVDICAVCSMPCPVSLMAIKAN 105
            +VGI  V   +YP            DP ++ ++  W  VDI     +   VSL  +KAN
Sbjct: 59  GVVGIATVTKASYPDHFQFDPESPYFDPKSDPNNPRWFMVDIEYQRHLRL-VSLKRMKAN 117

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRM 135
           P L+ M L+   SRLSV PVT  ++ E+  M
Sbjct: 118 PALAEMPLVKKGSRLSVMPVTEAQWQEILTM 148


>gi|159488735|ref|XP_001702358.1| hypothetical protein CHLREDRAFT_185829 [Chlamydomonas reinhardtii]
 gi|158271152|gb|EDO96978.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 289

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 85/154 (55%), Gaps = 19/154 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           Y+L+KSEP E+S    + K      W GVRN QARN MR MR+GD+  FYHS+ K    V
Sbjct: 130 YYLMKSEPEEFSLDDLEAKPESIGHWEGVRNAQARNIMRGMRLGDEALFYHSSCKVPAAV 189

Query: 62  GIFEVITCTYPDPTA---------EQSS----CWECVDICAVCSMPCPVSLMAI-----K 103
           G+  V+   YPD  A         E+S+     W  VD+  V  +  PV+L  +     K
Sbjct: 190 GVVRVVREAYPDHFAFDKKSKYYDERSTPDNPKWWMVDVQLVRRLARPVTLAELRAEGAK 249

Query: 104 ANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           A   ++SM+LI  SRLSVQPVT +++  V ++ K
Sbjct: 250 AGSPVASMVLINKSRLSVQPVTEEQWNVVMQLEK 283


>gi|157414028|ref|YP_001484894.1| hypothetical protein P9215_16951 [Prochlorococcus marinus str. MIT
           9215]
 gi|157388603|gb|ABV51308.1| Conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9215]
          Length = 154

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 71/141 (50%), Gaps = 17/141 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREI 60
           +YWL+KSEP  +S    ++ G     W G+RNYQARN MRKM  GD+ FFYHSN K   I
Sbjct: 7   SYWLMKSEPDAYSIDTLKNDGVT--LWDGIRNYQARNFMRKMNKGDQVFFYHSNCKPPGI 64

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ EVI     DPT                   W+CV +         +SL  +K    
Sbjct: 65  VGLMEVIDLNIVDPTQFDKDSKYFDPKSKPDNPRWDCVKVKYKSKSEKILSLHELKFLFN 124

Query: 108 LSSMILIVS-SRLSVQPVTTD 127
            + ++++   +RLS+ PV  D
Sbjct: 125 EAELLVVKKGNRLSILPVRND 145


>gi|313679782|ref|YP_004057521.1| hypothetical protein Ocepr_0891 [Oceanithermus profundus DSM 14977]
 gi|313152497|gb|ADR36348.1| protein of unknown function DUF55 [Oceanithermus profundus DSM
           14977]
          Length = 153

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 71/139 (51%), Gaps = 17/139 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M YWL+KSEP  +S    +  GR  E W GVRNYQARN +R+M+ GD  FFYHSN K   
Sbjct: 1   MRYWLMKSEPEAYSIDDLERDGR--EIWDGVRNYQARNYLREMKEGDLAFFYHSNAKPPG 58

Query: 60  IVGIFEVITCTYPDPTA-EQSSC------------WECVDICAVCSMPCPVSLMAIKANP 106
           +VG+  ++     DPT  +  SC            W+ V++  V   P  V L  ++   
Sbjct: 59  VVGLMRIVKSGVVDPTQFDPESCYYDPKSTPENPRWQTVEVEFVEKFPRMVPLAELRERF 118

Query: 107 RLSSMILIVSS-RLSVQPV 124
               + L+    RLSV PV
Sbjct: 119 TAEELPLLKRGFRLSVMPV 137


>gi|126696956|ref|YP_001091842.1| hypothetical protein P9301_16181 [Prochlorococcus marinus str. MIT
           9301]
 gi|126543999|gb|ABO18241.1| Uncharacterized conserved protein [Prochlorococcus marinus str. MIT
           9301]
          Length = 152

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 72/140 (51%), Gaps = 17/140 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP  +S    ++ G     W G+RNYQARN MRKM  GDK FFYHSN K   IV
Sbjct: 6   YWLMKSEPDAYSIDTLKNDGVT--LWDGIRNYQARNFMRKMNKGDKVFFYHSNCKPPGIV 63

Query: 62  GIFEVITCTYPDPTA-EQSSC------------WECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ EVI     DPT  +Q S             W+CV +         +SL  +K     
Sbjct: 64  GLMEVIDLNIVDPTQFDQDSKYFDPKSKPDNPRWDCVKVEYKFKSDKILSLPELKILFNE 123

Query: 109 SSMILIVS-SRLSVQPVTTD 127
             ++++   +RLS+ PV  D
Sbjct: 124 DELLVVKKGNRLSILPVRND 143


>gi|123966839|ref|YP_001011920.1| hypothetical protein P9515_16061 [Prochlorococcus marinus str. MIT
           9515]
 gi|123201205|gb|ABM72813.1| Uncharacterized conserved protein [Prochlorococcus marinus str. MIT
           9515]
          Length = 155

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 69/139 (49%), Gaps = 17/139 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP  +S    +  G     W G+RNYQARN MR+M +GDK FFYHSN K   I 
Sbjct: 6   YWLMKSEPDAYSIDTLKRDGVT--LWDGIRNYQARNFMRRMMIGDKVFFYHSNCKPPGIA 63

Query: 62  GIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRL 108
           G  EV+     DPT  Q                W+CV +  +      +SL  +K     
Sbjct: 64  GFMEVVDLNIIDPTQFQKESGYYDQKSSKENPRWDCVKVKYLFKADKFLSLPELKILFNE 123

Query: 109 SSMILIVS-SRLSVQPVTT 126
             ++L+   +RLS+ PV T
Sbjct: 124 EELLLVKKGNRLSIIPVET 142


>gi|167737566|ref|ZP_02410340.1| hypothetical protein Bpse14_05845 [Burkholderia pseudomallei 14]
 gi|254298248|ref|ZP_04965700.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157808221|gb|EDO85391.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
          Length = 153

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSHSPYHDPKSTREAPRWMLVDVRFVRKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEW 144


>gi|332304428|ref|YP_004432279.1| hypothetical protein Glaag_0042 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332171757|gb|AEE21011.1| protein of unknown function DUF55 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 153

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 74/145 (51%), Gaps = 16/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL K+EP  +S      +    E W G+RNYQARN +R +++ GDK F YHS+ K  
Sbjct: 1   MQYWLFKTEPDAFSIDDLAARPNQTEHWDGIRNYQARNFLRDQVKQGDKVFIYHSSCKEV 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV+   YPD T             + ++  W  VD+  +   P  ++L  IK  
Sbjct: 61  GIAGLAEVVKEAYPDHTQFDPESHYYDPKSSPENPRWVMVDVKFIEKFPDVLALKKIKTM 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEY 129
           P +S + L+    RLS+ PV   E+
Sbjct: 121 PEISEVGLVKKGHRLSIMPVNEQEF 145


>gi|167917988|ref|ZP_02505079.1| hypothetical protein BpseBC_05493 [Burkholderia pseudomallei
           BCC215]
          Length = 153

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 75/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT               ++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWMLVDVRFVRKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEW 144


>gi|260434320|ref|ZP_05788290.1| conserved hypothetical protein [Synechococcus sp. WH 8109]
 gi|260412194|gb|EEX05490.1| conserved hypothetical protein [Synechococcus sp. WH 8109]
          Length = 153

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 79/154 (51%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MA+WL+KSEP  +     + +G     W G+RNYQARN MR M VGD+ FFYHSN K   
Sbjct: 1   MAFWLMKSEPDAYGIDDLRREGTT--LWDGIRNYQARNFMRSMDVGDQAFFYHSNCKPPG 58

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I+G+ EV+     DPT             + +   W+C  +  +      +SL  ++   
Sbjct: 59  IIGLMEVMETGLVDPTQFDPTAKYYDPKSSPEKPRWDCARLRFLGEFDALLSLDQLRELY 118

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLE-VCRMGKL 138
               + +I   +RLS+ PV TD   + + R+G+L
Sbjct: 119 SEEQLPVIKRGNRLSILPVPTDTANDLLARLGQL 152


>gi|167823154|ref|ZP_02454625.1| hypothetical protein Bpseu9_05723 [Burkholderia pseudomallei 9]
 gi|167893253|ref|ZP_02480655.1| hypothetical protein Bpse7_05775 [Burkholderia pseudomallei 7894]
 gi|167909950|ref|ZP_02497041.1| hypothetical protein Bpse112_05621 [Burkholderia pseudomallei 112]
 gi|226194431|ref|ZP_03790029.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|254190829|ref|ZP_04897336.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254261399|ref|ZP_04952453.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|157938504|gb|EDO94174.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|225933516|gb|EEH29505.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|254220088|gb|EET09472.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 153

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSHSPYHDPKSTREAPRWVLVDVRFVRKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEW 144


>gi|78049083|ref|YP_365258.1| hypothetical protein XCV3527 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78037513|emb|CAJ25258.1| conserved hypothetical protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 181

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 75/146 (51%), Gaps = 22/146 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  RVG E W GVRNYQARN MR  M+VGD  FFYHSN K   
Sbjct: 30  YWLMKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMQVGDGVFFYHSNCKVPG 86

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIK--A 104
           IVGI +V +  YPD T    S              W  VD+     +   +SL  IK  A
Sbjct: 87  IVGIAKVASAAYPDDTQFDPSSDYHDPKSTREDPRWMLVDVAFERKLARTISLDEIKQQA 146

Query: 105 NPRLSSMILIV-SSRLSVQPVTTDEY 129
           +       LI   +RLS+ PVT  ++
Sbjct: 147 DALGEGFALIARGNRLSILPVTAAQW 172


>gi|289207966|ref|YP_003460032.1| hypothetical protein TK90_0781 [Thioalkalivibrio sp. K90mix]
 gi|288943597|gb|ADC71296.1| protein of unknown function DUF55 [Thioalkalivibrio sp. K90mix]
          Length = 154

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 78/146 (53%), Gaps = 20/146 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KG 57
           MAYWL+KSEP E+S     D  RVG E W G+RNYQ RN MR +M+ GD  FFYHSN K 
Sbjct: 1   MAYWLMKSEPDEFSIA---DLERVGVEPWDGIRNYQVRNMMRDEMKKGDLAFFYHSNAKP 57

Query: 58  REIVGIFEVITCTYP------------DPTAEQSSC-WECVDICAVCSMPCPVSLMAIKA 104
             IVGI  +    YP            DP ++  +  W  VD+         ++L  +K 
Sbjct: 58  PGIVGILRIEKEAYPDSCAFDPEDPHYDPKSDPDNPRWLRVDVAFEEKFGDIITLDWLKQ 117

Query: 105 NPRLSSMILI-VSSRLSVQPVTTDEY 129
            P+L    L+   +RLSV P+T +++
Sbjct: 118 QPQLEDCPLVRRGNRLSVMPITQEQW 143


>gi|76809962|ref|YP_332595.1| hypothetical protein BURPS1710b_1184 [Burkholderia pseudomallei
           1710b]
 gi|76579415|gb|ABA48890.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b]
          Length = 170

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 18  MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 77

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 78  GIAGLARVSSTPYPDPTQFDSHSPYHDPKSTREAPRWVLVDVRFVRKSPL-VPLAALREH 136

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 137 EALANMRVLAKGNRLSITPVTPNEW 161


>gi|319941708|ref|ZP_08016030.1| 3SC1 protein [Sutterella wadsworthensis 3_1_45B]
 gi|319804641|gb|EFW01508.1| 3SC1 protein [Sutterella wadsworthensis 3_1_45B]
          Length = 170

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 80/149 (53%), Gaps = 23/149 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHS---NKGR 58
           +WL+K+EPSE S            +W GVRNYQARN MR +M+VGD   FYHS   N G 
Sbjct: 17  FWLMKTEPSECSIDDAFAATNHAVSWFGVRNYQARNFMRDQMKVGDAVLFYHSSCPNPG- 75

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPC-PVSLMAIKA 104
            IVGI  + +  YPD              + + +  W  VD+ A+   P  PVS++  +A
Sbjct: 76  -IVGIARIASKPYPDTCQFDEKSDYFDPKSTKDAPRWVAVDVEALVKFPVIPVSIL--RA 132

Query: 105 NPRLSSMILI-VSSRLSVQPVTTDEYLEV 132
            P L+ M+++   +RLS+ PV   ++L +
Sbjct: 133 QPELADMLILRRGNRLSITPVEKKDFLFI 161


>gi|254442038|ref|ZP_05055514.1| conserved hypothetical protein [Verrucomicrobiae bacterium DG1235]
 gi|198256346|gb|EDY80654.1| conserved hypothetical protein [Verrucomicrobiae bacterium DG1235]
          Length = 168

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 81/160 (50%), Gaps = 20/160 (12%)

Query: 3   YWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGREI 60
           YWL+KSEP  + +  + + KG+  E W G+RNYQARN MR  M+ GD   FYHSN G ++
Sbjct: 5   YWLIKSEPDVFGFDDLAKCKGQT-EHWDGIRNYQARNFMRDSMQKGDIAIFYHSNAGPKV 63

Query: 61  --VGIFEVIT-CTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKA 104
             VG+  V +   YPD T             ++ +  W  V      +    V+L  +K 
Sbjct: 64  GAVGLASVASEKAYPDHTQFDPKSNYYDAKSSKDNPRWLMVSFKWKAAFKRLVTLKELKE 123

Query: 105 NPRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKLSNPPL 143
              L  M+++    RLS+QPV    +  VC+MG L+   L
Sbjct: 124 TAELEDMLVVQRGQRLSIQPVEKRHFTYVCKMGGLTAKEL 163


>gi|53718615|ref|YP_107601.1| hypothetical protein BPSL0973 [Burkholderia pseudomallei K96243]
 gi|67639837|ref|ZP_00438668.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|121601022|ref|YP_993639.1| hypothetical protein BMASAVP1_A2330 [Burkholderia mallei SAVP1]
 gi|124385947|ref|YP_001028900.1| hypothetical protein BMA10229_A2956 [Burkholderia mallei NCTC
           10229]
 gi|126451040|ref|YP_001081186.1| hypothetical protein BMA10247_1642 [Burkholderia mallei NCTC 10247]
 gi|167004005|ref|ZP_02269782.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|167718536|ref|ZP_02401772.1| hypothetical protein BpseD_05907 [Burkholderia pseudomallei DM98]
 gi|167814699|ref|ZP_02446379.1| hypothetical protein Bpse9_06127 [Burkholderia pseudomallei 91]
 gi|167901711|ref|ZP_02488916.1| hypothetical protein BpseN_05490 [Burkholderia pseudomallei NCTC
           13177]
 gi|217420265|ref|ZP_03451771.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|254178650|ref|ZP_04885305.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254199360|ref|ZP_04905726.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254205674|ref|ZP_04912026.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|254357833|ref|ZP_04974106.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|52209029|emb|CAH34969.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|121229832|gb|ABM52350.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124293967|gb|ABN03236.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126243910|gb|ABO07003.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|147748956|gb|EDK56030.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147753117|gb|EDK60182.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|148026960|gb|EDK84981.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|160699689|gb|EDP89659.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|217397569|gb|EEC37585.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|238520445|gb|EEP83905.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|243060563|gb|EES42749.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
          Length = 153

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 75/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT               ++  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWVLVDVRFVRKSPL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEW 144


>gi|58580751|ref|YP_199767.1| hypothetical protein XOO1128 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188578277|ref|YP_001915206.1| hypothetical protein PXO_02383 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|58425345|gb|AAW74382.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188522729|gb|ACD60674.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 156

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 72/143 (50%), Gaps = 22/143 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  RVG E W GVRNYQARN MR  M VGD  FFYHSN K   
Sbjct: 7   YWLMKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMHVGDDVFFYHSNCKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK--A 104
           IVG+ +V +  YPD T                   W  VD+     +   +SL AIK  A
Sbjct: 64  IVGLAKVASAAYPDDTQFDPKSDYYDPKSTRDDPRWMLVDVAFERKLTRTISLDAIKQQA 123

Query: 105 NPRLSSMILIV-SSRLSVQPVTT 126
           +       LI   +RLS+ PVT 
Sbjct: 124 DALGEGFPLIARGNRLSILPVTA 146


>gi|238028363|ref|YP_002912594.1| hypothetical protein bglu_1g28240 [Burkholderia glumae BGR1]
 gi|237877557|gb|ACR29890.1| Hypothetical protein bglu_1g28240 [Burkholderia glumae BGR1]
          Length = 153

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  MRVGD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLAAAPQRTLPWTGVRNYQARNFMRDTMRVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT              + +  W  VD+  V      V L A++ +
Sbjct: 61  GIAGLAEVASTPYPDPTQFDADSPYYDPKSKQDAPRWVLVDVRFVKKTAL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DALAEMRVLAKGNRLSITPVTRAEW 144


>gi|254526986|ref|ZP_05139038.1| tymocyte protein cThy28kD [Prochlorococcus marinus str. MIT 9202]
 gi|221538410|gb|EEE40863.1| tymocyte protein cThy28kD [Prochlorococcus marinus str. MIT 9202]
          Length = 152

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 70/140 (50%), Gaps = 17/140 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP  +S    ++ G     W G+RNYQARN MRKM  GD+ FFYHSN K   IV
Sbjct: 6   YWLMKSEPDAYSIDTLKNDGVT--LWDGIRNYQARNFMRKMNKGDQVFFYHSNCKPPGIV 63

Query: 62  GIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ EVI     DPT                   W+CV +         +SL  +K     
Sbjct: 64  GLMEVIDLNIVDPTQFDKDSKYFDPKSKPDNPRWDCVKVKYKSKSEKILSLHELKFLFNE 123

Query: 109 SSMILIVS-SRLSVQPVTTD 127
           + ++++   +RLS+ PV  D
Sbjct: 124 AELLVVKKGNRLSILPVRND 143


>gi|289662138|ref|ZP_06483719.1| hypothetical protein XcampvN_03308 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 156

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 73/143 (51%), Gaps = 22/143 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  RVG E W GVRNYQARN MR  M VGD  FFYHSN K   
Sbjct: 7   YWLMKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMHVGDSVFFYHSNCKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK--A 104
           IVGI +V +  YPD T             + +   W  VD+     +   +SL  IK  A
Sbjct: 64  IVGIAKVASAAYPDDTQFDPKSDYHDPKSSREDPRWMLVDVAFERKLTRTISLDEIKQQA 123

Query: 105 NPRLSSMILIV-SSRLSVQPVTT 126
           +       LI   +RLS+ PVT 
Sbjct: 124 DALGEGFPLIARGNRLSILPVTA 146


>gi|24216517|ref|NP_713998.1| hypothetical protein LA_3818 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45656332|ref|YP_000418.1| hypothetical protein LIC10433 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24197826|gb|AAN51016.1|AE011536_11 conserved hypothetical protein [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45599566|gb|AAS69055.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 156

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 71/145 (48%), Gaps = 16/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKM-RVGDKGFFYHSNKG-R 58
           M YWL K+EP  +S     +       W GVRNYQARN +R + + GD   FYHS     
Sbjct: 1   MNYWLFKTEPDVFSIDDLYNSPSKTAPWEGVRNYQARNYLRDLVQKGDLVLFYHSRANPL 60

Query: 59  EIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI EV+   YPD  A              +S  W  VDI        PV+   +K +
Sbjct: 61  SVVGIAEVVKPGYPDHFAFDPSHKYFDPKSKVESPTWFMVDIKFKKKFSIPVTTEEMKKH 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEY 129
             L +MIL+   SRLS+QPV+  E+
Sbjct: 121 KPLKNMILLKKGSRLSIQPVSATEF 145


>gi|118594107|ref|ZP_01551454.1| hypothetical protein MB2181_00525 [Methylophilales bacterium
           HTCC2181]
 gi|118439885|gb|EAV46512.1| hypothetical protein MB2181_00525 [Methylophilales bacterium
           HTCC2181]
          Length = 154

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 75/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP+++S    +        W G+RNYQARN MR  M +GD  FFYHSN K  
Sbjct: 1   MRYWLMKSEPTDFSIDDLEKAPNQSIDWYGIRNYQARNFMRDTMELGDLAFFYHSNCKVP 60

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ +V    YPD              ++  +  W  VD+  V  +P  VSL  +K  
Sbjct: 61  GIVGVMKVSQLAYPDKLQFIKGHKYFDPKSSPDNPRWVNVDVQFVKRLPL-VSLQELKTY 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L  M IL   +RLS+ P++  E+
Sbjct: 120 SELGEMKILQRGNRLSITPLSKYEW 144


>gi|281337333|gb|EFB12917.1| hypothetical protein PANDA_005058 [Ailuropoda melanoleuca]
          Length = 225

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 78/158 (49%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP          ++S +  + + +    W GVRNYQARN +R M++  + FFYH
Sbjct: 56  YWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEQEAFFYH 115

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   I G+ +++   YPD T              E +  W  VD+  V  M   ++L
Sbjct: 116 SNCKEPGIAGLVKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRYITL 175

Query: 100 MAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
             +K + +        L +M L    RLSVQP+T +E+
Sbjct: 176 AELKTHHQAHKTTGGPLKNMALFTRQRLSVQPLTPEEF 213


>gi|325917034|ref|ZP_08179273.1| hypothetical protein XVE_3253 [Xanthomonas vesicatoria ATCC 35937]
 gi|325536785|gb|EGD08542.1| hypothetical protein XVE_3253 [Xanthomonas vesicatoria ATCC 35937]
          Length = 156

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 75/146 (51%), Gaps = 22/146 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  RVG E W GVRNYQARN MR  M VGD  FFYHSN K   
Sbjct: 7   YWLMKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMHVGDGVFFYHSNCKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK--A 104
           IVGI +V +  YPD T             + +   W  VD+     +   +SL  IK  A
Sbjct: 64  IVGIAKVASAAYPDDTQFDPKSDYHDPKASREDPRWMLVDVAFERKLTRTISLDEIKQHA 123

Query: 105 NPRLSSMILIV-SSRLSVQPVTTDEY 129
           +       LI   +RLS+ PVT  ++
Sbjct: 124 DALGEGFPLIARGNRLSILPVTAAQW 149


>gi|116071268|ref|ZP_01468537.1| hypothetical protein BL107_16520 [Synechococcus sp. BL107]
 gi|116066673|gb|EAU72430.1| hypothetical protein BL107_16520 [Synechococcus sp. BL107]
          Length = 156

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 81/155 (52%), Gaps = 20/155 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           +A+WL+KSEP  +     + +G     W G+RNYQARN MR M VGD+ FFYHSN K   
Sbjct: 4   VAFWLMKSEPDAYGIDDLRREGST--LWDGIRNYQARNFMRSMSVGDQAFFYHSNCKPPG 61

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           I+G+ EV+     DPT   S+              W+C  +  +      +SL  ++A+ 
Sbjct: 62  IIGLMEVVETQLVDPTQFDSAAKYFDPKSNPDQPRWDCARLRFLGKFDELLSLDQLRASY 121

Query: 107 RLSSMILIV-SSRLSVQPV--TTDEYLEVCRMGKL 138
               + +I   +RLS+ PV  TT E L + R+G L
Sbjct: 122 NEEQLPVIKRGNRLSILPVPTTTAEDL-LDRLGPL 155


>gi|241766554|ref|ZP_04764414.1| protein of unknown function DUF55 [Acidovorax delafieldii 2AN]
 gi|241363208|gb|EER58786.1| protein of unknown function DUF55 [Acidovorax delafieldii 2AN]
          Length = 170

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 19/155 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREI 60
           YWL+KSEP+E S             WTGVRNYQARN MR  M+VGD   FYHS+     I
Sbjct: 14  YWLMKSEPNECSIDDALAAPDATVPWTGVRNYQARNFMRDAMQVGDSVLFYHSSCPQPGI 73

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI  V + T PDPT             A +   W  +D+ A+      ++L  ++A+P 
Sbjct: 74  AGIARVASGTRPDPTQFDPASPYFDPRSAPEKPRWLLLDVQALRKTRL-LALAELRAHPA 132

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
           L+ M +L  ++RLS+ PV   E+  +  +  L++P
Sbjct: 133 LAQMRVLQRANRLSITPVEPAEWDAI--LAALADP 165


>gi|325922298|ref|ZP_08184079.1| hypothetical protein XGA_3104 [Xanthomonas gardneri ATCC 19865]
 gi|325547251|gb|EGD18324.1| hypothetical protein XGA_3104 [Xanthomonas gardneri ATCC 19865]
          Length = 156

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 77/152 (50%), Gaps = 22/152 (14%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  RVG E W GVRNYQARN MR  M VGD  FFYHSN K   
Sbjct: 7   YWLMKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMHVGDGVFFYHSNCKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK--A 104
           IVGI ++ +  YPD T             + +   W  VD+     +   +SL  IK  A
Sbjct: 64  IVGIAKIASAAYPDDTQFDPKSDYHDPKASREDPRWMLVDVAFERKLTRTISLDEIKQQA 123

Query: 105 NPRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           +       LI   +RLS+ PVT  ++  +  M
Sbjct: 124 DALGEGFPLIARGNRLSILPVTAAQWKLLLAM 155


>gi|301763002|ref|XP_002916918.1| PREDICTED: thymocyte nuclear protein 1-like [Ailuropoda
           melanoleuca]
          Length = 229

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 78/158 (49%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP          ++S +  + + +    W GVRNYQARN +R M++  + FFYH
Sbjct: 60  YWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEQEAFFYH 119

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   I G+ +++   YPD T              E +  W  VD+  V  M   ++L
Sbjct: 120 SNCKEPGIAGLVKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRYITL 179

Query: 100 MAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
             +K + +        L +M L    RLSVQP+T +E+
Sbjct: 180 AELKTHHQAHKTTGGPLKNMALFTRQRLSVQPLTPEEF 217


>gi|107104331|ref|ZP_01368249.1| hypothetical protein PaerPA_01005406 [Pseudomonas aeruginosa PACS2]
          Length = 146

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 75/148 (50%), Gaps = 19/148 (12%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGI 63
           +KSEP E S +   D  R+G A W GVRNYQARN +R M  GD  FFYHS+     I GI
Sbjct: 1   MKSEPDELSIR---DLQRLGTARWDGVRNYQARNFIRSMNSGDLFFFYHSSCPQPGIAGI 57

Query: 64  FEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRLSS 110
             +    YPDPTA   +              W   D+  V +    V L  +KA   L++
Sbjct: 58  ARIEGEAYPDPTALDPASPYHDPKASAGKNPWSARDVSFVEAFAEVVPLARLKAQDALAN 117

Query: 111 MILIV-SSRLSVQPVTTDEYLEVCRMGK 137
           + L+   SRLSV PV+ +E+  +  + K
Sbjct: 118 LALVQKGSRLSVMPVSAEEWQAILPLAK 145


>gi|73540357|ref|YP_294877.1| hypothetical protein Reut_A0651 [Ralstonia eutropha JMP134]
 gi|72117770|gb|AAZ60033.1| Protein of unknown function DUF589 [Ralstonia eutropha JMP134]
          Length = 167

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 74/143 (51%), Gaps = 19/143 (13%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREI 60
           YWL+KSEP E S       G +   WTGVRNYQARN MR  MR+GD   FYHS+     I
Sbjct: 19  YWLMKSEPDEASIDTLAKDGTL--PWTGVRNYQARNFMRDVMRIGDGVLFYHSSCPEPGI 76

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
            G+ EV +  YPDPT                   W+ VD+  V      + L  ++A+  
Sbjct: 77  AGLAEVCSQPYPDPTQFDPKSHYYDAASKPDEPRWQLVDVKYVRKSAL-IPLSELRAHEE 135

Query: 108 LSSMILI-VSSRLSVQPVTTDEY 129
           L+ M+++   +RLS+ PVT  E+
Sbjct: 136 LADMVVLRRGNRLSITPVTAAEW 158


>gi|167585757|ref|ZP_02378145.1| hypothetical protein BuboB_10503 [Burkholderia ubonensis Bu]
          Length = 153

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 75/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M +WL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLANAPQRTLPWTGVRNYQARNFMRDMMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT              +++  W  VD+  V      V L A++  
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPKSPYYDPKSTQETPRWLLVDVRFVKKAAL-VPLAALREY 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT  E+
Sbjct: 120 DELADMRVLAKGNRLSITPVTRAEW 144


>gi|220935932|ref|YP_002514831.1| protein of unknown function DUF55 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997242|gb|ACL73844.1| protein of unknown function DUF55 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 152

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 74/146 (50%), Gaps = 20/146 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KG 57
           MAYWL+KSEP  +      D  RV  E W GVRNYQARN MR +M+ GD+ FFYHSN + 
Sbjct: 1   MAYWLMKSEPDVFG---IDDLKRVKVEPWDGVRNYQARNMMRDEMKQGDEVFFYHSNCEV 57

Query: 58  REIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKA 104
             IVG+  V    YPD TA                  W  VD+         + L  +K 
Sbjct: 58  PGIVGLMTVAREGYPDDTAFNPEAKYYDPKSDPDNPRWYRVDVRFKRKFKETIPLSDLKT 117

Query: 105 NPRLSSMILI-VSSRLSVQPVTTDEY 129
            P L+ M L+   +RLS+ PV+  E+
Sbjct: 118 YPELADMALVRKGNRLSIMPVSPQEW 143


>gi|78184100|ref|YP_376535.1| hypothetical protein Syncc9902_0523 [Synechococcus sp. CC9902]
 gi|78168394|gb|ABB25491.1| conserved hypothetical protein [Synechococcus sp. CC9902]
          Length = 156

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 82/156 (52%), Gaps = 22/156 (14%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYHSN-KG 57
           +A+WL+KSEP  +      D  R  E+  W G+RNYQARN MR M VGD+ FFYHSN K 
Sbjct: 4   VAFWLMKSEPDAYGI----DDLRREESTLWDGIRNYQARNFMRSMSVGDQAFFYHSNCKP 59

Query: 58  REIVGIFEVI------------TCTYPDPTAEQSSC-WECVDICAVCSMPCPVSLMAIKA 104
             I+G+ EV+            T  Y DP ++Q    W+C  +  +      +SL  ++A
Sbjct: 60  PGIIGLMEVVETHLVDPTQFDSTAKYFDPKSKQDQPRWDCARLRFLGQFDQLLSLDQLRA 119

Query: 105 NPRLSSMILIV-SSRLSVQPVTTDEYLEVC-RMGKL 138
           +     + +I   +RLS+ PV T    ++  R+G L
Sbjct: 120 SYNEEQLPVIKRGNRLSILPVPTTTAKDLLDRLGPL 155


>gi|301167356|emb|CBW26938.1| conserved hypothetical protein [Bacteriovorax marinus SJ]
          Length = 156

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 74/143 (51%), Gaps = 16/143 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL+K+EP  +S    + +    E+W GVRNYQARN MR +M+ GD    YHS+ K   I
Sbjct: 5   YWLMKTEPDTFSIDDLKSRPNKTESWDGVRNYQARNFMRDEMKKGDLILIYHSSCKIPGI 64

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI EV   ++PD T             +E++  W  V +         + L  +K   +
Sbjct: 65  AGIAEVAKESHPDHTCFDKTSKYYDPKSSEENPRWFMVSVKFKKKFKNFLPLNELKEQKK 124

Query: 108 LSSMILIVS-SRLSVQPVTTDEY 129
           L  M+L+   SRLS+QPVT  EY
Sbjct: 125 LKDMLLLQKGSRLSIQPVTKKEY 147


>gi|311695866|gb|ADP98739.1| protein belonging to uncharacterized protein family UPF0310 [marine
           bacterium HP15]
          Length = 152

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 74/144 (51%), Gaps = 15/144 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M  WLVKSEPSE   +           W GVRNYQARN + +M  GD+ F YHS+ K   
Sbjct: 1   MTKWLVKSEPSECGIEDFATAPTGVIPWDGVRNYQARNFLARMAEGDEVFLYHSSCKHIG 60

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +V+   YPDPT               +   W+ VD+  V ++P  + L  +K+  
Sbjct: 61  IAGIVKVVRSAYPDPTQFDPESPYFDAKSTAEKPRWQAVDMKYVRTLPKLIPLDELKSMA 120

Query: 107 RLSSMILI-VSSRLSVQPVTTDEY 129
            L  + L+   +RLSV PV+ +E+
Sbjct: 121 GLEDLPLVRKGNRLSVMPVSEEEW 144


>gi|46048964|ref|NP_989618.1| thymocyte nuclear protein 1 [Gallus gallus]
 gi|82107220|sp|Q90679|THYN1_CHICK RecName: Full=Thymocyte nuclear protein 1; AltName: Full=Thymocyte
           protein Thy28; Short=cThy28
 gi|995778|gb|AAA75591.1|AAA75591 cThy28kD [Gallus gallus]
          Length = 242

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 79/158 (50%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           +WL+KSEP        +  + ++  K +  +   W GVRNYQARN +R M++G + FFYH
Sbjct: 73  HWLLKSEPESRLEKGVDVKFSIEDLKAQPNQTTFWEGVRNYQARNFLRAMKLGQQAFFYH 132

Query: 54  SN-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSL 99
           SN K   IVGI +++   YPD T              +++  W  VD+  V      + L
Sbjct: 133 SNCKEPGIVGIVKIVKEAYPDHTQFDQKDPHYDSSSRKENPKWSMVDVQFVRMTKRFIPL 192

Query: 100 MAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
             IK +          L +M+L    RLS+QP+T +E+
Sbjct: 193 SEIKTHHLAHKADGGPLKNMMLFSRQRLSIQPLTQEEF 230


>gi|237811293|ref|YP_002895744.1| hypothetical protein GBP346_A1020 [Burkholderia pseudomallei
           MSHR346]
 gi|237503033|gb|ACQ95351.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
          Length = 153

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT               ++  W  VD+  V      V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWVLVDVRFVRKSSL-VPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEW 144


>gi|17228479|ref|NP_485027.1| hypothetical protein all0984 [Nostoc sp. PCC 7120]
 gi|17130330|dbj|BAB72941.1| all0984 [Nostoc sp. PCC 7120]
          Length = 151

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 74/143 (51%), Gaps = 23/143 (16%)

Query: 1   MAYWLVKSEPSEWS-WKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP  +    +Q+D   +   W GVRNYQARN MR+M+ GD  FFYHSN    
Sbjct: 1   MNYWLMKSEPEVYGITHLQKDNQTI---WDGVRNYQARNFMRQMQPGDLVFFYHSNTNPP 57

Query: 60  -IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVG+  V+     DPT   SS              W+ V +  V +    +SL  +K  
Sbjct: 58  GIVGLMRVVKTDVADPTQFDSSSEYYDPKSTPETPRWQTVLVEFVENFSDSISLTILKE- 116

Query: 106 PRLSSMILIV---SSRLSVQPVT 125
            + SS  L+V    +RLSV PV+
Sbjct: 117 -KFSSEELMVVKQGNRLSVMPVS 138


>gi|307152165|ref|YP_003887549.1| hypothetical protein Cyan7822_2296 [Cyanothece sp. PCC 7822]
 gi|306982393|gb|ADN14274.1| protein of unknown function DUF55 [Cyanothece sp. PCC 7822]
          Length = 152

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 79/150 (52%), Gaps = 20/150 (13%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE-IV 61
           YWL+KSEP+ +S    + +G+    W GVRNYQARN +R+M+ GD  FFYHSN     IV
Sbjct: 4   YWLMKSEPNVYSITDLKKEGKT--IWDGVRNYQARNFLRQMQPGDLCFFYHSNVTPPGIV 61

Query: 62  GIFEVITCTYPDPTAEQS--------SC-----WECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ +V+     DPT   S        SC     W+ V +  V   P  +SL  +K     
Sbjct: 62  GLMQVVESDVIDPTQFDSQSPYYDAQSCLESPRWQTVIVEFVKVFPEMISLTTLKQMFHQ 121

Query: 109 SSMILI-VSSRLSVQPV---TTDEYLEVCR 134
             ++LI   +RLSV PV     D+ L++ +
Sbjct: 122 EELLLIRRGNRLSVMPVAKKVADQILQIAQ 151


>gi|33863706|ref|NP_895266.1| hypothetical protein PMT1439 [Prochlorococcus marinus str. MIT
           9313]
 gi|33635289|emb|CAE21614.1| conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9313]
          Length = 158

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 69/137 (50%), Gaps = 17/137 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP  +     Q +G     W G+RNYQARN MR M +GDK FFYHSN K   IV
Sbjct: 8   YWLMKSEPDAYGIDHLQKEGST--LWDGIRNYQARNFMRSMLIGDKAFFYHSNCKPPGIV 65

Query: 62  GIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ EVI     DPT             +     W+CV +  +      ++L +++     
Sbjct: 66  GLMEVIETGLVDPTQFDPKAKYYDPKSSPDKPRWDCVRLHYLGRFSELLTLESLRDKYSA 125

Query: 109 SSM-ILIVSSRLSVQPV 124
             + +L   +RLS+ P+
Sbjct: 126 EQLPVLRKGNRLSILPI 142


>gi|88807415|ref|ZP_01122927.1| hypothetical protein WH7805_12728 [Synechococcus sp. WH 7805]
 gi|88788629|gb|EAR19784.1| hypothetical protein WH7805_12728 [Synechococcus sp. WH 7805]
          Length = 153

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 72/140 (51%), Gaps = 19/140 (13%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MAYWL+KSEP  +    +QQ+   +   W G+RNYQARN MR M +GD+ FFYHSN K  
Sbjct: 1   MAYWLMKSEPDVYGIDHLQQEHSTL---WDGIRNYQARNFMRTMAIGDQAFFYHSNCKPP 57

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            I+G+ EV      DPT    S              W+CV +  +      +SL  ++  
Sbjct: 58  GIIGLMEVTETGLIDPTQFDPSSKYHDPASTREKPRWDCVRLAYIGRFQRLLSLDELRQA 117

Query: 106 PRLSSMILIV-SSRLSVQPV 124
            +   + ++   +RLS+ PV
Sbjct: 118 YQPEELAVVKRGNRLSILPV 137


>gi|297621336|ref|YP_003709473.1| hypothetical protein wcw_1110 [Waddlia chondrophila WSU 86-1044]
 gi|297376637|gb|ADI38467.1| conserved hypothetical protein [Waddlia chondrophila WSU 86-1044]
          Length = 149

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 73/146 (50%), Gaps = 20/146 (13%)

Query: 1   MAYWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNK-G 57
           M YWL+KSEP  +S   +++DK      W GVRNYQARN MR +M+VGD   FYHSN   
Sbjct: 1   MKYWLMKSEPGSYSIDDLRKDKK---TTWEGVRNYQARNFMRDEMKVGDLALFYHSNALP 57

Query: 58  REIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKA 104
             + GI E+     PD T+               +  W  V++  V   P  + L  ++ 
Sbjct: 58  SGVAGICEITKVGIPDDTSWNPKSKYYDPKTDPDNPRWIMVEVKFVKKFPAIIPLSELRK 117

Query: 105 NPRLSS-MILIVSSRLSVQPVTTDEY 129
            P L   MIL   SRLS+ P+   E+
Sbjct: 118 APELKEMMILKKGSRLSITPLKKREF 143


>gi|86605669|ref|YP_474432.1| hypothetical protein CYA_0968 [Synechococcus sp. JA-3-3Ab]
 gi|86554211|gb|ABC99169.1| conserved hypothetical protein [Synechococcus sp. JA-3-3Ab]
          Length = 153

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 77/140 (55%), Gaps = 19/140 (13%)

Query: 1   MAYWLVKSEPSEWS-WKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M YWL+KSEPS +S W +Q++   +   W GVRNYQARN ++ M+VGD+ FFYHSN    
Sbjct: 1   MNYWLMKSEPSVYSIWDLQREGQTL---WDGVRNYQARNYLKAMQVGDRAFFYHSNANPP 57

Query: 60  -IVGIFEVI------------TCTYPDPTAEQSSC-WECVDICAVCSMPCPVSLMAIKAN 105
            I G+ E++            T  Y DP +  ++  W+ V +  V +    + L  ++A 
Sbjct: 58  GIAGLMEIVETQVVDPSQFDPTSPYYDPKSTPAAPRWQTVRVQFVAAFGRLIPLAQLRAT 117

Query: 106 PRLSSM-ILIVSSRLSVQPV 124
              + + ++   +RLSV PV
Sbjct: 118 FTPAELEVVRRGTRLSVMPV 137


>gi|188990315|ref|YP_001902325.1| hypothetical protein xccb100_0920 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732075|emb|CAP50267.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 156

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 75/146 (51%), Gaps = 22/146 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  RVG E W GVRNYQARN MR  M+VGD  FFYHSN K   
Sbjct: 7   YWLMKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMQVGDGVFFYHSNCKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK--A 104
           IVGI +V +  YPD T               +   W  VD+     +   ++L  IK  A
Sbjct: 64  IVGIAKVASTAYPDETQFDRTSDYHDPKAKREDPRWMLVDVAFERKLKRTIALDEIKQHA 123

Query: 105 NPRLSSMILIV-SSRLSVQPVTTDEY 129
           +       LI   +RLS+ PVT  ++
Sbjct: 124 DALGEGFPLIARGNRLSILPVTAAQW 149


>gi|289668027|ref|ZP_06489102.1| hypothetical protein XcampmN_05863 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 156

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 75/146 (51%), Gaps = 22/146 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  RVG E W GVRNYQARN MR  M VG+  FFYHSN K   
Sbjct: 7   YWLMKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMHVGESVFFYHSNCKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK--A 104
           IVGI +V +  YPD T             + +   W  VD+     +   +SL  IK  A
Sbjct: 64  IVGIAKVASAAYPDDTQFDPKSDYHDPKSSREDPRWMLVDVAFERKLTRTISLDEIKQQA 123

Query: 105 NPRLSSMILIV-SSRLSVQPVTTDEY 129
           +       LI   +RLS+ PVT  ++
Sbjct: 124 DALGEGFPLIARGNRLSILPVTAAQW 149


>gi|326933330|ref|XP_003212759.1| PREDICTED: thymocyte nuclear protein 1-like [Meleagris gallopavo]
 gi|20302922|gb|AAM18926.1| cThy28 [Gallus gallus]
          Length = 242

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 79/158 (50%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           +WL+KSEP        +  + ++  K +  +   W GVRNYQARN +R M++G + FFYH
Sbjct: 73  HWLLKSEPESRLEKGVDVKFSIEDLKAQPNQTTFWEGVRNYQARNFLRAMKLGQQAFFYH 132

Query: 54  SN-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSL 99
           SN K   IVGI +++   YPD T              +++  W  VD+  V      + L
Sbjct: 133 SNCKEPGIVGIVKIVKEAYPDHTQFDQKDPHYDSSSRKENPKWSMVDVQFVRMTKRFIPL 192

Query: 100 MAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
             IK +          L +M+L    RLS+QP+T +E+
Sbjct: 193 SEIKTHHLAHKADGGPLKNMMLFSRQRLSIQPLTQEEF 230


>gi|332141207|ref|YP_004426945.1| hypothetical protein MADE_1009045 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551229|gb|AEA97947.1| hypothetical protein MADE_1009045 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 154

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 78/153 (50%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S     ++    E W GVRNYQARN +R  +++GDK F YHS+ K  
Sbjct: 1   MAYWLFKTEPDAFSIDDLANRPEQTEPWDGVRNYQARNFLRDGVKLGDKVFIYHSSCKLV 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV+   YPD T             +E++  W  VD+  V      + L  IK+ 
Sbjct: 61  GIAGVAEVVKDGYPDTTQFNPESKYYDPKSSEENPRWFRVDVKFVEKFSSVLPLSVIKSM 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
             ++ + L+    RLS+ PV   E+ ++    K
Sbjct: 121 EGITELPLVKKGGRLSIMPVQEGEWQQLYAAAK 153


>gi|124022226|ref|YP_001016533.1| hypothetical protein P9303_05161 [Prochlorococcus marinus str. MIT
           9303]
 gi|123962512|gb|ABM77268.1| Uncharacterized conserved protein [Prochlorococcus marinus str. MIT
           9303]
          Length = 158

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 69/137 (50%), Gaps = 17/137 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEP  +     + +G     W G+RNYQARN MR M +GDK FFYHSN K   IV
Sbjct: 8   YWLMKSEPDAYGIDHLKKEGNT--LWDGIRNYQARNFMRSMLIGDKAFFYHSNCKPPGIV 65

Query: 62  GIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ EVI     DPT             +     W+CV +  +      +SL +++     
Sbjct: 66  GLMEVIETGLVDPTQFDPKAKYYDPKSSPDKPRWDCVRLHYLGRFSELLSLESLRDKYSA 125

Query: 109 SSM-ILIVSSRLSVQPV 124
             + +L   +RLS+ P+
Sbjct: 126 EQLPVLRKGNRLSILPI 142


>gi|116332058|ref|YP_801776.1| hypothetical protein LBJ_2591 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116125747|gb|ABJ77018.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 156

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 77/153 (50%), Gaps = 18/153 (11%)

Query: 1   MAYWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KG 57
           M +WL K+EP  +S   + +   R+   W GVRNYQARN +R  ++ GD   FYHS    
Sbjct: 1   MKHWLFKTEPDVFSIDDLYKAPSRIA-PWEGVRNYQARNFLRDSIQKGDFILFYHSRVNP 59

Query: 58  REIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKA 104
             IVGI EV    YPD  A              ++  W  VDI      P P++   +K 
Sbjct: 60  LSIVGIAEVAKPGYPDHFAFDPSHKYFDPKSKPENPTWYMVDIKFKKKFPEPITTEEMKK 119

Query: 105 NPRLSSMILIVS-SRLSVQPVTTDEYLEVCRMG 136
           + +L +M L+   +RLS+QPV+  E+  + R+ 
Sbjct: 120 HKQLKNMALLQKGARLSIQPVSPTEFQFILRLA 152


>gi|116327327|ref|YP_797047.1| hypothetical protein LBL_0521 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116120071|gb|ABJ78114.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
          Length = 156

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 77/153 (50%), Gaps = 18/153 (11%)

Query: 1   MAYWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KG 57
           M +WL K+EP  +S   + +   R+   W GVRNYQARN +R  ++ GD   FYHS    
Sbjct: 1   MKHWLFKTEPDVFSIDDLYKAPSRIA-PWEGVRNYQARNFLRDSIQKGDLILFYHSRVNP 59

Query: 58  REIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKA 104
             IVGI EV    YPD  A              ++  W  VDI      P P++   +K 
Sbjct: 60  LSIVGIAEVAKPGYPDHFAFDPSHKYFDPKSKPENPTWYMVDIKFKKKFPEPITTEEMKK 119

Query: 105 NPRLSSMILIVS-SRLSVQPVTTDEYLEVCRMG 136
           + +L +M L+   +RLS+QPV+  E+  + R+ 
Sbjct: 120 HKQLKNMALLQKGARLSIQPVSPTEFQFILRLA 152


>gi|218248968|ref|YP_002374339.1| hypothetical protein PCC8801_4260 [Cyanothece sp. PCC 8801]
 gi|257062053|ref|YP_003139941.1| hypothetical protein Cyan8802_4320 [Cyanothece sp. PCC 8802]
 gi|218169446|gb|ACK68183.1| protein of unknown function DUF55 [Cyanothece sp. PCC 8801]
 gi|256592219|gb|ACV03106.1| protein of unknown function DUF55 [Cyanothece sp. PCC 8802]
          Length = 149

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M YWL+KSEP+ +S    Q +G+    W GVRNYQARN +R+M V D  FFYHSN K   
Sbjct: 1   MKYWLMKSEPNTYSIADLQQEGQT--IWDGVRNYQARNFLRQMTVDDLAFFYHSNTKIPG 58

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+  V+     DPT                S  W+ V +  V      ++L  +K   
Sbjct: 59  IVGLMRVVESQVIDPTQFDQKSPYYDPKSTTDSPRWQTVKVEFVKEFSKILTLEILKVRF 118

Query: 107 RLSSMILIVS-SRLSVQPVTTDEYLEVCRM 135
               ++L+   +RLSV PV  +   ++  M
Sbjct: 119 TSEELLLVKKGNRLSVIPVAPEIASQILEM 148


>gi|75909158|ref|YP_323454.1| hypothetical protein Ava_2948 [Anabaena variabilis ATCC 29413]
 gi|75702883|gb|ABA22559.1| Protein of unknown function DUF589 [Anabaena variabilis ATCC 29413]
          Length = 151

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 72/143 (50%), Gaps = 23/143 (16%)

Query: 1   MAYWLVKSEPSEWS-WKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP  +    +Q+D   +   W GVRNYQARN MR+M+ GD  FFYHSN    
Sbjct: 1   MNYWLMKSEPEVYGITHLQKDHQTI---WDGVRNYQARNFMRQMQPGDIVFFYHSNTNPP 57

Query: 60  -IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V+     DPT   SS              W+ V +  V      +SL  +K N
Sbjct: 58  GIAGLMRVVKTYIADPTQFDSSSEYYDPKSTPETPRWQTVLVEFVEKFSDSISLTTLKEN 117

Query: 106 PRLSSMILIV---SSRLSVQPVT 125
              SS  L+V    +RLSV PV+
Sbjct: 118 --FSSEELMVVKQGNRLSVMPVS 138


>gi|159904087|ref|YP_001551431.1| hypothetical protein P9211_15461 [Prochlorococcus marinus str. MIT
           9211]
 gi|159889263|gb|ABX09477.1| Conserved hypothetical protein [Prochlorococcus marinus str. MIT
           9211]
          Length = 156

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 69/137 (50%), Gaps = 17/137 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YW++KSEP  +S  +   K      W G+RNYQARN MR M VGD  FFYHSN K   IV
Sbjct: 6   YWIMKSEPDAYS--IDDLKEEKETLWDGIRNYQARNFMRSMNVGDIAFFYHSNCKPPGIV 63

Query: 62  GIFEVITCTYPDPTA--------EQSSC-----WECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ +VI     DPT         +Q S      W+C  +  +      +SL  +  N   
Sbjct: 64  GLMQVIETKLTDPTQFDNQSKYFDQKSSLENPRWDCAKLKYLGEFGEKLSLKEMSDNFTA 123

Query: 109 SSMILI-VSSRLSVQPV 124
             ++L+   +RLS+ PV
Sbjct: 124 EELLLLRKGNRLSIIPV 140


>gi|91788787|ref|YP_549739.1| hypothetical protein Bpro_2927 [Polaromonas sp. JS666]
 gi|91698012|gb|ABE44841.1| protein of unknown function DUF589 [Polaromonas sp. JS666]
          Length = 154

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 76/151 (50%), Gaps = 17/151 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M YWL+KSEP E S        +    W GVRNYQARN MR  MRVGD   FYHS+    
Sbjct: 1   MNYWLMKSEPEECSVDDALAAPKATVPWVGVRNYQARNFMRDAMRVGDGVLFYHSSCAEP 60

Query: 60  -IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI +V +  YPDPT               +   W  VD+  V      ++L  ++A+
Sbjct: 61  GIVGIAQVASTPYPDPTQFDPKSPYYDAKSKPEEPRWLLVDV-QVLRKTRNLALPELRAH 119

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
             L  ++++   +RLS+ PV    +  +C++
Sbjct: 120 EDLQGLVVLRKGNRLSITPVEPKHWRVICKL 150


>gi|51894304|ref|YP_076995.1| hypothetical protein STH3169 [Symbiobacterium thermophilum IAM
           14863]
 gi|51857993|dbj|BAD42151.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 135

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 76/131 (58%), Gaps = 3/131 (2%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFE 65
           +K+EP+ +S+   +  GR  + W GVRN  A  NMR MR GD   FYH+   R +VG+  
Sbjct: 1   MKTEPTVYSYDDLERAGR--DLWDGVRNAAAARNMRAMRPGDLFLFYHTGDERAVVGVGR 58

Query: 66  VITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVT 125
           +++  YPDPT +    W  VD+  +     PV+L  +KA+PR +   L+  SRLSV PV+
Sbjct: 59  IVSEPYPDPT-DSEGRWVAVDVEPLYRFRTPVTLADVKADPRFADWALVRQSRLSVMPVS 117

Query: 126 TDEYLEVCRMG 136
            +++  +  MG
Sbjct: 118 QEQWAWLHEMG 128


>gi|82701747|ref|YP_411313.1| hypothetical protein Nmul_A0614 [Nitrosospira multiformis ATCC
           25196]
 gi|82409812|gb|ABB73921.1| Protein of unknown function DUF589 [Nitrosospira multiformis ATCC
           25196]
          Length = 154

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEPS+ S            AW GVRNYQARN MR +MRVGD+ FFYHS  +  
Sbjct: 4   MRYWLMKSEPSDVSIDDLASMPDQTVAWYGVRNYQARNFMRDQMRVGDRVFFYHSTCEEP 63

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV    YPD T               ++  W  VD+  +      V +  ++  
Sbjct: 64  GIAGIAEVSKLAYPDATQFEPENKYFDPKATPENPRWFNVDVRLIKKTRL-VGIKELRGY 122

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
           P L++M IL   +RLS+ P+   E+
Sbjct: 123 PELANMRILQKGNRLSITPIDPAEW 147


>gi|109109389|ref|XP_001088767.1| PREDICTED: thymocyte nuclear protein 1 [Macaca mulatta]
          Length = 225

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 80/159 (50%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T              E +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWCMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +K+  +        L +M L    RLS+QP+T +E+
Sbjct: 175 LAELKSYHQAHKATGGPLKNMTLFSRQRLSIQPLTQEEF 213


>gi|90412746|ref|ZP_01220747.1| hypothetical protein P3TCK_22600 [Photobacterium profundum 3TCK]
 gi|90326321|gb|EAS42740.1| hypothetical protein P3TCK_22600 [Photobacterium profundum 3TCK]
          Length = 154

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 83/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           + YWL K+EP  +S  +   K +    W GVRNYQARN MR ++++GD+ F YHS+ K  
Sbjct: 3   VGYWLFKTEPDTFS--IDTLKQQKVSCWEGVRNYQARNMMRDQVKLGDQIFIYHSSCKEV 60

Query: 59  EIVGIFEVI------------TCTYPDPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI  V+            TC Y DP ++ ++  W  VD+     +   VSL  +KAN
Sbjct: 61  GVAGIATVVKEAYPDHFQFDPTCPYFDPKSDPENPLWIMVDVEYKRHLRL-VSLKRMKAN 119

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           P L  M L+   +RLS+ PVT  ++L + +M
Sbjct: 120 PLLEEMPLVKRGNRLSIMPVTEAQWLAILQM 150


>gi|126327514|ref|XP_001374343.1| PREDICTED: similar to Thymocyte nuclear protein 1 [Monodelphis
           domestica]
          Length = 231

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 74/158 (46%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP          ++  +  + + R    W GVRNYQARN +R M++G+K FFYH
Sbjct: 62  YWLMKSEPESRLEKGIDVKFGIEDLKAQPRQTACWDGVRNYQARNFLRTMKLGEKAFFYH 121

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   I G+ +++   YPD T              + +  W  VD+  +      + L
Sbjct: 122 SNCKEPGIAGLVKIVKEAYPDHTQFEKDSPHYDPSSKKDNPKWSMVDVQFIRMTKRFIPL 181

Query: 100 MAIKA--------NPRLSSMILIVSSRLSVQPVTTDEY 129
             +K            L +M L    RLSVQPVT  E+
Sbjct: 182 AELKGYYHAHKDIGGPLQNMALFTRQRLSVQPVTQGEF 219


>gi|54307356|ref|YP_128376.1| hypothetical protein PBPRA0135 [Photobacterium profundum SS9]
 gi|46911776|emb|CAG18574.1| conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 163

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/151 (37%), Positives = 82/151 (54%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL K+EP  +S  +   K +    W GVRNYQARN MR ++++GD+ F YHS+ K  
Sbjct: 12  MGYWLFKTEPETFS--IDTLKQQKVSCWEGVRNYQARNMMRDQVKLGDQIFIYHSSCKDV 69

Query: 59  EIVGIFEVI------------TCTYPDPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI  V+            TC Y DP +E ++  W  VD+     +   VSL  +KAN
Sbjct: 70  GVAGIATVVKEAYPDHFQFDPTCPYFDPKSEPENPRWIMVDVEYQRHLRL-VSLKRMKAN 128

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
           P L  M L+   +RLS+ PVT  ++  + +M
Sbjct: 129 PLLEEMPLVKRGNRLSIMPVTEAQWQAILQM 159


>gi|120611498|ref|YP_971176.1| hypothetical protein Aave_2834 [Acidovorax citrulli AAC00-1]
 gi|120589962|gb|ABM33402.1| protein of unknown function DUF55 [Acidovorax citrulli AAC00-1]
          Length = 171

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/148 (37%), Positives = 75/148 (50%), Gaps = 17/148 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREI 60
           YWL+KSEP E S        R    WTGVRNYQARN MR  MRVGD   FYHS+     I
Sbjct: 19  YWLMKSEPEECSIDDALAAPRATVPWTGVRNYQARNFMRDAMRVGDGVLFYHSSCPEPGI 78

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
            GI  V + T  DPT    +              W  +D+ A+      V L  ++ +P 
Sbjct: 79  AGIARVASGTRADPTQFDPASPYHDPKSTPARPRWLLLDVQALRKTRL-VGLAELRESPA 137

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
           L++M +L   +RLS+ PV + E+ E+ +
Sbjct: 138 LANMRVLQRGNRLSITPVESAEWEEIVQ 165


>gi|219112803|ref|XP_002185985.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|209582835|gb|ACI65455.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 137

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 72/137 (52%), Gaps = 18/137 (13%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIF 64
           +KSEPSE+S    + + R  E W GVRNY ARN++R MR  D+ +FYHS  K   IVG  
Sbjct: 1   IKSEPSEFSIHNLEARPRQREEWDGVRNYAARNHIRSMRENDRCWFYHSACKTPAIVGTC 60

Query: 65  EVITCTYPDPTAEQS------------SC-WECVDICAVCSMPCPVSLMAIKA----NPR 107
            V+    PD TA  S            SC W+ V +        P++L  ++A    N  
Sbjct: 61  RVVRTAAPDATALDSNHPGYDPKSTAESCRWDSVLVELESIFESPITLKELRAQAKINKT 120

Query: 108 LSSMILIVSSRLSVQPV 124
           ++SM ++  SRLSV PV
Sbjct: 121 VASMTILKMSRLSVTPV 137


>gi|74318692|ref|YP_316432.1| hypothetical protein Tbd_2674 [Thiobacillus denitrificans ATCC
           25259]
 gi|74058187|gb|AAZ98627.1| conserved hypothetical protein [Thiobacillus denitrificans ATCC
           25259]
          Length = 151

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M YWL+KSEPS+ S            AW GVRNYQARN MR +M+ GDK  FYHS+    
Sbjct: 1   MRYWLMKSEPSDVSIDDLAAMPEQSVAWYGVRNYQARNFMRDQMQPGDKVLFYHSSCAEP 60

Query: 60  -IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV T  YPD T               ++  W  VD+  V      + L  I+  
Sbjct: 61  GIAGLAEVSTPAYPDATQFDPENKYFDAKATAETPRWFNVDVKLVKKTRL-MPLSEIRGY 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
           P L+ M IL   +RLS+ PV   EY  + +
Sbjct: 120 PELAGMRILQKGNRLSITPVDPAEYRFIVK 149


>gi|291615139|ref|YP_003525296.1| hypothetical protein Slit_2684 [Sideroxydans lithotrophicus ES-1]
 gi|291585251|gb|ADE12909.1| protein of unknown function DUF55 [Sideroxydans lithotrophicus
           ES-1]
          Length = 167

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEPS+ S            AW GVRNYQARN MR +M+VGD   FYHSN K  
Sbjct: 14  MRYWLMKSEPSDCSIDDLAKLPNQTVAWYGVRNYQARNFMRDQMQVGDGVLFYHSNCKEP 73

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPD T               +   W  VD+  V  +   +S+  +K +
Sbjct: 74  GIAGIAEVSSTAYPDTTQFDKKSKYFDPKATPEQPRWMNVDVKLVRKIAL-ISIEELKRH 132

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
           P L +M  L   +RLS+ P+   E+
Sbjct: 133 PELENMRTLQRGNRLSITPLDPAEW 157


>gi|91782317|ref|YP_557523.1| hypothetical protein Bxe_A3514 [Burkholderia xenovorans LB400]
 gi|91686271|gb|ABE29471.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 153

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 77/151 (50%), Gaps = 17/151 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M +WL+KSEPSE+         +    WTG+RNYQARN +R +  VGD  FFYHS+    
Sbjct: 1   MRHWLLKSEPSEFGIDDLAQSSKQTAPWTGIRNYQARNFLRDESSVGDLAFFYHSSCPQP 60

Query: 59  EIVGIFEVITCTYPDPTA-EQSSC------------WECVDICAVCSMPCPVSLMAIKAN 105
            I G+  + +  Y DPT  +QSS             W  VD+  V      + L  ++  
Sbjct: 61  GIAGLMLIASKAYADPTQFDQSSPYFDLKSTDEKPRWTAVDVKLVKKTRL-LGLDEMRRV 119

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
             LS M L+   +RLSV PV+  E+  +C++
Sbjct: 120 DELSGMRLLARGNRLSVMPVSVTEFDAICKI 150


>gi|300863565|ref|ZP_07108511.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300338432|emb|CBN53653.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 149

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 72/144 (50%), Gaps = 21/144 (14%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           M YWL+KSEP+ +S  +   K  +   W GVRNYQARN +R+M  GD  FFYHSN     
Sbjct: 1   MNYWLMKSEPNVYS--ITDLKRDLTSLWDGVRNYQARNYLRQMNQGDLVFFYHSNSNPPG 58

Query: 60  IVGIFEVITCTYPDPTA--EQSSC-----------WECVDICAVCSMPCPVSLMAIK--- 103
           IVG+  VI     DPT    QS             W+ V +  V      +SL  +K   
Sbjct: 59  IVGLMRVIETGISDPTQFDHQSEYYDPKSTLNAPRWQTVSVEFVEEFAKLISLDLLKQEF 118

Query: 104 ANPRLSSMILIVSSRLSVQPVTTD 127
            N RL  +++   +RLSV P+  D
Sbjct: 119 TNDRL--LLVQKGNRLSVMPIAED 140


>gi|58617650|ref|YP_196849.1| hypothetical protein ERGA_CDS_09230 [Ehrlichia ruminantium str.
           Gardel]
 gi|58417262|emb|CAI28375.1| Hypothetical protein ERGA_CDS_09230 [Ehrlichia ruminantium str.
           Gardel]
          Length = 135

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 70/140 (50%), Gaps = 7/140 (5%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M+YWL+K+EP ++SW    D  R     W  V NYQA+  +R M+  D  FFYHS   + 
Sbjct: 1   MSYWLLKTEPQDFSW---NDMVRSNITVWDNVLNYQAQGYLRLMKSNDLAFFYHSGIEKS 57

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
           I+GI  +    Y      ++  +  VD+     +   V L  IK    L ++I++   RL
Sbjct: 58  IIGIVSIYKEFY---CFNENDKFGVVDVKIHTKLKKAVHLKDIKLETNLKNLIMLRQPRL 114

Query: 120 SVQPVTTDEYLEVCRMGKLS 139
           SV P+T  E+  +  + + S
Sbjct: 115 SVSPITEKEWNSILEISETS 134


>gi|88607201|ref|YP_505805.1| hypothetical protein APH_1291 [Anaplasma phagocytophilum HZ]
 gi|88598264|gb|ABD43734.1| conserved hypothetical protein [Anaplasma phagocytophilum HZ]
          Length = 135

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 73/134 (54%), Gaps = 8/134 (5%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRV-GEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           +WL+KSEP++++W    D   V    W GV+NYQA+ N++   VGD  FFYH+   + I 
Sbjct: 6   FWLLKSEPADFAWG---DMLAVCVTTWDGVKNYQAQGNLKAASVGDFAFFYHAGAEKAIK 62

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI +V    Y      ++  + C+D+    ++   +SL  IK+   LSSM ++   RLSV
Sbjct: 63  GIVKVCREFY----IPENDRFGCIDVEFHSALKRSISLQEIKSVESLSSMAILKQPRLSV 118

Query: 122 QPVTTDEYLEVCRM 135
             VT  E+  +  M
Sbjct: 119 SEVTPAEWDTIIEM 132


>gi|327539167|gb|EGF25795.1| protein belonging to uncharacterized protein family UPF0310
           [Rhodopirellula baltica WH47]
          Length = 159

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 78/158 (49%), Gaps = 21/158 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+K+EP+ +S     ++      W GVRNYQARN +R ++  GD+  FYHS  K  
Sbjct: 1   MKYWLMKTEPNTFSIDDLAEQPEQITCWEGVRNYQARNLLRDEIEEGDQVLFYHSACKTP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLM----- 100
            +VG+  V    YPD  A               S  W  VDI     +  PV+L      
Sbjct: 61  AVVGLATVSRGGYPDHHAFDKKSHYFDPKSNPDSPTWYMVDIKLNKKLERPVTLAELREE 120

Query: 101 AIKANPRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGK 137
           A KA   L  M+L+   SRLSVQPVT  ++  V ++ +
Sbjct: 121 ATKARSPLVDMVLLQKGSRLSVQPVTKKQFDRVVKLSE 158


>gi|291410641|ref|XP_002721602.1| PREDICTED: thymocyte nuclear protein 1 [Oryctolagus cuniculus]
          Length = 222

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 78/159 (49%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP        +  + ++  K +  +   W GVRNYQARN +R M++ ++ FFY
Sbjct: 52  SHWLMKSEPESRLEKGVDVKFGIEDLKAQPKQTACWDGVRNYQARNFLRSMKLEEEAFFY 111

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T              E +  W  VD+  V  M   + 
Sbjct: 112 HSNCKQPGIAGLMKIVKEAYPDHTQFEKNSPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 171

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +K   +        L +M L    RLSVQP+T +E+
Sbjct: 172 LAELKTYHQAHKATGGPLKNMALFTRQRLSVQPLTQEEF 210


>gi|156392004|ref|XP_001635839.1| predicted protein [Nematostella vectensis]
 gi|156222937|gb|EDO43776.1| predicted protein [Nematostella vectensis]
          Length = 201

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 79/158 (50%), Gaps = 32/158 (20%)

Query: 4   WLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYH 53
           WL+KSEP          ++  +  + + +    W GVRNYQARN MR +M+VG  GFFYH
Sbjct: 32  WLMKSEPESRFENGVDVKFGIEDLKSEPKQTSCWDGVRNYQARNFMRDQMKVGQLGFFYH 91

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   I GI +++   Y D T              + S  W+ VD+  V  M   + L
Sbjct: 92  SNCKTPGIAGIIKIVKEGYDDHTQFDKKDPHYDPKSKKDSPRWQMVDVQFVRMMKRFIPL 151

Query: 100 MAIKA---NPRLS-----SMILIVSSRLSVQPVTTDEY 129
             +K    N +LS     S+ L   +RLSVQP+T DE+
Sbjct: 152 SELKTYHENHKLSGGPLKSVALFTRARLSVQPLTEDEF 189


>gi|254181429|ref|ZP_04888026.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|184211967|gb|EDU09010.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
          Length = 153

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT               ++  W  VD+  V      V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWVLVDVRFVRKS-LLVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L++M +L   +RLS+ PVT +E+
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEW 144


>gi|327283898|ref|XP_003226677.1| PREDICTED: thymocyte nuclear protein 1-like isoform 1 [Anolis
           carolinensis]
 gi|327283900|ref|XP_003226678.1| PREDICTED: thymocyte nuclear protein 1-like isoform 2 [Anolis
           carolinensis]
          Length = 229

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 77/159 (48%), Gaps = 31/159 (19%)

Query: 2   AYWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP        +  + ++  K +  +   W GVRNYQARN ++ M+VG + FFY
Sbjct: 60  SHWLMKSEPESRFEKGVDVKFGIEDLKAQPNQTACWDGVRNYQARNFLKDMKVGQEAFFY 119

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I GI +++   YPD T              ++   W  VD+  V      + 
Sbjct: 120 HSNCKEPGIAGIVKIVQEAYPDHTQFDKKDPHYDASSTKEKPKWFMVDVQFVRMTKRFIP 179

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
           L  +K   +        L +M L    RLSVQP+T +E+
Sbjct: 180 LAELKVQHQAHKTSGGPLKAMSLFTRQRLSVQPLTDEEF 218


>gi|94311724|ref|YP_584934.1| hypothetical protein Rmet_2792 [Cupriavidus metallidurans CH34]
 gi|93355576|gb|ABF09665.1| conserved hypothetical protein [Cupriavidus metallidurans CH34]
          Length = 159

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 76/144 (52%), Gaps = 21/144 (14%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGE-AWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGRE 59
           YWL+KSEP E S     D  R G   WTGVRNYQARN MR +MR+GD   FYHS+     
Sbjct: 11  YWLMKSEPDEASI---DDLAREGTLPWTGVRNYQARNFMRDQMRIGDGVLFYHSSCPEPG 67

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+ EV +  YPD T              + +  W  VD+  V      + L A++ + 
Sbjct: 68  IAGLAEVCSQPYPDSTQFDPKSDYYDSASKQDNPRWSLVDVSFVRKSTL-IPLQALREHD 126

Query: 107 RLSSMILI-VSSRLSVQPVTTDEY 129
            L+ M+++   +RLS+ PVT  E+
Sbjct: 127 ALADMVVLRRGNRLSITPVTPAEW 150


>gi|57239607|ref|YP_180743.1| hypothetical protein Erum8810 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579596|ref|YP_197808.1| hypothetical protein ERWE_CDS_09320 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161686|emb|CAH58616.1| conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58418222|emb|CAI27426.1| Hypothetical protein ERWE_CDS_09320 [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 135

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 70/140 (50%), Gaps = 7/140 (5%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M+YWL+K+EP ++SW    D  R     W  V NYQA+  +R M+  D  FFYHS   + 
Sbjct: 1   MSYWLLKTEPQDFSW---SDMVRSNITVWDNVLNYQAQGYLRLMKSNDLAFFYHSGIEKS 57

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
           I+GI  +    Y      ++  +  VD+     +   V L  IK    L ++I++   RL
Sbjct: 58  IIGIVSIYKEFY---CFNKNDKFGVVDVKIHTKLKKAVHLKDIKLETNLKNLIMLRQPRL 114

Query: 120 SVQPVTTDEYLEVCRMGKLS 139
           SV P+T  E+  +  + + S
Sbjct: 115 SVSPITEKEWNSILEISETS 134


>gi|113868930|ref|YP_727419.1| hypothetical protein H16_A2975 [Ralstonia eutropha H16]
 gi|113527706|emb|CAJ94051.1| conserved hypothetical protein [Ralstonia eutropha H16]
          Length = 160

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/153 (38%), Positives = 78/153 (50%), Gaps = 23/153 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGE-AWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP E S     D  R G   WTGVRNYQARN MR  MR+GD   FYHS+     
Sbjct: 12  YWLMKSEPDEASI---DDLAREGTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEPG 68

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+ EV +  YPDPT                +  W  VD+         + L A++ + 
Sbjct: 69  IAGLAEVCSVPYPDPTQFDRKSPYYDAASKADAPRWLLVDV-RFERKSALIPLAALREHE 127

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKL 138
            L+ M+++   +RLS+ PVT  E+  +   GKL
Sbjct: 128 ELADMVVLRRGNRLSITPVTPAEWRFIT--GKL 158


>gi|91793503|ref|YP_563154.1| hypothetical protein Sden_2149 [Shewanella denitrificans OS217]
 gi|91715505|gb|ABE55431.1| protein of unknown function DUF589 [Shewanella denitrificans OS217]
          Length = 149

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 78/147 (53%), Gaps = 16/147 (10%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREIVGI 63
           +KSEP E      +D       W G+RNYQARN +R  ++VG++ FFYHS+ K   IVGI
Sbjct: 1   MKSEPDECCIDDIKDSTDQCIPWQGIRNYQARNYIRDNIQVGEQVFFYHSSCKEPGIVGI 60

Query: 64  FEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRLSS 110
            EV++    D +A  ++              W  +D+      P  + L  +KA+P L+ 
Sbjct: 61  VEVVSDASADVSAFDNTSPYFDAKSSPEKPRWYSIDLKFGRKFPKVIRLKQLKADPALAE 120

Query: 111 MILIV-SSRLSVQPVTTDEYLEVCRMG 136
           M+L+   +RLSVQPVT  E+  + ++ 
Sbjct: 121 MVLVAKGARLSVQPVTVQEWQHISKLA 147


>gi|28899750|ref|NP_799355.1| hypothetical protein VP2976 [Vibrio parahaemolyticus RIMD 2210633]
 gi|28808002|dbj|BAC61239.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
          Length = 156

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 80/154 (51%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   + +    W GVRNYQARN MR +++VGD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IDTLRTQKVSCWEGVRNYQARNMMRDQVKVGDFVLIYHSSCKNV 58

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YP            DP ++  +  W  VDI  V      + L  +KA 
Sbjct: 59  GVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDIEFVRKTARVIPLSVMKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PVT DE+  +    KL
Sbjct: 119 PELENMPLVKRGNRLSIMPVTEDEWEAILGKEKL 152


>gi|186683803|ref|YP_001866999.1| hypothetical protein Npun_R3666 [Nostoc punctiforme PCC 73102]
 gi|186466255|gb|ACC82056.1| protein of unknown function DUF55 [Nostoc punctiforme PCC 73102]
          Length = 156

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 73/151 (48%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP  +S   +QQ    +   W GVRNYQARN +R+M  GD  FFYHSN    
Sbjct: 1   MNYWLMKSEPEAYSIVDLQQQSQTI---WDGVRNYQARNFLRQMEEGDLAFFYHSNTNFP 57

Query: 60  -IVGIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V+     DP             +  +S  W+ V +  + +   P+ L  +K  
Sbjct: 58  GIAGLMRVVKKDIADPSQFEPESKYYDPKSTSESPRWQTVVVEFIETFSNPILLSILKEK 117

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
                ++L+   +RLSV PV     L++  M
Sbjct: 118 FSDEDLMLVRQGNRLSVMPVPEAVALKILAM 148


>gi|283780248|ref|YP_003371003.1| hypothetical protein Psta_2474 [Pirellula staleyi DSM 6068]
 gi|283438701|gb|ADB17143.1| protein of unknown function DUF55 [Pirellula staleyi DSM 6068]
          Length = 150

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 74/147 (50%), Gaps = 16/147 (10%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREIVGI 63
           +K+EP  WS        +    W GVRNYQARN +R +M++G +   YHSN +   IVG+
Sbjct: 1   MKTEPESWSVDDFLKAPKKTTHWDGVRNYQARNMLRDEMKLGHEVLVYHSNAEPPAIVGL 60

Query: 64  FEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRLSS 110
            EV+   YPDP++   S              W  VD+        P+ L  ++ +P+L  
Sbjct: 61  AEVVREGYPDPSSWDKSSHYFDEGTSPDNVRWYMVDLRLKEKFAQPIPLPQLREDPQLDG 120

Query: 111 M-ILIVSSRLSVQPVTTDEYLEVCRMG 136
           M +L   SRLSVQ V++  +  + R+ 
Sbjct: 121 MELLRKGSRLSVQSVSSAHFAHILRLA 147


>gi|308094601|ref|ZP_05890473.2| thymocyte nuclear protein 1 [Vibrio parahaemolyticus AN-5034]
 gi|308095237|ref|ZP_05904321.2| thymocyte nuclear protein 1 (Thymocyte protein Thy28) [Vibrio
           parahaemolyticus Peru-466]
 gi|308125860|ref|ZP_05777747.2| thymocyte nuclear protein 1 [Vibrio parahaemolyticus K5030]
 gi|308126318|ref|ZP_05909237.2| thymocyte nuclear protein 1 [Vibrio parahaemolyticus AQ4037]
 gi|308087187|gb|EFO36882.1| thymocyte nuclear protein 1 (Thymocyte protein Thy28) [Vibrio
           parahaemolyticus Peru-466]
 gi|308092767|gb|EFO42462.1| thymocyte nuclear protein 1 [Vibrio parahaemolyticus AN-5034]
 gi|308110599|gb|EFO48139.1| thymocyte nuclear protein 1 [Vibrio parahaemolyticus AQ4037]
 gi|308111042|gb|EFO48582.1| thymocyte nuclear protein 1 [Vibrio parahaemolyticus K5030]
          Length = 181

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 80/154 (51%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   + +    W GVRNYQARN MR +++VGD    YHS+ K  
Sbjct: 26  MAYWLFKTEPDTFS--IDTLRTQKVSCWEGVRNYQARNMMRDQVKVGDFVLIYHSSCKNV 83

Query: 59  EIVGIFEVITCTYP------------DPTAEQSSC-WECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YP            DP ++  +  W  VDI  V      + L  +KA 
Sbjct: 84  GVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDIEFVRKTARVIPLSVMKAM 143

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PVT DE+  +    KL
Sbjct: 144 PELENMPLVKRGNRLSIMPVTEDEWEAILGKEKL 177


>gi|161528994|ref|YP_001582820.1| hypothetical protein Nmar_1486 [Nitrosopumilus maritimus SCM1]
 gi|160340295|gb|ABX13382.1| protein of unknown function DUF55 [Nitrosopumilus maritimus SCM1]
          Length = 139

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 69/136 (50%), Gaps = 5/136 (3%)

Query: 3   YWLVKSEPS-EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           YWL K EPS    +  +Q K      W GV N  A  +MR+M+ GD   FYH+   R+ V
Sbjct: 4   YWLAKQEPSGPRGYNFEQLKKDKTTVWDGVHNNLALKHMREMKPGDLVLFYHTGDERQAV 63

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI +V +  Y +P  E    +  VD+    ++  PV+L  +K N +     LI  SRLSV
Sbjct: 64  GIMQVTSKPYSNP-KEDVERFIVVDVKYKKALKRPVTLDEMKQNKKFKDWELIRISRLSV 122

Query: 122 QPVTT---DEYLEVCR 134
            PV     DE L++ +
Sbjct: 123 MPVPKPIWDEILKISQ 138


>gi|113477831|ref|YP_723892.1| hypothetical protein Tery_4432 [Trichodesmium erythraeum IMS101]
 gi|110168879|gb|ABG53419.1| protein of unknown function DUF55 [Trichodesmium erythraeum IMS101]
          Length = 151

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 76/151 (50%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP  +S   M+Q+K  +   W GVRNYQARN +R+M  GD  FFYHSN +  
Sbjct: 1   MKYWLIKSEPKTYSISDMKQEKNCI---WDGVRNYQARNFLRQMNQGDLAFFYHSNTRFP 57

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I+GI ++      DPT                +  W+ V +  V   P  +SL  +K  
Sbjct: 58  GIIGIVKIWESGVTDPTQFDPESKYYDPKSTPNAPRWQTVSVEFVEEFPKLISLADLKQQ 117

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
                ++++   +RLSV P+  +   ++  M
Sbjct: 118 FTGDELLVVRRGNRLSVMPIHENVAKKILDM 148


>gi|302877553|ref|YP_003846117.1| hypothetical protein Galf_0308 [Gallionella capsiferriformans ES-2]
 gi|302580342|gb|ADL54353.1| protein of unknown function DUF55 [Gallionella capsiferriformans
           ES-2]
          Length = 154

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 71/141 (50%), Gaps = 19/141 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP++ S            AW GVRNYQARN MR +M +GD   FYHSN K  
Sbjct: 1   MRYWLMKSEPADVSIDDLASFPDQSVAWYGVRNYQARNFMRDQMAIGDGVLFYHSNCKIP 60

Query: 59  EIVGIFEVITCTYPD--------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKA 104
            I GI  V T  YPD               T EQ   W  VD+  V  +P  +SL  ++ 
Sbjct: 61  GIAGIARVSTTAYPDAKQYDQTSKYFDEKATPEQPR-WFNVDVQLVKKIPL-ISLSELRL 118

Query: 105 NPRLSSM-ILIVSSRLSVQPV 124
           +P L  M  L   +RLS+ P+
Sbjct: 119 HPELERMRTLQQGNRLSITPL 139


>gi|254432454|ref|ZP_05046157.1| hypothetical protein CPCC7001_2347 [Cyanobium sp. PCC 7001]
 gi|197626907|gb|EDY39466.1| hypothetical protein CPCC7001_2347 [Cyanobium sp. PCC 7001]
          Length = 159

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 68/139 (48%), Gaps = 17/139 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MAYWL+KSEP  +     + +G     W G+RNYQARN MR M  GD  FFYHSN +   
Sbjct: 9   MAYWLMKSEPEVYGIDDLEREGST--LWDGIRNYQARNFMRSMEPGDLAFFYHSNTQPPG 66

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ EVI     DPT                S  W+C  +    + P  +SL  ++   
Sbjct: 67  IVGLMEVIETGLIDPTQFDPASKYFDAAAKRDSPRWDCARLRYRRTFPALLSLDVLRERF 126

Query: 107 RLSSM-ILIVSSRLSVQPV 124
               + ++   +RLS+ PV
Sbjct: 127 DPEQLGVVKRGNRLSILPV 145


>gi|224823408|ref|ZP_03696517.1| protein of unknown function DUF55 [Lutiella nitroferrum 2002]
 gi|224603863|gb|EEG10037.1| protein of unknown function DUF55 [Lutiella nitroferrum 2002]
          Length = 152

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 80/151 (52%), Gaps = 21/151 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA--WTGVRNYQARNNMRK-MRVGDKGFFYHSN-K 56
           M YWL+KSEP E S  +     R G+A  WTGVRNYQARN MR  M+ GD+  F+HS+  
Sbjct: 1   MRYWLMKSEPDEVS--IDHLAARPGQAFEWTGVRNYQARNFMRDAMQPGDRVLFWHSSCP 58

Query: 57  GREIVGIFEVITCTYPD--------PTAEQSSC-----WECVDICAVCSMPCPVSLMAIK 103
              I G+ EV+T  + D        P  +  S      W CVD+  +      +S   ++
Sbjct: 59  EPGIAGLAEVVTAAHADSSQFDPDSPYFDPKSTTDAPRWLCVDVRFLTKTRL-LSPAELR 117

Query: 104 ANPRLSSM-ILIVSSRLSVQPVTTDEYLEVC 133
            +P L+ M +L   +RLS+ PV+ DE+  + 
Sbjct: 118 GHPPLAGMTVLKRGNRLSITPVSADEWTYIT 148


>gi|32475480|ref|NP_868474.1| hypothetical protein RB8644 [Rhodopirellula baltica SH 1]
 gi|32446022|emb|CAD75838.1| conserved hypothetical protein [Rhodopirellula baltica SH 1]
          Length = 159

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 78/158 (49%), Gaps = 21/158 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+K+EP+ +S     ++      W GVRNYQARN +R ++  GD+  FYHS  K  
Sbjct: 1   MKYWLMKTEPNTFSIDDLAEQPEQITCWEGVRNYQARNLLRDEIEEGDQVLFYHSACKTP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLM----- 100
            +VG+  V    YPD  A               S  W  VDI     +  PV+L      
Sbjct: 61  AVVGLATVSRGGYPDHHAFDKKSHYFDPKSNPDSPTWYMVDIKLNKKLERPVTLAELREE 120

Query: 101 AIKANPRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGK 137
           A KA   L  M+L+   SRLSVQPV+  ++  V ++ +
Sbjct: 121 ATKARSPLVDMVLLQKGSRLSVQPVSKKQFDRVVKLSE 158


>gi|153838755|ref|ZP_01991422.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Vibrio
           parahaemolyticus AQ3810]
 gi|149747841|gb|EDM58725.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Vibrio
           parahaemolyticus AQ3810]
          Length = 209

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 80/154 (51%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   + +    W GVRNYQARN MR +++VGD    YHS+ K  
Sbjct: 54  MAYWLFKTEPDTFS--IDTLRTQKVSCWEGVRNYQARNMMRDQVKVGDFVLIYHSSCKNV 111

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YP            DP ++  +  W  VDI  V      + L  +KA 
Sbjct: 112 GVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDIEFVRKTVRVIPLSVMKAM 171

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PVT DE+  +    KL
Sbjct: 172 PELENMPLVKRGNRLSIMPVTEDEWEAILGKEKL 205


>gi|319796239|ref|YP_004157879.1| hypothetical protein Varpa_5614 [Variovorax paradoxus EPS]
 gi|315598702|gb|ADU39768.1| protein of unknown function DUF55 [Variovorax paradoxus EPS]
          Length = 153

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 75/149 (50%), Gaps = 17/149 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREI 60
           YWL+KSEP E S            AWTGVRNYQARN MR  M++GD   FYHS+     I
Sbjct: 4   YWLMKSEPDEVSIDDALAAPDATVAWTGVRNYQARNFMRDGMKIGDGVLFYHSSCPEPGI 63

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI  V +   PDPT              ++   W  VD+ A+      ++L  ++A P 
Sbjct: 64  AGIARVASGIKPDPTQFDAKSPYYDAASKKEDPRWLLVDVQAMRKTRL-LALPELRAKPE 122

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           L+ +I++   +RLS+ PV    +  + +M
Sbjct: 123 LAELIILRKGNRLSITPVEPAHWKVIEKM 151


>gi|312795345|ref|YP_004028267.1| hypothetical protein RBRH_03143 [Burkholderia rhizoxinica HKI 454]
 gi|312167120|emb|CBW74123.1| Hypothetical protein RBRH_03143 [Burkholderia rhizoxinica HKI 454]
          Length = 169

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M YW++KSEP E S             WTGVRNYQARN MR  M+ GD   FYHS+    
Sbjct: 15  MHYWVMKSEPDEASIDDLAASPTRTLPWTGVRNYQARNFMRDGMQPGDGVLFYHSSCAEP 74

Query: 60  -IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT   ++              W  VD+  V  +   + L  ++ +
Sbjct: 75  GIAGLAEVASGPYPDPTQFDAASPYYDPKSRRDAPRWLLVDVRFVKKLRL-IPLSELRTH 133

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L+ M +L   +RLS+ PVT D++
Sbjct: 134 AALADMQVLARGNRLSITPVTPDQW 158


>gi|119896926|ref|YP_932139.1| hypothetical protein azo0635 [Azoarcus sp. BH72]
 gi|119669339|emb|CAL93252.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 159

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 77/150 (51%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP + S      +      W GVRNYQARN MR +M+VGD  FFYHS+    
Sbjct: 1   MRYWLMKSEPDDCSIDDLARRPGSTVPWYGVRNYQARNLMRDQMQVGDAVFFYHSSCPQP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  V +  YPD T               ++  W  VD+  V   P  V L  ++++
Sbjct: 61  GIAGIARVSSPAYPDATQFDPASPYHDPKSTPEAPRWLNVDVQFVRKTPL-VPLAELRSH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L  ++RLS+ PV   E+  + R
Sbjct: 120 TELANMRVLARANRLSITPVDPAEWRFITR 149


>gi|121594448|ref|YP_986344.1| hypothetical protein Ajs_2092 [Acidovorax sp. JS42]
 gi|120606528|gb|ABM42268.1| protein of unknown function DUF55 [Acidovorax sp. JS42]
          Length = 159

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 74/149 (49%), Gaps = 17/149 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           +WL+KSEP E S             WTGVRNYQARN MR +M+VGD   FYHS+     I
Sbjct: 8   FWLMKSEPDECSIDDALGAPGATVPWTGVRNYQARNFMRDEMQVGDGVLFYHSSCPAPGI 67

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
            GI  + +   PDPT                   W   D+ AV      + L  ++A+P 
Sbjct: 68  AGIARIASGVRPDPTQFDPESPYYDPKSPLEKPRWLLRDVQAVRKTRL-IGLAELRAHPE 126

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCRM 135
           L+SM +L   +RLS+ P+ + E+  + R+
Sbjct: 127 LASMRVLQRGNRLSITPLQSQEWTFITRV 155


>gi|226946745|ref|YP_002801818.1| hypothetical protein Avin_47380 [Azotobacter vinelandii DJ]
 gi|226721672|gb|ACO80843.1| Conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 135

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 68/123 (55%), Gaps = 15/123 (12%)

Query: 28  WTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE-IVGIFEVITCTYPDPTA---------- 76
           W GVRNYQARN +R M+ G+  FFYHS+  R  IVGI  +++  YPDP+A          
Sbjct: 12  WDGVRNYQARNFLRSMQPGELFFFYHSSCPRPGIVGIGRIVSGAYPDPSALEPQSPYFDA 71

Query: 77  ---EQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
               + + W  VD+  V +    + LM +++ P L+ + +L   +RLSV PV+  E+  V
Sbjct: 72  KAGAERNPWVAVDVEFVEAFGDVIELMRLRSTPDLAQLPLLKKGNRLSVMPVSAGEWAAV 131

Query: 133 CRM 135
             +
Sbjct: 132 LAL 134


>gi|99034708|ref|ZP_01314644.1| hypothetical protein Wendoof_01000542 [Wolbachia endosymbiont of
          Drosophila willistoni TSC#14030-0811.24]
          Length = 86

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 4/76 (5%)

Query: 1  MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
          M +WL+KSEPSE+SW+ + +K +V E W GVRNYQA+N M+ M+  D  FFYH+ K + I
Sbjct: 1  MQFWLLKSEPSEYSWQ-KMEKEQVVE-WDGVRNYQAQNYMKIMKASDLAFFYHTGKEKAI 58

Query: 61 VGIFEVITCTYP--DP 74
          +GI EV    Y   DP
Sbjct: 59 LGIVEVFKEYYHVNDP 74


>gi|239817894|ref|YP_002946804.1| hypothetical protein Vapar_4934 [Variovorax paradoxus S110]
 gi|239804471|gb|ACS21538.1| protein of unknown function DUF55 [Variovorax paradoxus S110]
          Length = 153

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 73/149 (48%), Gaps = 17/149 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREI 60
           YWL+KSEP E S            AWTGVRNYQARN MR  M+VGD   FYHS+     I
Sbjct: 4   YWLMKSEPDEVSIDDALAAPNATVAWTGVRNYQARNFMRDGMKVGDGVLFYHSSCPEPGI 63

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI  V +   PDPT              +    W  VD+ AV      + L  ++A P 
Sbjct: 64  AGIARVASGIKPDPTQFDPKSPYYDPASKKDDPRWLLVDVQAVRKTRL-LPLPELRARPE 122

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           L+ ++++   +RLS+ PV    +  + +M
Sbjct: 123 LADLVVLRKGNRLSITPVEPAHWRVIEKM 151


>gi|255610050|ref|XP_002539126.1| conserved hypothetical protein [Ricinus communis]
 gi|223508498|gb|EEF23256.1| conserved hypothetical protein [Ricinus communis]
          Length = 153

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEPS+ S             W GVRNYQARN MR +M+VGD   FYHSN    
Sbjct: 3   MRYWLMKSEPSDVSIDDLASFPNQTVDWYGVRNYQARNFMRDQMQVGDGVLFYHSNCDEP 62

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EVI   YPD T               ++  W  VD+  V      +SL  ++  
Sbjct: 63  GIAGIAEVIRMAYPDRTQFIEGHKYFDPKATAENPRWFNVDVKLVRKTRL-LSLKELRDT 121

Query: 106 PRLSSM-ILIVSSRLSVQPV 124
           P L+++ IL   +RLS+ PV
Sbjct: 122 PELTNLRILQKGNRLSITPV 141


>gi|56750598|ref|YP_171299.1| hypothetical protein syc0589_d [Synechococcus elongatus PCC 6301]
 gi|81299762|ref|YP_399970.1| hypothetical protein Synpcc7942_0953 [Synechococcus elongatus PCC
           7942]
 gi|56685557|dbj|BAD78779.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gi|81168643|gb|ABB56983.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
          Length = 154

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 72/143 (50%), Gaps = 19/143 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           MA+WL+KSEP  +      D  R GE  W GVRNYQARN +R+M VGD+ FFYHSN K  
Sbjct: 1   MAFWLLKSEPDVYGIA---DLEREGETLWDGVRNYQARNFLRQMAVGDRAFFYHSNTKPP 57

Query: 59  EIVGIFEVITC------------TYPDPTAEQSS-CWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+  V                Y DP ++  +  W  V +         ++L  ++A 
Sbjct: 58  GIVGLMTVSATEQVDPSQFDPDSDYYDPRSQADNPTWITVKLIFGDRFQPGLTLAELRAE 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTD 127
                ++++   +RLSV PV  D
Sbjct: 118 FTTEDLLILRPGNRLSVTPVEED 140


>gi|91774482|ref|YP_544238.1| hypothetical protein Mfla_0126 [Methylobacillus flagellatus KT]
 gi|91708469|gb|ABE48397.1| protein of unknown function DUF589 [Methylobacillus flagellatus KT]
          Length = 152

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 77/151 (50%), Gaps = 17/151 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M YWL+KSEPS+ S             W GVRNYQARN MR +M+VGD   FYHSN    
Sbjct: 1   MRYWLMKSEPSDVSIDDLASFPNQTVDWYGVRNYQARNFMRDQMKVGDGVLFYHSNCAEP 60

Query: 60  -IVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV    YP            DP A  ++  W  VD+  V      +SL  ++A 
Sbjct: 61  GIVGIAEVSKQAYPDRFQFIEGHKYYDPKATPENPRWFNVDVKLVRKTRL-LSLKELRAT 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRM 135
           P L ++ IL   +RLS+ PV   ++  + ++
Sbjct: 120 PELQNLRILQRGNRLSITPVDPRDWEFIMKL 150


>gi|209523277|ref|ZP_03271833.1| protein of unknown function DUF55 [Arthrospira maxima CS-328]
 gi|209496428|gb|EDZ96727.1| protein of unknown function DUF55 [Arthrospira maxima CS-328]
          Length = 155

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 70/143 (48%), Gaps = 19/143 (13%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           M YWL+KSE   +S  +MQ D   +   W GVRNY ARN +RKM+V D  FFYHSN K  
Sbjct: 1   MVYWLIKSEEKTYSIDQMQSDTTCI---WDGVRNYMARNFLRKMQVNDLCFFYHSNTKIP 57

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            IVG+  VI     DPT    +              W  V +  +   P  +SL  +K  
Sbjct: 58  GIVGLVRVIESDIVDPTQFDENSPYYDPKATANHPRWYTVRVEFIDKFPQMISLGDLKQQ 117

Query: 106 PRLSSMILI-VSSRLSVQPVTTD 127
                ++L+   +RLSV P+  D
Sbjct: 118 FDPDDLLLVRRGNRLSVMPIRVD 140


>gi|319788229|ref|YP_004147704.1| hypothetical protein Psesu_2644 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466741|gb|ADV28473.1| protein of unknown function DUF55 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 158

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 72/143 (50%), Gaps = 22/143 (15%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  RVG E W GVRNYQARN MR  M+VGD   FYHSN K   
Sbjct: 7   YWLMKSEPDAFSI---DDLERVGTEPWNGVRNYQARNFMRDGMKVGDGVLFYHSNTKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI +V +  YPD T               +   W  VD+     +   + L  IK + 
Sbjct: 64  IVGIAKVASEAYPDETQFDPRSDYHDPKATREQPRWFLVDVSFERKLGRTIPLDEIKQHA 123

Query: 107 -RLSSMILIVS--SRLSVQPVTT 126
             L     +V+  +RLSV PVT 
Sbjct: 124 DELGEGFPLVARGNRLSVFPVTA 146


>gi|326317214|ref|YP_004234886.1| hypothetical protein Acav_2407 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323374050|gb|ADX46319.1| Uncharacterized protein family UPF0310 [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 171

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREI 60
           YWL+KSEP E S             WTGVRNYQARN MR  M+VGD   FYHS+     I
Sbjct: 19  YWLMKSEPDECSIDDALAAPGATVPWTGVRNYQARNFMRDAMQVGDGVLFYHSSCPEPGI 78

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
            GI  V + T PDPT    +              W  +D+ A+      V L  ++ +P 
Sbjct: 79  AGIARVASGTRPDPTQFDPASPYYDPKSTPARPRWLLLDVQALRKTRL-VGLAELREHPA 137

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
           L+ M +L   +RLS+ PV   E+ ++ +
Sbjct: 138 LAGMRVLQRGNRLSITPVEPGEWEKIVQ 165


>gi|319762927|ref|YP_004126864.1| hypothetical protein Alide_2241 [Alicycliphilus denitrificans BC]
 gi|317117488|gb|ADU99976.1| protein of unknown function DUF55 [Alicycliphilus denitrificans BC]
          Length = 168

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 71/148 (47%), Gaps = 17/148 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL+KSEP E S             WTGVRNYQARN MR +MR+GD   FYHS      I
Sbjct: 10  YWLMKSEPDECSIDDALAAPGATVPWTGVRNYQARNFMRDEMRIGDGVLFYHSGCPEPGI 69

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
            GI  V +    DPT    +              W  +D+ A+      V L  ++A+P 
Sbjct: 70  AGIARVASGVRADPTQFDPASPYYDPKATPGKPRWLLLDVQAIRKTRL-VRLAELRAHPA 128

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
           L+ M +L   +RLS+ PV   E+  + R
Sbjct: 129 LAEMRVLQRGNRLSITPVQEQEWAAILR 156


>gi|28198703|ref|NP_779017.1| hypothetical protein PD0798 [Xylella fastidiosa Temecula1]
 gi|182681394|ref|YP_001829554.1| hypothetical protein XfasM23_0843 [Xylella fastidiosa M23]
 gi|28056794|gb|AAO28666.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182631504|gb|ACB92280.1| protein of unknown function DUF55 [Xylella fastidiosa M23]
          Length = 155

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 73/145 (50%), Gaps = 20/145 (13%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL+KSEP  +S    Q  G   E W GVRNYQARN +R K+ +GD   FYHSN K   I
Sbjct: 6   YWLMKSEPDAFSIDDLQQVGT--EPWNGVRNYQARNFIRDKIHIGDGVLFYHSNCKPPGI 63

Query: 61  VGIFEVITCTYP------------DPTAEQSSC-WECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ ++ +  YP            DP A +    W  VDI     +   ++L  IK   +
Sbjct: 64  VGLAKIASAAYPDESQFDPNSDYYDPKANREQPRWYLVDIAFERKLARTITLENIKQYAK 123

Query: 108 LSSM---ILIVSSRLSVQPVTTDEY 129
                  ++   +RLSV PVTT ++
Sbjct: 124 TLGEGFPLITRGNRLSVFPVTTSQW 148


>gi|284051924|ref|ZP_06382134.1| hypothetical protein AplaP_10676 [Arthrospira platensis str.
           Paraca]
 gi|291571377|dbj|BAI93649.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 155

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 70/142 (49%), Gaps = 17/142 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M+YWL+KSE  E ++ + Q +      W GVRNY ARN +RKM+V D  FFYHSN K   
Sbjct: 1   MSYWLIKSE--EKTYSIDQMQSEQTCIWDGVRNYMARNFLRKMQVNDLCFFYHSNTKIPG 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+  VI     DPT    +              W  + +  V   P  +SL  +K   
Sbjct: 59  IVGLVRVIESNIVDPTQFDENSPYYDPKATANHPRWYTIRVEFVDKFPQMISLGDLKQKF 118

Query: 107 RLSSMILI-VSSRLSVQPVTTD 127
               ++L+   +RLSV P+  D
Sbjct: 119 DPDELLLVRRGNRLSVMPIRVD 140


>gi|166367728|ref|YP_001660001.1| hypothetical protein MAE_49870 [Microcystis aeruginosa NIES-843]
 gi|166090101|dbj|BAG04809.1| hypothetical protein MAE_49870 [Microcystis aeruginosa NIES-843]
          Length = 156

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 68/140 (48%), Gaps = 17/140 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           + YWL+KSEP  +S +  +  G+    W GVRNYQARN +R+M+ GD  FFYHSN     
Sbjct: 3   LNYWLMKSEPDVYSIEDLKKDGQT--IWEGVRNYQARNFLRQMKRGDLAFFYHSNTTPPG 60

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+  V+     DPT   +               W  V +      P  + L  +K N 
Sbjct: 61  IVGLMRVVQTDMIDPTQFDTDSPYYDSKSSPDYPRWWTVKVEFDRLFPQLLPLGILKQNF 120

Query: 107 RLSSMILI-VSSRLSVQPVT 125
               ++L+   +RLSV PV 
Sbjct: 121 TADELLLVRTGNRLSVMPVN 140


>gi|253995657|ref|YP_003047721.1| hypothetical protein Mmol_0284 [Methylotenera mobilis JLW8]
 gi|253982336|gb|ACT47194.1| protein of unknown function DUF55 [Methylotenera mobilis JLW8]
          Length = 152

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 57/140 (40%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEPS+ S             W GVRNYQARN MR +M+VGD   FYHSN    
Sbjct: 1   MRYWLMKSEPSDVSIDDLAGFENQTVDWYGVRNYQARNFMRDQMQVGDGVLFYHSNCDEP 60

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV T  YP            DP A  ++  W  VD+  V      +SL  ++  
Sbjct: 61  GIAGIAEVATLAYPDRLQFIEGHKYFDPKATPETPRWFNVDVKLVRKTRL-LSLKEMRET 119

Query: 106 PRLSSM-ILIVSSRLSVQPV 124
           P L ++ IL   +RLS+ PV
Sbjct: 120 PELENLRILQRGNRLSITPV 139


>gi|71897969|ref|ZP_00680174.1| Protein of unknown function DUF589 [Xylella fastidiosa Ann-1]
 gi|71732213|gb|EAO34268.1| Protein of unknown function DUF589 [Xylella fastidiosa Ann-1]
          Length = 155

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 73/145 (50%), Gaps = 20/145 (13%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL+KSEP  +S    Q  G   E W GVRNYQARN +R K+ +GD   FYHSN K   I
Sbjct: 6   YWLMKSEPDAFSIDDLQQVGT--EPWNGVRNYQARNFIRDKIHIGDGVLFYHSNCKPPGI 63

Query: 61  VGIFEVITCTYP------------DPTAEQSSC-WECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ ++ +  YP            DP A +    W  VDI     +   ++L  IK   +
Sbjct: 64  VGLAKIASAAYPDESQFDPNSDYYDPKANREQPRWYLVDIAFERKLARTITLENIKQYAK 123

Query: 108 LSSM---ILIVSSRLSVQPVTTDEY 129
                  ++   +RLSV PVTT ++
Sbjct: 124 TLGEGFPLITRGNRLSVFPVTTTQW 148


>gi|254230116|ref|ZP_04923512.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|151937361|gb|EDN56223.1| conserved hypothetical protein [Vibrio sp. Ex25]
          Length = 156

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 80/154 (51%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   + +    W GVRNYQARN MR +++VGD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IDTLRTQKVSCWEGVRNYQARNMMRDQVKVGDFVLIYHSSCKNV 58

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YP            DP ++  +  W  VD+  V      + L  +KA 
Sbjct: 59  GVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDVEFVRKTTRVIPLSVMKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PVT +E+  +    KL
Sbjct: 119 PELENMPLVKRGNRLSIMPVTEEEWEAILGKEKL 152


>gi|239994482|ref|ZP_04715006.1| hypothetical protein AmacA2_08344 [Alteromonas macleodii ATCC
           27126]
          Length = 154

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S      +    E W GVRNYQARN +R  ++ GDK F YHS+ K  
Sbjct: 1   MAYWLFKTEPDAFSIDDLASRPEQTEPWDGVRNYQARNFLRDGVKRGDKVFIYHSSCKLV 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV+   YPD T             ++ +  W  VD+  V      + L  IK  
Sbjct: 61  GIAGVAEVVRDGYPDTTQFNPESKYYDPKSSQDNPRWYRVDVKFVEKFSSVLPLSVIKTM 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
             ++ + L+    RLS+ PV   E+ ++    K
Sbjct: 121 DGITELPLVKKGGRLSIMPVEEAEWQQLYAAAK 153


>gi|86608368|ref|YP_477130.1| hypothetical protein CYB_0888 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556910|gb|ABD01867.1| conserved hypothetical protein [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 153

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 80/156 (51%), Gaps = 19/156 (12%)

Query: 1   MAYWLVKSEPSEWS-WKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           M YWL+KSEPS +S W +Q++   +   W GVRNYQARN ++ M+ GD+ FFYHSN +  
Sbjct: 1   MNYWLMKSEPSIYSIWDLQREGQTL---WDGVRNYQARNYLKAMQPGDRAFFYHSNAEPP 57

Query: 59  EIVGIFEVI------------TCTYPDPTAEQSSC-WECVDICAVCSMPCPVSLMAIKAN 105
            I G+ E++            T  Y DP +  +   W  V +  + +    + L  ++A 
Sbjct: 58  GIAGLMEILETHVVDPSQFDPTSPYYDPKSTPADPRWYTVRVQFLAAFERVIPLAKLRAT 117

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
                + ++   +RLSV PV  +    +  +  LS+
Sbjct: 118 FTPEELEVVRRGTRLSVIPVAAEVAERLLSLANLSS 153


>gi|302885659|ref|XP_003041721.1| hypothetical protein NECHADRAFT_96535 [Nectria haematococca mpVI
           77-13-4]
 gi|256722626|gb|EEU36008.1| hypothetical protein NECHADRAFT_96535 [Nectria haematococca mpVI
           77-13-4]
          Length = 181

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 61/129 (47%), Gaps = 18/129 (13%)

Query: 26  EAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPTAEQSSC--- 81
           E W G+RNY ARNNMR M VGD  FFY SN K   I+G  E++     D +A Q      
Sbjct: 38  EGWDGIRNYAARNNMRNMNVGDLAFFYASNCKEPGIMGTMEIVKEFSEDKSARQPGAPYY 97

Query: 82  ----------WECVDICAVCSMPCPVSLMAI----KANPRLSSMILIVSSRLSVQPVTTD 127
                     W+ V +        P+ L  +    K+   L +M LI  SRLSV  V+ D
Sbjct: 98  DPKSTKEKPIWDLVHVEFRKKFAVPIHLKELRELGKSGGPLEAMQLIKQSRLSVTKVSAD 157

Query: 128 EYLEVCRMG 136
           E+  +C + 
Sbjct: 158 EWNTLCELA 166


>gi|148242947|ref|YP_001228104.1| hypothetical protein SynRCC307_1848 [Synechococcus sp. RCC307]
 gi|147851257|emb|CAK28751.1| Conserved hypothetical protein [Synechococcus sp. RCC307]
          Length = 159

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 69/137 (50%), Gaps = 17/137 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           +WL+KSEP  +   +   K      W G+RNYQARN MR M VGD+ FFYHSN K   IV
Sbjct: 8   WWLMKSEPDVYG--IDHLKAEQTTLWDGIRNYQARNFMRSMTVGDRAFFYHSNAKPPGIV 65

Query: 62  GIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ EV+     DP             +  ++  W+CV +  V      +SL  ++ +   
Sbjct: 66  GLMEVVETGITDPSQFEPDNKYFDPKSKPEAPRWDCVKLRYVGRFAAMLSLDDLRQSFTE 125

Query: 109 SSMILIV-SSRLSVQPV 124
             + +I   +RLS+ PV
Sbjct: 126 DELGVIKRGNRLSILPV 142


>gi|187937171|ref|NP_001120782.1| thymocyte nuclear protein 1 [Xenopus (Silurana) tropicalis]
 gi|187469832|gb|AAI67126.1| thyn1 protein [Xenopus (Silurana) tropicalis]
          Length = 224

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 79/163 (48%), Gaps = 31/163 (19%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEA---------WTGVRNYQARNNMRKMRVGDKGFFYHS 54
           WL+KSEP     K    K  + +          W GVRNYQARN MR M++G + FFYHS
Sbjct: 56  WLMKSEPETRIEKGLDMKFGIEDLMAQPSQTACWDGVRNYQARNFMRAMKIGQQAFFYHS 115

Query: 55  N-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLM 100
           N K   I GI +++  +Y D T             ++ +  W  VD+  V  +   + L 
Sbjct: 116 NCKEPGIAGIVQIVKESYVDHTQFDPKNPHYDASSSQDNPKWSMVDVQFVRKLKRYIPLA 175

Query: 101 AIKA---NPR-----LSSMILIVSSRLSVQPVTTDEYLEVCRM 135
            +K    N +     L ++ L   +RLSVQP+T +E+  + ++
Sbjct: 176 ELKKLHLNDKSSGGPLRNIALFTRARLSVQPLTQEEFDFILKL 218


>gi|30249841|ref|NP_841911.1| hypothetical protein NE1889 [Nitrosomonas europaea ATCC 19718]
 gi|30180878|emb|CAD85800.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 153

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 76/147 (51%), Gaps = 21/147 (14%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA--WTGVRNYQARNNMR-KMRVGDKGFFYHSN-K 56
           M YWL+KSEPSE S  +     R G+   W GVRNYQARN MR +M+ GD  FFYHS+  
Sbjct: 1   MRYWLMKSEPSEVS--IDDLAARPGQTVPWDGVRNYQARNFMRNQMQPGDLVFFYHSSCP 58

Query: 57  GREIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIK 103
              I G+ EV    YPD T   S+              W  V++  +      +SL  ++
Sbjct: 59  EPGIAGVVEVSRLAYPDETQFDSASKYFDPKSTRENPRWFNVEVRFLRKTRL-LSLRELR 117

Query: 104 ANPRLSSM-ILIVSSRLSVQPVTTDEY 129
           + P L+ M IL   +RLS+ PV   E+
Sbjct: 118 SYPELAGMRILQKGNRLSITPVDPSEW 144


>gi|91227522|ref|ZP_01261859.1| hypothetical protein V12G01_09742 [Vibrio alginolyticus 12G01]
 gi|91188546|gb|EAS74838.1| hypothetical protein V12G01_09742 [Vibrio alginolyticus 12G01]
          Length = 156

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 80/154 (51%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   + +    W GVRNYQARN MR +++VGD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IDTLRTQKVSCWEGVRNYQARNMMRDQVKVGDLVLIYHSSCKHV 58

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YP            DP ++  +  W  VD+  V      + L  +KA 
Sbjct: 59  GVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDVEFVRKTARVIPLSVMKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PVT +E+  +    KL
Sbjct: 119 PELENMPLVKRGNRLSIMPVTEEEWDAILGKEKL 152


>gi|297690731|ref|XP_002822762.1| PREDICTED: thymocyte nuclear protein 1-like isoform 1 [Pongo
           abelii]
 gi|297690733|ref|XP_002822763.1| PREDICTED: thymocyte nuclear protein 1-like isoform 2 [Pongo
           abelii]
          Length = 211

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 75/155 (48%), Gaps = 31/155 (20%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN  R M++G+  FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNLFRAMKLGEAAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   I  + +++   YPD T              E +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIARLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVT 125
           L  +K+  +        L +M+L    RLS+QP+T
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLT 209


>gi|297537375|ref|YP_003673144.1| hypothetical protein M301_0179 [Methylotenera sp. 301]
 gi|297256722|gb|ADI28567.1| protein of unknown function DUF55 [Methylotenera sp. 301]
          Length = 152

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/145 (38%), Positives = 71/145 (48%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEPS+ S             W G+RNYQARN MR +M+VGD  FFYHSN    
Sbjct: 1   MRYWLMKSEPSDVSIDDLAGFPNQSVDWYGIRNYQARNFMRDQMKVGDGVFFYHSNCDVP 60

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV    YPD                 ++  W  VD+  V      +SL  ++  
Sbjct: 61  GIAGIAEVSKLAYPDRLQFIKGHKYYDEKATPENPRWLNVDVKLVRKTRL-LSLKELREY 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
           P L +M IL   +RLS+ PV   E+
Sbjct: 120 PELINMRILQRGNRLSITPVDPKEW 144


>gi|328950543|ref|YP_004367878.1| Uncharacterized protein family UPF0310 [Marinithermus
           hydrothermalis DSM 14884]
 gi|328450867|gb|AEB11768.1| Uncharacterized protein family UPF0310 [Marinithermus
           hydrothermalis DSM 14884]
          Length = 156

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 70/143 (48%), Gaps = 19/143 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP  +S     D  R G A W GVRNYQARN +R+M+  D  FFYHSN +  
Sbjct: 1   MRYWLLKSEPETYSI---DDLAREGRAVWDGVRNYQARNFLREMQEDDLAFFYHSNARPP 57

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VG+  V+     DPT               ++  W  V++  V   P  V L  ++  
Sbjct: 58  GVVGLARVVRAGVVDPTQFDPQSPYYDPKATPEAPRWHTVEVAFVRRFPRMVPLSTLREV 117

Query: 106 PRLSSM-ILIVSSRLSVQPVTTD 127
                + IL   +RLSV PV  +
Sbjct: 118 FTPEELWILRRGNRLSVVPVPEE 140


>gi|240975908|ref|XP_002402204.1| thymocyte nuclear protein, putative [Ixodes scapularis]
 gi|215491123|gb|EEC00764.1| thymocyte nuclear protein, putative [Ixodes scapularis]
          Length = 157

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 71/139 (51%), Gaps = 25/139 (17%)

Query: 28  WTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPT---------- 75
           W GVRNYQARN MR  M+ G + FFYHSN K   IVGI EV+  +YPD T          
Sbjct: 18  WDGVRNYQARNYMRDGMKKGHQCFFYHSNCKVPGIVGIVEVVRESYPDHTQFDKKSGHYD 77

Query: 76  ---AEQSSCWECVDICAVCSMPCPVSLMAIKA----------NPRLSSMILIVSSRLSVQ 122
                ++  W  VD+  V  +  PV+L  +K              L++M L+  SRLSVQ
Sbjct: 78  KTSTRENPRWCMVDVKFVRKLTRPVTLPELKKLHEQHAASSEKGPLANMALLTRSRLSVQ 137

Query: 123 PVTTDEYLEVCRMGKLSNP 141
           PVT +E+  +  +   + P
Sbjct: 138 PVTEEEWNFILSLEGANGP 156


>gi|253997873|ref|YP_003049936.1| hypothetical protein Msip34_0160 [Methylovorus sp. SIP3-4]
 gi|253984552|gb|ACT49409.1| protein of unknown function DUF55 [Methylovorus sp. SIP3-4]
          Length = 153

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 75/151 (49%), Gaps = 17/151 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP + S             W GVRNYQARN MR +M+VGD   FYHSN    
Sbjct: 1   MRYWLMKSEPGDVSIDDLAGFPNQTVDWYGVRNYQARNFMRDQMKVGDGVLFYHSNCAEP 60

Query: 60  -IVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV    YP            DP A  ++  W  VD+  V      +SL  ++  
Sbjct: 61  GIVGIAEVSRLAYPDRLQFVEGHKYYDPKATPENPRWFNVDVKLVRKTRL-LSLKEMRET 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRM 135
           P L S+ IL   +RLS+ PV   E+  + ++
Sbjct: 120 PELESLRILQRGNRLSITPVDPREWNFIMKL 150


>gi|222110857|ref|YP_002553121.1| hypothetical protein Dtpsy_1663 [Acidovorax ebreus TPSY]
 gi|221730301|gb|ACM33121.1| protein of unknown function DUF55 [Acidovorax ebreus TPSY]
          Length = 159

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 73/149 (48%), Gaps = 17/149 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           +WL+KSEP E S             WTGVRNYQARN MR +M+VGD   FYHS+     I
Sbjct: 8   FWLMKSEPDECSIDDALGAPGATVPWTGVRNYQARNFMRDEMQVGDGVLFYHSSCPAPGI 67

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
            GI  + +   PDPT                   W   D+ AV      + L  ++A+P 
Sbjct: 68  AGIARIASGVRPDPTQFDPESPYYDPKSPLEKPRWLLRDVQAVRKTRL-IGLAELRAHPE 126

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCRM 135
           L+SM +L   +RLS+ P+   E+  + ++
Sbjct: 127 LASMRVLQRGNRLSITPLQPQEWTFITQV 155


>gi|88861192|ref|ZP_01135825.1| hypothetical protein PTD2_00322 [Pseudoalteromonas tunicata D2]
 gi|88816785|gb|EAR26607.1| hypothetical protein PTD2_00322 [Pseudoalteromonas tunicata D2]
          Length = 152

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 18/151 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S     +K      W GVRNYQARN +R  + +GD  F YHS+ K  
Sbjct: 1   MAYWLFKTEPDVFSITDLAEKNTAD--WEGVRNYQARNFLRDGVALGDLVFIYHSSCKQP 58

Query: 59  EIVGIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI  +    + DP             ++  S  W  V +  V     P++L  +KA+
Sbjct: 59  AIVGIAAISKSAHIDPSQFDPSSEYFDKKSSSDSPRWLQVSVEFVEQFKQPITLTKLKAD 118

Query: 106 PRLSSMILIVSS-RLSVQPVTTDEYLEVCRM 135
             L+  IL     RLSV PVT +++  +  M
Sbjct: 119 LNLTDFILTQKGCRLSVMPVTPEQWHYITNM 149


>gi|320106171|ref|YP_004181761.1| hypothetical protein AciPR4_0934 [Terriglobus saanensis SP1PR4]
 gi|319924692|gb|ADV81767.1| protein of unknown function DUF55 [Terriglobus saanensis SP1PR4]
          Length = 125

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 69/127 (54%), Gaps = 10/127 (7%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           +L+KSEP+++S+    D  R GE  W G+ N QA   +R M+ G+K   YHSN G+E VG
Sbjct: 3   YLLKSEPNKYSF---DDLIRDGETTWDGIANNQALLYLRGMKKGEKLVIYHSNIGKEAVG 59

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
             +V++    DP   +      V I  V ++  P SL  IKA    +  IL    RLSV 
Sbjct: 60  TAKVVSVDASDPKDPK------VIIKPVKALKTPKSLADIKAAGVFTDSILFRQFRLSVV 113

Query: 123 PVTTDEY 129
           P+T ++Y
Sbjct: 114 PLTDEQY 120


>gi|84622681|ref|YP_450053.1| hypothetical protein XOO_1024 [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|84366621|dbj|BAE67779.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 147

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 69/140 (49%), Gaps = 22/140 (15%)

Query: 6   VKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREIVG 62
           +KSEP  +S     D  RVG E W GVRNYQARN MR  M VGD  FFYHSN K   IVG
Sbjct: 1   MKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMHVGDDVFFYHSNCKVPGIVG 57

Query: 63  IFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK--ANPR 107
           + +V +  YPD T                   W  VD+     +   +SL AIK  A+  
Sbjct: 58  LAKVASAAYPDDTQFDPKSDYYDPKSTRDDPRWMLVDVAFERKLTRTISLDAIKQQADAL 117

Query: 108 LSSMILIV-SSRLSVQPVTT 126
                LI   +RLS+ PVT 
Sbjct: 118 GEGFPLIARGNRLSILPVTA 137


>gi|163803619|ref|ZP_02197484.1| hypothetical protein 1103602000425_AND4_16564 [Vibrio sp. AND4]
 gi|159172567|gb|EDP57427.1| hypothetical protein AND4_16564 [Vibrio sp. AND4]
          Length = 156

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 81/154 (52%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  ++  + +    W GVRNYQARN MR ++++GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IETLRIQKVSCWEGVRNYQARNMMRDQVKLGDLVLIYHSSCKNV 58

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V    YP            DP ++ +S  W  VDI  V      + L  +KA 
Sbjct: 59  GVAGIAKVTREAYPDHFQFDVESDYYDPKSDPESPRWIMVDIEFVRKTERLIPLSVMKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PV+ +E+  +    KL
Sbjct: 119 PELENMPLVKRGNRLSIMPVSEEEWQAILGKEKL 152


>gi|170079281|ref|YP_001735919.1| hypothetical protein SYNPCC7002_A2688 [Synechococcus sp. PCC
          7002]
 gi|169886950|gb|ACB00664.1| conserved hypothetical protein (DUF589) [Synechococcus sp. PCC
          7002]
          Length = 150

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 47/76 (61%), Gaps = 3/76 (3%)

Query: 1  MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
          M YWL+KSEPSE+S       G   E W GVRNYQARN +++M  GD+ FFYHSN K   
Sbjct: 1  MRYWLIKSEPSEYSLADLAADG--TELWDGVRNYQARNFLQQMEKGDRLFFYHSNTKSPG 58

Query: 60 IVGIFEVITCTYPDPT 75
          IVG+  V      DP+
Sbjct: 59 IVGLASVTQTNLVDPS 74


>gi|84393551|ref|ZP_00992305.1| hypothetical protein V12B01_06201 [Vibrio splendidus 12B01]
 gi|84375830|gb|EAP92723.1| hypothetical protein V12B01_06201 [Vibrio splendidus 12B01]
          Length = 155

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 75/145 (51%), Gaps = 18/145 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +Q  + +    W GVRNYQARN MR  +++GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IQTLRVQKTSCWEGVRNYQARNMMRDDVKLGDLVMIYHSSCKKV 58

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V    YPD              +++ +  W  VD+  V      + L  +KA 
Sbjct: 59  GVAGIAKVTKEAYPDHFQFDPESDYYDAKSSQDNPRWIMVDVEFVRVTERLIPLATLKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEY 129
           P L+ M L+   +RLS+ PVT  E+
Sbjct: 119 PELAEMPLVKRGNRLSIMPVTEQEW 143


>gi|46119295|ref|XP_384938.1| hypothetical protein FG04762.1 [Gibberella zeae PH-1]
          Length = 405

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 71/153 (46%), Gaps = 26/153 (16%)

Query: 3   YWLVKSEPSEW-----SWKMQQDKGRVG---EAWTGVRNYQARNNMRKMRVGDKGFFYHS 54
           YWL+K+EP          K   D  R     E W G+R Y ARNNMRKM  GD  FFY S
Sbjct: 229 YWLMKAEPETRIENGVDVKFSIDDLRAKTEPEGWDGIRAYAARNNMRKMNAGDLAFFYAS 288

Query: 55  N-KGREIVGIFEVI------------TCTYPDP-TAEQSSCWECVDICAVCSMPCPVSLM 100
           N K   IVG+ E++            +  Y DP + ++   W+ V +         + L 
Sbjct: 289 NCKEPGIVGVMEIVKEFSEDRSARKPSAPYYDPKSTKEKPIWDLVHVEFRKKFAVQIGLK 348

Query: 101 AI----KANPRLSSMILIVSSRLSVQPVTTDEY 129
            +    KA   L +M L+  SRLSV  V+ DE+
Sbjct: 349 ELKELGKAGGPLETMQLLKQSRLSVSQVSGDEF 381


>gi|323495286|ref|ZP_08100367.1| hypothetical protein VIBR0546_08647 [Vibrio brasiliensis LMG 20546]
 gi|323310463|gb|EGA63646.1| hypothetical protein VIBR0546_08647 [Vibrio brasiliensis LMG 20546]
          Length = 156

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 75/154 (48%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S    + + R    W GVRNYQARN MR +++ GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFSIDTLRTQNR--SCWEGVRNYQARNMMRDQVKEGDLVLIYHSSCKKV 58

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YPD  A                  W  VDI  V      + L  +KA 
Sbjct: 59  GVAGIAKVVKEAYPDHFAFDPESDYYDPKSTPDNPRWIMVDIEFVRKTERLIPLSVMKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PV+  E+  +    KL
Sbjct: 119 PELENMPLVKRGNRLSIMPVSESEWDAILDKEKL 152


>gi|226491506|ref|NP_001143946.1| hypothetical protein LOC100276759 [Zea mays]
 gi|195630671|gb|ACG36642.1| hypothetical protein [Zea mays]
          Length = 180

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 68/142 (47%), Gaps = 8/142 (5%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG---RE 59
           YWL+K+EP EWSW  Q         W GVRN QA N++  MR GD+  FYHS  G   R 
Sbjct: 23  YWLLKTEPGEWSWSDQARAPGGVAPWDGVRNRQAMNSLXAMRPGDRCLFYHSGAGAASRR 82

Query: 60  IVGIFEVITCTY-PDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANP----RLSSMILI 114
           +VG+ EV    Y  +   E++     VD+ AV     PV L  IK        +    L+
Sbjct: 83  VVGVVEVARPWYEGEGEGEEAVAGGAVDVRAVGQFRSPVPLGVIKKAAGEVEGMKDFALL 142

Query: 115 VSSRLSVQPVTTDEYLEVCRMG 136
             +RLSV  V    +  VC  G
Sbjct: 143 RQARLSVMXVPAKIWDWVCDAG 164


>gi|254521465|ref|ZP_05133520.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Stenotrophomonas sp. SKA14]
 gi|219719056|gb|EED37581.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Stenotrophomonas sp. SKA14]
          Length = 159

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 78/156 (50%), Gaps = 22/156 (14%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  +V  E W GVRNYQARN MR  M+VGD   FYHSN K   
Sbjct: 7   YWLMKSEPDAFSI---DDLAKVKVEPWNGVRNYQARNFMRDGMQVGDGILFYHSNTKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+  V +  YPD T               ++  W  VD+     +   ++L  IK + 
Sbjct: 64  IVGLATVASAAYPDDTQFDPASDYHDPKSTRENPRWMLVDVAFDRKLKQVIALDEIKLHA 123

Query: 107 -RLSSMILIVS--SRLSVQPVTTDEYLEVCRMGKLS 139
             L     +V+  +RLSV PVT  ++  +  + K S
Sbjct: 124 DELGEGFPLVAKGNRLSVFPVTAAQWKLLLSLEKKS 159


>gi|93005995|ref|YP_580432.1| hypothetical protein Pcryo_1167 [Psychrobacter cryohalolentis K5]
 gi|92393673|gb|ABE74948.1| protein of unknown function DUF589 [Psychrobacter cryohalolentis
           K5]
          Length = 165

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 49/129 (37%), Positives = 66/129 (51%), Gaps = 17/129 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL+KS PS +S K  +  G   E W GVRNY+ARN MR  M+VGDK FFYHS+ K  
Sbjct: 1   MAYWLIKSNPSCFSIKDLEGAGT--EMWDGVRNYRARNFMRDDMQVGDKAFFYHSSAKPS 58

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI  +    YPD T               ++  W  VD+    +    + L  +K  
Sbjct: 59  GVAGIVTISQAGYPDITQFHPEHRHYDPKATAENPRWYMVDLTFNQAFNNILPLSELKFL 118

Query: 106 PRLSSMILI 114
           P L + +L+
Sbjct: 119 PTLENSLLL 127


>gi|148978762|ref|ZP_01815142.1| hypothetical protein VSWAT3_00190 [Vibrionales bacterium SWAT-3]
 gi|145962183|gb|EDK27467.1| hypothetical protein VSWAT3_00190 [Vibrionales bacterium SWAT-3]
          Length = 155

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 75/145 (51%), Gaps = 18/145 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +Q  + +    W GVRNYQARN MR ++++GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IQTLRVQKTSCWEGVRNYQARNMMRDEVKLGDLVMIYHSSCKKV 58

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V    YPD              ++  +  W  VD+  V      + L  +KA 
Sbjct: 59  GVAGIAKVTREAYPDHFQFDPESDYYDPKSSPDNPRWIMVDVEFVRVTERLIPLATLKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEY 129
           P LS M L+   +RLS+ PVT  E+
Sbjct: 119 PELSEMPLVKRGNRLSIMPVTEQEW 143


>gi|194367054|ref|YP_002029664.1| hypothetical protein Smal_3282 [Stenotrophomonas maltophilia
           R551-3]
 gi|194349858|gb|ACF52981.1| protein of unknown function DUF55 [Stenotrophomonas maltophilia
           R551-3]
          Length = 159

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 78/156 (50%), Gaps = 22/156 (14%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  +V  E W GVRNYQARN MR  M+VGD   FYHSN K   
Sbjct: 7   YWLMKSEPDAFSI---DDLAKVKVEPWNGVRNYQARNFMRDGMQVGDGILFYHSNTKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+  V +  YPD T               ++  W  VD+     +   ++L  IK + 
Sbjct: 64  IVGLATVASTAYPDDTQFDPKSDYHDPKSTRENPRWMLVDVAFDRKLKQVIALDEIKLHA 123

Query: 107 R-LSSMILIVS--SRLSVQPVTTDEYLEVCRMGKLS 139
             L     +V+  +RLSV PVT  ++  +  + K S
Sbjct: 124 EALGEGFPLVAKGNRLSVFPVTAAQWKLLLSLEKKS 159


>gi|294627127|ref|ZP_06705715.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294667400|ref|ZP_06732618.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292598560|gb|EFF42709.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292602841|gb|EFF46274.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 149

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 69/140 (49%), Gaps = 22/140 (15%)

Query: 6   VKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREIVG 62
           +KSEP  +S     D  RVG E W GVRNYQARN MR  M VGD  FFYHSN K   IVG
Sbjct: 1   MKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMHVGDGVFFYHSNCKVPGIVG 57

Query: 63  IFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIK--ANPR 107
           I +V +  YPD T    S              W  VD+     +   +SL  IK  A+  
Sbjct: 58  IAKVASAAYPDDTQFDPSSDYHDPKSTREDPRWMLVDVAFERKLARTISLDEIKQQADAL 117

Query: 108 LSSMILIV-SSRLSVQPVTT 126
                LI   +RLS+ PVT 
Sbjct: 118 GEGFPLIARGNRLSILPVTA 137


>gi|71275762|ref|ZP_00652046.1| Protein of unknown function DUF589 [Xylella fastidiosa Dixon]
 gi|71899381|ref|ZP_00681541.1| Protein of unknown function DUF589 [Xylella fastidiosa Ann-1]
 gi|170730131|ref|YP_001775564.1| hypothetical protein Xfasm12_0961 [Xylella fastidiosa M12]
 gi|71163340|gb|EAO13058.1| Protein of unknown function DUF589 [Xylella fastidiosa Dixon]
 gi|71730895|gb|EAO32966.1| Protein of unknown function DUF589 [Xylella fastidiosa Ann-1]
 gi|167964924|gb|ACA11934.1| conserved hypothetical protein [Xylella fastidiosa M12]
          Length = 155

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 72/145 (49%), Gaps = 20/145 (13%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL+KSEP  +S    Q  G   E W GVRNYQARN +R K+ +GD   FYHSN     I
Sbjct: 6   YWLMKSEPDAFSIDDLQQVGT--EPWNGVRNYQARNFIRDKIHIGDGVLFYHSNCNPPGI 63

Query: 61  VGIFEVITCTYP------------DPTAEQSSC-WECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ ++ +  YP            DP A +    W  VDI     +   ++L  IK +  
Sbjct: 64  VGLAKIASAAYPDESQFDPNSDYYDPKANREQPRWYLVDIAFERKLARTITLENIKQHAE 123

Query: 108 LSSM---ILIVSSRLSVQPVTTDEY 129
                  ++   +RLSV PVTT ++
Sbjct: 124 TLGEGFPLITRGNRLSVFPVTTTQW 148


>gi|190575714|ref|YP_001973559.1| hypothetical protein Smlt3867 [Stenotrophomonas maltophilia K279a]
 gi|190013636|emb|CAQ47271.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 159

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 78/156 (50%), Gaps = 22/156 (14%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
           YWL+KSEP  +S     D  +V  E W GVRNYQARN MR  M+VGD   FYHSN K   
Sbjct: 7   YWLMKSEPDAFSI---DDLAKVKVEPWNGVRNYQARNFMRDGMQVGDGILFYHSNTKVPG 63

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+  V +  YPD T               ++  W  VD+     +   ++L  IK + 
Sbjct: 64  IVGLATVASTAYPDDTQFDPKSDYHDPKSTRENPRWMLVDVAFDRKLKQVIALDEIKLHA 123

Query: 107 -RLSSMILIVS--SRLSVQPVTTDEYLEVCRMGKLS 139
             L     +V+  +RLSV PVT  ++  +  + K S
Sbjct: 124 EELGEGFPLVAKGNRLSVFPVTAAQWKLLLSLEKKS 159


>gi|86148180|ref|ZP_01066478.1| hypothetical protein MED222_19348 [Vibrio sp. MED222]
 gi|85834027|gb|EAQ52187.1| hypothetical protein MED222_19348 [Vibrio sp. MED222]
          Length = 155

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 74/145 (51%), Gaps = 18/145 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +Q  + +    W GVRNYQARN MR  +++GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IQTLRVQKTSCWEGVRNYQARNMMRDDVKLGDLVMIYHSSCKKV 58

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V    YPD              ++  +  W  VD+  V      V L  +KA 
Sbjct: 59  GVAGIAKVTREAYPDHFQFDPESDYYDPKSSPDNPRWIMVDVEFVRVTERLVPLATLKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEY 129
           P LS M L+   +RLS+ PVT  E+
Sbjct: 119 PELSEMPLVKRGNRLSIMPVTEQEW 143


>gi|330825008|ref|YP_004388311.1| hypothetical protein Alide2_2436 [Alicycliphilus denitrificans
           K601]
 gi|329310380|gb|AEB84795.1| Uncharacterized protein family UPF0310 [Alicycliphilus
           denitrificans K601]
          Length = 168

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 70/148 (47%), Gaps = 17/148 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL+KSEP E S             WTGVRNYQARN MR +MR+GD   FYHS      I
Sbjct: 10  YWLMKSEPDECSIDDALAAPGATVPWTGVRNYQARNFMRDEMRIGDGVLFYHSGCPEPGI 69

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
            GI  V +    DP     +              W  +D+ A+      V L  ++A+P 
Sbjct: 70  AGIARVASGVRADPAQFDPASHYYDPKATPDKPRWLLLDVQAIRKTRL-VRLAELRAHPA 128

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
           L+ M +L   +RLS+ PV   E+  + R
Sbjct: 129 LAEMRVLQRGNRLSITPVQEQEWAAILR 156


>gi|21244135|ref|NP_643717.1| hypothetical protein XAC3410 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109765|gb|AAM38253.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 147

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 69/140 (49%), Gaps = 22/140 (15%)

Query: 6   VKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREIVG 62
           +KSEP  +S     D  RVG E W GVRNYQARN MR  M VGD  FFYHSN K   IVG
Sbjct: 1   MKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMHVGDGVFFYHSNCKVPGIVG 57

Query: 63  IFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIK--ANPR 107
           I +V +  YPD T    S              W  VD+     +   +SL  IK  A+  
Sbjct: 58  IAKVASAAYPDDTQFDPSSDYHDPKSTREDPRWMLVDVAFERKLTRTISLDEIKQQADAL 117

Query: 108 LSSMILIV-SSRLSVQPVTT 126
                LI   +RLS+ PVT 
Sbjct: 118 GEGFPLIARGNRLSILPVTA 137


>gi|285017578|ref|YP_003375289.1| hypothetical protein XALc_0783 [Xanthomonas albilineans GPE PC73]
 gi|283472796|emb|CBA15301.1| conserved hypothetical protein [Xanthomonas albilineans]
          Length = 156

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 74/145 (51%), Gaps = 20/145 (13%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREI 60
           YWL+KSEP  +S  +   +  V E W GVRNYQARN MR  M+VGD   FYHSN K   I
Sbjct: 7   YWLMKSEPDTFS--IDDLQRVVTEPWNGVRNYQARNFMRDGMKVGDGILFYHSNCKVPGI 64

Query: 61  VGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPR 107
           VG+  V +  YPD T    S              W  VD+     +   ++L  IK++  
Sbjct: 65  VGVATVASDAYPDATQFDPSSDYHDPKATPEQPRWYLVDVAFERKLTRTIALDEIKSHAD 124

Query: 108 -LSSMILIVS--SRLSVQPVTTDEY 129
            L     +V+  +RLSV PV+  ++
Sbjct: 125 ALGDGFPLVARGNRLSVFPVSAAQW 149


>gi|156972650|ref|YP_001443557.1| hypothetical protein VIBHAR_00302 [Vibrio harveyi ATCC BAA-1116]
 gi|156524244|gb|ABU69330.1| hypothetical protein VIBHAR_00302 [Vibrio harveyi ATCC BAA-1116]
          Length = 156

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 80/154 (51%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   + +    W GVRNYQARN MR ++++GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IDTLRTQKVSCWEGVRNYQARNMMRDQVKLGDLVLIYHSSCKNV 58

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V    YP            DP ++ ++  W  VDI  V      + L  +KA 
Sbjct: 59  GVAGIAKVTREAYPDHFQFDLESDYYDPKSDPENPRWIMVDIEFVRKTERLIPLSVMKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PV+ +E+  +    KL
Sbjct: 119 PELENMPLVKRGNRLSIMPVSEEEWQAILGKEKL 152


>gi|46198749|ref|YP_004416.1| hypothetical protein TTC0441 [Thermus thermophilus HB27]
 gi|46196372|gb|AAS80789.1| hypothetical conserved protein [Thermus thermophilus HB27]
          Length = 150

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 68/141 (48%), Gaps = 17/141 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           MAYWL+KSEP  +  +  + +GR    W GVRNYQARN + +M+ GD  FFYHS      
Sbjct: 1   MAYWLLKSEPQVYGIEDLEREGRA--IWDGVRNYQARNYLMQMKEGDLCFFYHSGTTPPG 58

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+  V+    PDPT               +   W  V++  V   P  V L  +KA  
Sbjct: 59  IAGLCRVVRTLLPDPTQFDPESPYYDPKATPEKPRWYTVEVAFVEKWPL-VPLAELKALF 117

Query: 107 RLSSMILIVSSRLSVQPVTTD 127
                ++   +RLSV PV  +
Sbjct: 118 PPDHPLVKRGNRLSVMPVPPE 138


>gi|255562220|ref|XP_002522118.1| conserved hypothetical protein [Ricinus communis]
 gi|223538717|gb|EEF40318.1| conserved hypothetical protein [Ricinus communis]
          Length = 150

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 70/135 (51%), Gaps = 7/135 (5%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+K+EP EWSW  Q   G +   W GV+N QA+ N++ M + D  FFYHS  K R +V
Sbjct: 7   YWLLKTEPGEWSWDDQASNGGI-TNWDGVKNKQAQKNLKAMNIKDLCFFYHSGAKARRVV 65

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           G+  V+   Y +   E         + AV  M  PV L  +K +  LS   L    RLSV
Sbjct: 66  GVVAVVKEWYSNDDDEVVVD-----VKAVGEMRRPVDLKEMKNDDGLSDFALFRQPRLSV 120

Query: 122 QPVTTDEYLEVCRMG 136
            PV  + +  VC +G
Sbjct: 121 VPVPKEVWERVCELG 135


>gi|134093957|ref|YP_001099032.1| hypothetical protein HEAR0711 [Herminiimonas arsenicoxydans]
          Length = 149

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 72/145 (49%), Gaps = 17/145 (11%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE-IVGI 63
           +KSEP E S            AWTGVRNYQARN MR  M+ GD   FYHS+     I G+
Sbjct: 1   MKSEPGEVSIDDALAAPNQTVAWTGVRNYQARNFMRDAMQPGDGVLFYHSSCAEPGIAGL 60

Query: 64  FEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSS 110
            EV +  YPD T               ++  W  VD+  +      +SL  ++  P L+ 
Sbjct: 61  AEVASTPYPDETQFDPASHYFDPKATRETPRWMLVDV-RIRKKTRLLSLAELRTRPELAD 119

Query: 111 MILIV-SSRLSVQPVTTDEYLEVCR 134
           M+++   SRLS+ PVT  E+  +C+
Sbjct: 120 MVVLQKGSRLSITPVTAQEWQFICK 144


>gi|37678278|ref|NP_932887.1| hypothetical protein VV0094 [Vibrio vulnificus YJ016]
 gi|37197017|dbj|BAC92858.1| conserved hypothetical protein [Vibrio vulnificus YJ016]
          Length = 160

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 78/156 (50%), Gaps = 22/156 (14%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA--WTGVRNYQARNNMR-KMRVGDKGFFYHSN-K 56
           MAYWL K+EP  +S     D  RV +   W GVRNYQARN +R +++ GD    YHS+ K
Sbjct: 5   MAYWLFKTEPDTFS----IDTLRVQKVSCWEGVRNYQARNMLRDEVKEGDWVMIYHSSCK 60

Query: 57  GREIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIK 103
              + GI +V+   YPD              +  ++  W  VD+  V      + L  +K
Sbjct: 61  QVGVAGIAKVVREAYPDHFQFDANSDYYDAKSTPENPRWIMVDVEFVRKTERVIPLAVLK 120

Query: 104 ANPRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGKL 138
           A P L +M L+   +RLSV PVT  E+  +    KL
Sbjct: 121 AMPELENMPLVKKGNRLSVMPVTEQEWQAILTKEKL 156


>gi|218710936|ref|YP_002418557.1| hypothetical protein VS_3039 [Vibrio splendidus LGP32]
 gi|218323955|emb|CAV20317.1| hypothetical protein VS_3039 [Vibrio splendidus LGP32]
          Length = 155

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 73/145 (50%), Gaps = 18/145 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +Q  + +    W GVRNYQARN MR  ++ GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IQTLRVQKTSCWEGVRNYQARNMMRDDVKFGDLVMIYHSSCKKV 58

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V    YPD              ++  +  W  VD+  V      + L  +KA 
Sbjct: 59  GVAGIAKVTREAYPDHFQFDPESDYYDPKSSPDNPRWIMVDVEFVRVTERLIPLATLKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEY 129
           P LS M L+   +RLS+ PVT  E+
Sbjct: 119 PELSEMPLVKRGNRLSIMPVTEQEW 143


>gi|299748398|ref|XP_001839097.2| hypothetical protein CC1G_10662 [Coprinopsis cinerea okayama7#130]
 gi|298407955|gb|EAU82757.2| hypothetical protein CC1G_10662 [Coprinopsis cinerea okayama7#130]
          Length = 310

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/176 (30%), Positives = 77/176 (43%), Gaps = 41/176 (23%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGE-------AWTGVRNYQARNNMRKMRVGDKGFFYHSN 55
           Y+L+K+EP     K Q  K  V +        W GVRN++ARN M++M+VGDK  FYHSN
Sbjct: 19  YYLLKAEPDSRIVKGQDVKFSVDDFEEVKTSPWEGVRNFEARNIMKEMKVGDKALFYHSN 78

Query: 56  -KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVC---------- 91
            K   I    EV    YPD TA             +++  W  VD+  VC          
Sbjct: 79  CKNPGIAAFAEVSREAYPDFTAWDESHPYFDPKTDKENPKWFMVDLTFVCRPKNFVPLAL 138

Query: 92  ----------SMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
                     ++P  +S +       L  M L+   RLSVQ V   E+  + ++ +
Sbjct: 139 LRYIATLTLQNIPSELSYLGKDGIKALQGMDLVTRGRLSVQRVRQPEWEAIQKLAE 194


>gi|323500154|ref|ZP_08105099.1| hypothetical protein VISI1226_16268 [Vibrio sinaloensis DSM 21326]
 gi|323314783|gb|EGA67849.1| hypothetical protein VISI1226_16268 [Vibrio sinaloensis DSM 21326]
          Length = 154

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 76/145 (52%), Gaps = 18/145 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S    + + R    W GVRNYQARN MR +++ GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFSIDTLRTQNR--SCWEGVRNYQARNMMRDQVKQGDLVLIYHSSCKKV 58

Query: 59  EIVGIFEVITCTYP-----DPTAE--------QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V    YP     DP +E        ++  W  VD+  V      + L  +K+ 
Sbjct: 59  GVAGIAQVTKEAYPDHFAFDPESEYYDPKSNPENPRWVMVDVEFVRKTERLIPLSVMKSM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEY 129
           P L +M L+   +RLS+ PV+ +E+
Sbjct: 119 PELENMPLVKRGNRLSIMPVSEEEW 143


>gi|326423799|ref|NP_760082.2| hypothetical protein VV1_1135 [Vibrio vulnificus CMCP6]
 gi|319999167|gb|AAO09609.2| Uncharacterized conserved protein [Vibrio vulnificus CMCP6]
          Length = 156

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/156 (35%), Positives = 77/156 (49%), Gaps = 22/156 (14%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA--WTGVRNYQARNNMR-KMRVGDKGFFYHSN-K 56
           MAYWL K+EP  +S     D  RV +   W GVRNYQARN +R +++ GD    YHS+ K
Sbjct: 1   MAYWLFKTEPDTFS----IDTLRVQKVSCWEGVRNYQARNMLRDEVKEGDWVMIYHSSCK 56

Query: 57  GREIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIK 103
              + GI +V+   YPD              +  +   W  VD+  V      + L  +K
Sbjct: 57  QVGVAGIAKVVREAYPDHFQFDANSDYYDAKSTPEKPRWIMVDVEFVRKTERVIPLAVLK 116

Query: 104 ANPRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGKL 138
           A P L +M L+   +RLSV PVT  E+  +    KL
Sbjct: 117 AMPELENMPLVKKGNRLSVMPVTEQEWQAILTKEKL 152


>gi|166713284|ref|ZP_02244491.1| hypothetical protein Xoryp_18045 [Xanthomonas oryzae pv. oryzicola
           BLS256]
          Length = 147

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/140 (40%), Positives = 68/140 (48%), Gaps = 22/140 (15%)

Query: 6   VKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREIVG 62
           +KSEP  +S     D  RVG E W GVRNYQARN MR  M VGD  FFYHSN K   IVG
Sbjct: 1   MKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMHVGDDVFFYHSNCKVPGIVG 57

Query: 63  IFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK--ANPR 107
           + +V +  YPD T                   W  VD+     +   +SL  IK  A+  
Sbjct: 58  LAKVASAAYPDDTQFDPKSDYYDPKSTRDDPRWMLVDVAFERKLTRTISLDEIKQQADAL 117

Query: 108 LSSMILIV-SSRLSVQPVTT 126
                LI   +RLS+ PVT 
Sbjct: 118 GEGFPLIARGNRLSILPVTA 137


>gi|218437199|ref|YP_002375528.1| hypothetical protein PCC7424_0190 [Cyanothece sp. PCC 7424]
 gi|218169927|gb|ACK68660.1| protein of unknown function DUF55 [Cyanothece sp. PCC 7424]
          Length = 150

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 68/134 (50%), Gaps = 17/134 (12%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIF 64
           +KSEP  +S    + +G+    W GVRNYQARN +R+M+VGD  FFYHSN     IVG+ 
Sbjct: 1   MKSEPDVYSIDDLKKEGQT--LWDGVRNYQARNFLRQMKVGDLCFFYHSNLTPPAIVGLM 58

Query: 65  EVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRLSSM 111
           +VI     DPT   S+              W+ V +  V   P  + L  +K       +
Sbjct: 59  KVIQSNVVDPTQFDSNSPYYDSKSKLDAPRWQTVIVDFVKVFPNMIPLTTLKQLFNPEEL 118

Query: 112 ILI-VSSRLSVQPV 124
           +LI   +RLSV P+
Sbjct: 119 LLIRKGNRLSVMPI 132


>gi|188996118|ref|YP_001930369.1| protein of unknown function DUF55 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931185|gb|ACD65815.1| protein of unknown function DUF55 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 131

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 64/125 (51%), Gaps = 7/125 (5%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           Y+L K+EP E+S+ M + +G+    W GV+N  A+  +++M+ GD  F YH+ K + IVG
Sbjct: 4   YYLAKTEPEEYSYDMLEKEGKT--VWNGVKNPLAQKFIKQMKKGDLVFIYHTGKEKAIVG 61

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           I +V++  Y D      +    VDI     +   ++L  IK         L+   RLSV 
Sbjct: 62  IGKVVSEPYQD-----ENGLYVVDIQPYKRLNKKLTLSEIKKMKEFQDFYLVKMPRLSVM 116

Query: 123 PVTTD 127
            V  D
Sbjct: 117 EVPDD 121


>gi|242038569|ref|XP_002466679.1| hypothetical protein SORBIDRAFT_01g012120 [Sorghum bicolor]
 gi|241920533|gb|EER93677.1| hypothetical protein SORBIDRAFT_01g012120 [Sorghum bicolor]
          Length = 193

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 67/144 (46%), Gaps = 10/144 (6%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL+K+EP EWSW  Q         W GVRN QA N++R MR GD+  FYHS  G     
Sbjct: 36  YWLLKTEPGEWSWSDQARAPGGVAPWDGVRNRQAINSLRAMRPGDRCLFYHSGAGAASRR 95

Query: 63  IFEVITCTYP------DPTAEQSSCWECVDICAVCSMPCPVSLMAIKANP----RLSSMI 112
           +  V+    P      D   ++++    VD+ AV     PV L  IK        +    
Sbjct: 96  VVGVVEVVRPWYEGEGDGEGKEAAAGGAVDVRAVGEFRNPVPLGDIKKAAGEVEGMKDFA 155

Query: 113 LIVSSRLSVQPVTTDEYLEVCRMG 136
           L+  +RLSV PV    +  +C  G
Sbjct: 156 LLRQARLSVMPVPAKIWDWICDAG 179


>gi|269965088|ref|ZP_06179253.1| hypothetical protein VMC_06830 [Vibrio alginolyticus 40B]
 gi|269830391|gb|EEZ84616.1| hypothetical protein VMC_06830 [Vibrio alginolyticus 40B]
          Length = 156

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 79/154 (51%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   + +    W GVRNYQARN MR ++++GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFS--IDTLRTQKVSCWEGVRNYQARNMMRDQVKLGDLVLIYHSSCKHV 58

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YP            DP ++  +  W   D+  V      + L  +KA 
Sbjct: 59  GVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMADVEFVRKTARVIPLSVMKAM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PVT +E+  +    KL
Sbjct: 119 PELENMPLVKRGNRLSIMPVTEEEWDAILGKEKL 152


>gi|21232693|ref|NP_638610.1| hypothetical protein XCC3264 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767232|ref|YP_241994.1| hypothetical protein XC_0900 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21114503|gb|AAM42534.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66572564|gb|AAY47974.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 147

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/140 (40%), Positives = 70/140 (50%), Gaps = 22/140 (15%)

Query: 6   VKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREIVG 62
           +KSEP  +S     D  RVG E W GVRNYQARN MR  M+VGD  FFYHSN K   IVG
Sbjct: 1   MKSEPDTFSI---DDLERVGTEPWNGVRNYQARNFMRDGMQVGDGVFFYHSNCKVPGIVG 57

Query: 63  IFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIK--ANPR 107
           I +V +  YPD T               +   W  VD+     +   ++L  IK  A+  
Sbjct: 58  IAKVASTAYPDETQFDRTSDYHDPKAKREDPRWMLVDVAFERKLKRTIALDEIKQHADAL 117

Query: 108 LSSMILIV-SSRLSVQPVTT 126
                LI   +RLS+ PVT 
Sbjct: 118 GEGFPLIARGNRLSILPVTA 137


>gi|41055054|ref|NP_956951.1| thymocyte nuclear protein 1 [Danio rerio]
 gi|82187203|sp|Q6PFL8|THYN1_DANRE RecName: Full=Thymocyte nuclear protein 1
 gi|34784105|gb|AAH57500.1| Thymocyte nuclear protein 1 [Danio rerio]
          Length = 231

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 75/158 (47%), Gaps = 33/158 (20%)

Query: 4   WLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYHS 54
           WL+KSEP        +  + ++  K    +   W GVRNYQARN MR+M+VG + FFYHS
Sbjct: 63  WLMKSEPESRIENGVDVKFGIEDLKALPNQTGCWDGVRNYQARNFMREMKVGQQAFFYHS 122

Query: 55  N-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDIC--AVCSMPCPVS 98
           N K   I G+ +++   Y D T                +  W  VD+    +     P++
Sbjct: 123 NCKEPGIAGLMKIVKEAYVDHTQFDKKDVHYDPSSKADNPKWHMVDVQFERMVKRFIPLA 182

Query: 99  LMA-------IKANPRLSSMILIVSSRLSVQPVTTDEY 129
            +        +K  P L  M L   +RLSVQP+T +E+
Sbjct: 183 ELKKYHLEHRVKGGP-LKDMALFTRARLSVQPLTAEEF 219


>gi|320449796|ref|YP_004201892.1| tymocyte protein cThy28kD [Thermus scotoductus SA-01]
 gi|320149965|gb|ADW21343.1| tymocyte protein cThy28kD [Thermus scotoductus SA-01]
          Length = 150

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 70/141 (49%), Gaps = 17/141 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           MAYWL+KSEP  +S    + +GR    W GVRNYQARN +  M++GD  FFYHS+     
Sbjct: 1   MAYWLLKSEPEVYSILDLKREGRA--IWDGVRNYQARNYLMHMQLGDLCFFYHSSTNPPG 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           I G+  V+    PDPT    S              W  V++  + + P  V L  +KA  
Sbjct: 59  IAGLCRVVGTLVPDPTQFDPSSPYFDPRATRENPRWYTVEVEFLEAWPL-VPLAELKACF 117

Query: 107 RLSSMILIVSSRLSVQPVTTD 127
                ++   +RLSV PV  +
Sbjct: 118 PPDHPLVKRGNRLSVMPVPPE 138


>gi|221128561|ref|XP_002162584.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 253

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 77/160 (48%), Gaps = 33/160 (20%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMR-KMRVGDKGFFY 52
           YWL+KSEP        +  + ++  K +  +   W GVRN+Q+RN +R +++VGD+ FFY
Sbjct: 85  YWLLKSEPETRLHNGVDIKFGIEDLKSKPDQTSVWDGVRNHQSRNFLRDEIKVGDQAFFY 144

Query: 53  HSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVS 98
           HSN K   IVGI +++   YPD T             +E +  W  VD+     +   + 
Sbjct: 145 HSNCKQPGIVGIVDIVKSGYPDATQFDSKGNFYDPKSSEDNPKWFSVDVKFNRMLKRYIP 204

Query: 99  LMAIK---------ANPRLSSMILIVSSRLSVQPVTTDEY 129
           L  +K             L    LI   RLSV PVT +E+
Sbjct: 205 LPELKDLYLQHKKNKEGALKLFGLITKPRLSVLPVTKEEF 244


>gi|167044109|gb|ABZ08793.1| putative family of unknown function (DUF589) [uncultured marine
           crenarchaeote HF4000_APKG5B22]
          Length = 142

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 72/139 (51%), Gaps = 8/139 (5%)

Query: 3   YWLVKSEPSE---WSWK-MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGR 58
           YWL K EPS    +S+  +Q++K  V   W GV N  A  +MR M+ GD+  +YH+   R
Sbjct: 8   YWLAKQEPSGPRGYSFSTLQKEKTAV---WDGVHNNLALKHMRSMKKGDQILYYHTGDER 64

Query: 59  EIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSR 118
           + VGI  V +  YP+P  E +  +  VD+     +  PVSL  +K         L+   R
Sbjct: 65  QAVGIMTVTSEPYPNP-KEDNERFIVVDVKFKKQLKKPVSLEQMKQEKSFKDWELLRIGR 123

Query: 119 LSVQPVTTDEYLEVCRMGK 137
           LSV PV  + + ++ ++ +
Sbjct: 124 LSVMPVPKNIWDKIIKLSQ 142


>gi|169619193|ref|XP_001803009.1| hypothetical protein SNOG_12791 [Phaeosphaeria nodorum SN15]
 gi|111058471|gb|EAT79591.1| hypothetical protein SNOG_12791 [Phaeosphaeria nodorum SN15]
          Length = 297

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 61/124 (49%), Gaps = 18/124 (14%)

Query: 24  VGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPTA------ 76
           V E W GVRN QARNNM+ MR GD GFFYHSN K   +VGI  V      D TA      
Sbjct: 148 VPEPWGGVRNPQARNNMQAMRKGDLGFFYHSNAKPSGVVGILRVAEEAKVDETAFDKKDP 207

Query: 77  -------EQSSCWECVDICAVCSMPCPVSLMAIKANP----RLSSMILIVSSRLSVQPVT 125
                   +   W CV +  V      + L  IK++     +L  M L+ +SRLSV  V 
Sbjct: 208 YYDAKSDREKPKWYCVGVDFVKKFDDVIDLATIKSHAGSGGKLEGMQLVTNSRLSVCRVR 267

Query: 126 TDEY 129
            +E+
Sbjct: 268 KEEW 271


>gi|153835105|ref|ZP_01987772.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Vibrio
           harveyi HY01]
 gi|148868455|gb|EDL67563.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Vibrio
           harveyi HY01]
          Length = 206

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/154 (35%), Positives = 80/154 (51%), Gaps = 18/154 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   + +    W GVRNYQARN MR ++++GD    YHS+ K  
Sbjct: 51  MAYWLFKTEPDTFS--IDTLRTQKVSCWEGVRNYQARNMMRDQVKLGDLVLIYHSSCKNV 108

Query: 59  EIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V    YP            DP ++ ++  W  VDI  V      + L  +KA 
Sbjct: 109 GVAGIAKVTREAYPDHFQFDLESDYYDPKSDPENPRWIMVDIEFVRKTVRLIPLSVMKAM 168

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
           P L +M L+   +RLS+ PV+ +E+  +    KL
Sbjct: 169 PELENMPLVKRGNRLSIMPVSEEEWQAILGKEKL 202


>gi|303256765|ref|ZP_07342779.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
 gi|330999114|ref|ZP_08322835.1| hypothetical protein HMPREF9439_00457 [Parasutterella
           excrementihominis YIT 11859]
 gi|302860256|gb|EFL83333.1| conserved hypothetical protein [Burkholderiales bacterium 1_1_47]
 gi|329575503|gb|EGG57042.1| hypothetical protein HMPREF9439_00457 [Parasutterella
           excrementihominis YIT 11859]
          Length = 160

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 71/142 (50%), Gaps = 17/142 (11%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKM-RVGDKGFFYHSNKGRE-IV 61
           WL+KSEPSE S             W GVRNYQARN MR + ++GD   FYHS+  +  IV
Sbjct: 9   WLMKSEPSEVSVDDVLGMKDCKVGWFGVRNYQARNFMRDLCKIGDPVLFYHSSCAQPGIV 68

Query: 62  GIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRL 108
           GI E+ +  YPDPT    +              W  VD+  +  +   VS+  ++  P  
Sbjct: 69  GIGEIASEPYPDPTQFDETSEYFDAKSTQAKPRWVQVDVHILHKVKL-VSIAELRTIPGC 127

Query: 109 SSM-ILIVSSRLSVQPVTTDEY 129
             M +L   +RLS+ PV  DE+
Sbjct: 128 EGMRVLQKGNRLSITPVNEDEW 149


>gi|325982312|ref|YP_004294714.1| hypothetical protein NAL212_1678 [Nitrosomonas sp. AL212]
 gi|325531831|gb|ADZ26552.1| Uncharacterized protein family UPF0310 [Nitrosomonas sp. AL212]
          Length = 151

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 74/145 (51%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHS-NKGR 58
           M YWL+KS+P E+S        +   AW GVRNYQ+RN MR +M +GD+ FFYHS  K  
Sbjct: 1   MRYWLMKSDPDEFSIDDFAALPKQTIAWEGVRNYQSRNFMRNQMNIGDQAFFYHSCCKDP 60

Query: 59  EIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMP-------------CPVSLMAIKAN 105
            I+GI  V    YPD +   SS  +  D+ A  + P               +S+  ++ +
Sbjct: 61  GIMGIATVSRPAYPDVSQFDSSS-KYFDLKASLNNPRWFNVELTLTRRIRLISIKELRQH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
             L  M +L   +RLS+ PV   E+
Sbjct: 120 EELRGMRVLQTGNRLSITPVDPAEW 144


>gi|16330832|ref|NP_441560.1| tymocyte protein cThy28kD [Synechocystis sp. PCC 6803]
 gi|1653325|dbj|BAA18240.1| tymocyte protein cThy28kD [Synechocystis sp. PCC 6803]
          Length = 149

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 66/140 (47%), Gaps = 17/140 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MA+WL+KSEP  +     + +G     W GVRNYQARN ++ M VGD+ FFYHSN K   
Sbjct: 1   MAFWLMKSEPVTYGIHHLKAEGET--LWDGVRNYQARNFLQTMAVGDQAFFYHSNCKPPG 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           IVG+  +      DPT    +              W  V           ++L  +KA  
Sbjct: 59  IVGLMTITAEQVVDPTQFDPASPYFDPKATLEKPRWFTVKASFTREFAQMITLSTLKAQF 118

Query: 107 RLSSM-ILIVSSRLSVQPVT 125
               + +L   +RLSV PV+
Sbjct: 119 SPEELGVLKKGNRLSVLPVS 138


>gi|159027784|emb|CAO89655.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 153

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 70/142 (49%), Gaps = 21/142 (14%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           + YWL+KSEP+ +S    +  G+    W GVRNYQARN +R+M+ GD  FFYHSN     
Sbjct: 3   LNYWLMKSEPNVYSIGDLKKDGQT--IWEGVRNYQARNFLRQMKRGDLAFFYHSNTTPPG 60

Query: 60  IVGIFEVITCTYPDPTA--------------EQSSCWEC-VDICAVCSMPCPVSLMAIKA 104
           IVG+  V+     DPT               +    W   V+   + S   P+ ++  K 
Sbjct: 61  IVGLMRVVETDMIDPTQLDPDSPYYDSKSSPDAPRWWTVKVEFDRLFSQMLPLGIL--KQ 118

Query: 105 NPRLSSMILI-VSSRLSVQPVT 125
           N     ++L+   +RLSV PV 
Sbjct: 119 NFTADELLLVRTGNRLSVMPVN 140


>gi|55980764|ref|YP_144061.1| hypothetical protein TTHA0795 [Thermus thermophilus HB8]
 gi|55772177|dbj|BAD70618.1| conserved hypothetical protein [Thermus thermophilus HB8]
          Length = 150

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 67/141 (47%), Gaps = 17/141 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           MAYWL+KSEP  +  +  + +GR    W GVRNYQARN + +M+ GD  FFYHS      
Sbjct: 1   MAYWLLKSEPQVYGIEDLEREGRA--IWDGVRNYQARNYLMQMKEGDLCFFYHSGTTPPG 58

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I G   V+    PDPT               +   W  V++  V   P  V L  +KA  
Sbjct: 59  IAGRCRVVRTLLPDPTQFDPESPYYDPKATPEKPRWYTVEVAFVEKWPL-VPLAELKALF 117

Query: 107 RLSSMILIVSSRLSVQPVTTD 127
                ++   +RLSV PV  +
Sbjct: 118 PPDHPLVKRGNRLSVMPVPPE 138


>gi|171059350|ref|YP_001791699.1| hypothetical protein Lcho_2669 [Leptothrix cholodnii SP-6]
 gi|170776795|gb|ACB34934.1| protein of unknown function DUF55 [Leptothrix cholodnii SP-6]
          Length = 157

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 71/143 (49%), Gaps = 17/143 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE-I 60
           YWL+KSEP E S             WTGVRNYQARN MR  M+VGD   FYHS+  +  +
Sbjct: 6   YWLMKSEPEECSIDTLAQSVSQCLPWTGVRNYQARNFMRDAMQVGDGVLFYHSSCPQPGV 65

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            G+ EV +  Y D T               ++  W  VD+  V      + L  ++A P 
Sbjct: 66  AGLAEVASAAYLDATQFDPASPYFDARSQREAPRWLHVDVRFVRKTRL-LGLAEMRAQPG 124

Query: 108 LSSMILI-VSSRLSVQPVTTDEY 129
           L+ M L+   +RLS+ PVT  E+
Sbjct: 125 LAGMTLLRPGNRLSITPVTPAEW 147


>gi|171678305|ref|XP_001904102.1| hypothetical protein [Podospora anserina S mat+]
 gi|170937222|emb|CAP61879.1| unnamed protein product [Podospora anserina S mat+]
          Length = 270

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 69/154 (44%), Gaps = 28/154 (18%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHS 54
           YWL+K+EP        +  + +     +   E W G+RNY ARNN+R M+ GD  FFYHS
Sbjct: 108 YWLLKAEPESRYENGVDVKFSIDDLAAKTEPEPWDGIRNYAARNNLRAMKKGDLAFFYHS 167

Query: 55  N-KGREIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLM 100
           N K   IVG  E++    PD +A                  W  V +        P++L 
Sbjct: 168 NCKEPGIVGTMEIVKEHSPDLSAHDPKAPYYDPKSKPSDPKWSVVHVKFHEKFNKPITLK 227

Query: 101 AIK-----ANPRLSSMILIVSSRLSVQPVTTDEY 129
            +K       P L  M +I  SRLSV  V+  E+
Sbjct: 228 ELKELGAPGGP-LDKMQMIKQSRLSVSKVSASEW 260


>gi|114331944|ref|YP_748166.1| hypothetical protein Neut_1972 [Nitrosomonas eutropha C91]
 gi|114308958|gb|ABI60201.1| protein of unknown function DUF55 [Nitrosomonas eutropha C91]
          Length = 151

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/145 (37%), Positives = 73/145 (50%), Gaps = 17/145 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M +WL+KSEPSE S      +     AW GVRNYQARN MR +M+VGD   FYHS+    
Sbjct: 1   MRFWLMKSEPSEMSIDGLAARPEQTVAWDGVRNYQARNFMRNQMQVGDLVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV     PD T               ++  W  V+I  V      +SL  +++ 
Sbjct: 61  GIAGVAEVSRLACPDETQFDPVSKYFDPKATRENPRWFNVEIRFVRKTRL-LSLKELRSY 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEY 129
           P L+ M IL   +RLS+ PV   E+
Sbjct: 120 PELAGMRILQKGNRLSITPVDPAEW 144


>gi|78213669|ref|YP_382448.1| hypothetical protein Syncc9605_2154 [Synechococcus sp. CC9605]
 gi|78198128|gb|ABB35893.1| conserved hypothetical protein [Synechococcus sp. CC9605]
          Length = 148

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 72/149 (48%), Gaps = 18/149 (12%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIF 64
           +KSEP  +     + +G     W G+RNYQARN MR M VGD+ FFYHSN K   I+G+ 
Sbjct: 1   MKSEPDAYGIDDLRHEGTT--LWDGIRNYQARNFMRSMDVGDQAFFYHSNCKPPGIIGLM 58

Query: 65  EVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRLSSM 111
           EV+     DPT    S              W+C  +  +      +SL  ++       +
Sbjct: 59  EVMETGLVDPTQFDPSAKYYDPKSSPEKPRWDCARLRFLGEFDALLSLDQLRELYSEEQL 118

Query: 112 ILIV-SSRLSVQPVTTDEYLE-VCRMGKL 138
            +I   +RLS+ PV T+   + + R+G L
Sbjct: 119 PVIKRGNRLSILPVPTNTANDLLARLGHL 147


>gi|331243989|ref|XP_003334636.1| hypothetical protein PGTG_16495 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309313626|gb|EFP90217.1| hypothetical protein PGTG_16495 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 219

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 76/159 (47%), Gaps = 33/159 (20%)

Query: 10  PSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREIVGIFEV 66
           PS W  K+  D  ++G E W GVRN++A+N M+ KM+ GD   FYHSN K   I GI E+
Sbjct: 5   PSAWLMKID-DLEKIGIEHWDGVRNHEAKNLMKEKMKKGDHVLFYHSNCKVPGIAGIAEI 63

Query: 67  ITCTYPDPTA-------------EQSSCWECVDICAVCSMP--CPVSLMAIKANPRLS-- 109
               YPD TA             E +  W  VD+  V  +P   P+ L+    N ++S  
Sbjct: 64  DKEGYPDFTAFDPSHPYYDPKSVESTPIWFMVDVKFVSRLPSFVPLKLLQNLVNGKVSPP 123

Query: 110 ------------SMILIVSSRLSVQPVTTDEYLEVCRMG 136
                        M L+   RLSVQPV+ + +  V  +G
Sbjct: 124 DYLTSKDLQAIKDMPLLNRGRLSVQPVSVEAFEVVRNLG 162


>gi|71909636|ref|YP_287223.1| hypothetical protein Daro_4026 [Dechloromonas aromatica RCB]
 gi|71849257|gb|AAZ48753.1| Protein of unknown function DUF589 [Dechloromonas aromatica RCB]
          Length = 153

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 53/145 (36%), Positives = 71/145 (48%), Gaps = 19/145 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M YWL+KSEP E S       G V   W GVRNYQARN MR  M++GD  FFYHS     
Sbjct: 1   MQYWLMKSEPDEVSIDDLARNGTV--PWFGVRNYQARNFMRDAMQIGDLAFFYHSGCAEP 58

Query: 60  -IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            + GI EV +  YPD T  + +              W   D+         V L  ++  
Sbjct: 59  GVAGICEVCSEPYPDATQFEPASPYFDPKSTLENPRWLLRDV-RFGEKTRYVPLTELRTY 117

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEY 129
             L++M L+   +RLS+ PV+ +E+
Sbjct: 118 AELANMRLLARGNRLSITPVSAEEW 142


>gi|229367658|gb|ACQ58809.1| Thymocyte nuclear protein 1 [Anoplopoma fimbria]
          Length = 220

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 77/162 (47%), Gaps = 37/162 (22%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVG-----------EAWTGVRNYQARNNMRKMRVGDKGF 50
           ++WL+KSEP E  ++   D G+ G           + W GVRNYQARN MR+M+ G   F
Sbjct: 50  SHWLMKSEP-ESRFESGID-GKFGIEDLKALPDQTDCWDGVRNYQARNFMRQMKDGQLAF 107

Query: 51  FYHSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDI--CAVCSMP 94
           FYHS+ K   I GI +++   Y D T                +  W  VD+    +    
Sbjct: 108 FYHSDCKEPGIAGIMKIVKEAYVDHTQFDKKDIHFDANSEPDNPKWSMVDVQYQRMLKRF 167

Query: 95  CPVSLMA-------IKANPRLSSMILIVSSRLSVQPVTTDEY 129
            P+S +         K  P L  M L  S+RLSVQP+T +E+
Sbjct: 168 FPLSELKKYHLQHRAKGGP-LKDMALFTSARLSVQPLTPEEF 208


>gi|296818789|ref|XP_002849731.1| thymocyte nuclear protein 1 [Arthroderma otae CBS 113480]
 gi|238840184|gb|EEQ29846.1| thymocyte nuclear protein 1 [Arthroderma otae CBS 113480]
          Length = 301

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 79/166 (47%), Gaps = 26/166 (15%)

Query: 2   AYWLVKSEPSEW-----SWKMQQDKGRVG---EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP          K   D  R     E W GVRN  ARN+MR M+ GD  FFYH
Sbjct: 133 SYWLMKAEPETRLEKGVDVKFSIDDLRAATEPEGWDGVRNAAARNHMRAMKKGDLAFFYH 192

Query: 54  SN-KGREIVGIFEVITCT------------YPDPTAEQSS-CWECVDICAVCSMPCPVSL 99
           SN K   I G  E++  +            Y DP + + +  W+ V +         ++L
Sbjct: 193 SNCKVPGIAGTMEIVRESSVDESAFDPAHPYYDPKSNRDNPKWDWVHVQFRSKFKNLITL 252

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
             IK++ +    L ++ ++  SRLSV PVT +++  +  + +   P
Sbjct: 253 ADIKSHAKPGCALENLQMVKQSRLSVSPVTAEQWKFLMSLAEEEQP 298


>gi|282889574|ref|ZP_06298115.1| hypothetical protein pah_c002o007 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500497|gb|EFB42775.1| hypothetical protein pah_c002o007 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 165

 Score = 70.1 bits (170), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 74/149 (49%), Gaps = 20/149 (13%)

Query: 6   VKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGREIV-- 61
           +KSEPS +S   ++QD   +   W GVRNYQARN MR +M VGD   FYHSN     V  
Sbjct: 1   MKSEPSVYSIDDLKQDGFTL---WDGVRNYQARNYMRDEMEVGDLALFYHSNVAPPGVAG 57

Query: 62  -------GIFEVITCTYPDP-----TAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLS 109
                  GI+++       P     + ++S  W  V++  V   P  VSL  +K +P   
Sbjct: 58  ICRICKTGIYDLTALDSESPYYDKRSTQKSPIWATVEVEYVEKFPYFVSLADLKDSPMFK 117

Query: 110 SM-ILIVSSRLSVQPVTTDEYLEVCRMGK 137
            + +L   SRLS+ P+  + +  +  +G 
Sbjct: 118 GLELLNKGSRLSIIPIEYEHFDAIRALGH 146


>gi|330915371|ref|XP_003297002.1| hypothetical protein PTT_07270 [Pyrenophora teres f. teres 0-1]
 gi|311330552|gb|EFQ94898.1| hypothetical protein PTT_07270 [Pyrenophora teres f. teres 0-1]
          Length = 314

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 59/122 (48%), Gaps = 18/122 (14%)

Query: 26  EAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPTA-------- 76
           E W GVRN QARNNM+ MR GD GFFYHSN K   +VGI  V+     D TA        
Sbjct: 152 EPWGGVRNPQARNNMQAMRKGDLGFFYHSNAKPSGVVGILRVVEEAKVDETAFDPKDPYY 211

Query: 77  -----EQSSCWECVDICAVCSMPCPVSLMAIKANPR----LSSMILIVSSRLSVQPVTTD 127
                 +   W CV +  V      V L  IK   +    L  M L+ +SRLSV  V  +
Sbjct: 212 DKKSDPEKPKWFCVGVEFVKEFDEVVDLHKIKEYAKDGGPLKDMQLVTNSRLSVCKVRKE 271

Query: 128 EY 129
           E+
Sbjct: 272 EW 273


>gi|329766509|ref|ZP_08258052.1| hypothetical protein Nlim_1863 [Candidatus Nitrosoarchaeum limnia
           SFB1]
 gi|329136764|gb|EGG41057.1| hypothetical protein Nlim_1863 [Candidatus Nitrosoarchaeum limnia
           SFB1]
          Length = 134

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 60/111 (54%), Gaps = 4/111 (3%)

Query: 17  MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTA 76
           +++DK  V   W GV N  A  +MR+M+ GD   FYH+   R+ VGI EV++  YP+P  
Sbjct: 17  LKKDKKTV---WNGVHNNLALKHMREMKKGDLVLFYHTGDERQAVGIMEVVSEPYPNP-K 72

Query: 77  EQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTD 127
           E +  +   D     S+  PV+L  +K   +  +  L+  SRLSV PV  D
Sbjct: 73  EDNKRFIVFDGKYKKSLKRPVTLDEMKKQKKFQNWELLRISRLSVMPVPKD 123


>gi|218295663|ref|ZP_03496459.1| protein of unknown function DUF55 [Thermus aquaticus Y51MC23]
 gi|218243822|gb|EED10349.1| protein of unknown function DUF55 [Thermus aquaticus Y51MC23]
          Length = 150

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 69/141 (48%), Gaps = 17/141 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           MAYWL+K+EP  +S +  + +GR    W GVRNYQARN + +M  GD  F YHS+     
Sbjct: 1   MAYWLLKTEPETYSIEDLRREGRA--IWDGVRNYQARNYLLRMGEGDLCFIYHSSTNPPG 58

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+  V+    PDPT               +   W  V++  + + P  + L  +KA  
Sbjct: 59  IAGLARVVQTRIPDPTQFDPESPYFDPRATPERPRWYTVEVAFLEAWPL-IPLKELKALF 117

Query: 107 RLSSMILIVSSRLSVQPVTTD 127
                ++   +RLSV PV  +
Sbjct: 118 PPDHPLVKRGNRLSVMPVPPE 138


>gi|149191488|ref|ZP_01869737.1| hypothetical protein VSAK1_12335 [Vibrio shilonii AK1]
 gi|148834676|gb|EDL51664.1| hypothetical protein VSAK1_12335 [Vibrio shilonii AK1]
          Length = 152

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 72/145 (49%), Gaps = 18/145 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP E+S    + KG     W GVRNYQARN +R +M+VGD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDEFSIDTLRVKGTA--CWEGVRNYQARNMIRDEMKVGDLVLIYHSSCKQI 58

Query: 59  EIVGI-------------FEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + G+             F++ +  Y   +  ++  W  VDI         + L  +K  
Sbjct: 59  GVAGLATITKEAYIDHFQFDIESDYYDAKSDPENPRWLMVDIEFGEKFKRVLPLSVLKTM 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEY 129
           P L  M L+   +RLSV PVT  E+
Sbjct: 119 PELMEMPLVKRGNRLSVMPVTESEW 143


>gi|325106891|ref|YP_004267959.1| hypothetical protein Plabr_0308 [Planctomyces brasiliensis DSM
           5305]
 gi|324967159|gb|ADY57937.1| Uncharacterized protein family UPF0310 [Planctomyces brasiliensis
           DSM 5305]
          Length = 164

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 72/150 (48%), Gaps = 16/150 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREI 60
           YWL KSE   +S    +   +    W GVRNYQ RN +R +++ GD   +YHSN K   +
Sbjct: 13  YWLFKSEADCFSIDDLKAAPKKTTFWDGVRNYQVRNMLRDEVKKGDLVLYYHSNSKPLGV 72

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VG  EV+   YPD TA              +   W  VD+         V+   +K +P 
Sbjct: 73  VGTAEVVKEGYPDHTAYDPKEDHYDPKSDPEDPRWFMVDVKFRSKYDEAVTRDMLKDHPV 132

Query: 108 LSSMILIVS-SRLSVQPVTTDEYLEVCRMG 136
            S M+++   SRLS+ PVT +E+  V  + 
Sbjct: 133 TSGMMVMQKGSRLSITPVTAEEFAAVEELA 162


>gi|302420669|ref|XP_003008165.1| thymocyte nuclear protein [Verticillium albo-atrum VaMs.102]
 gi|261353816|gb|EEY16244.1| thymocyte nuclear protein [Verticillium albo-atrum VaMs.102]
          Length = 269

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 51/80 (63%), Gaps = 9/80 (11%)

Query: 3   YWLVKSEPS---EWSWKMQ---QDKG--RVGEAWTGVRNYQARNNMRKMRVGDKGFFYHS 54
           +WL+KSEP    E  ++++    D G  ++ E W G+RNY ARNN+R+M+ GDK FFYHS
Sbjct: 138 FWLMKSEPDVRIEDGYEIKFSIDDLGERKMPEGWDGIRNYVARNNLRQMKKGDKAFFYHS 197

Query: 55  N-KGREIVGIFEVITCTYPD 73
           N K   +VG+  ++    PD
Sbjct: 198 NCKEPGVVGLMTIVKEHSPD 217


>gi|327297887|ref|XP_003233637.1| hypothetical protein TERG_05511 [Trichophyton rubrum CBS 118892]
 gi|326463815|gb|EGD89268.1| hypothetical protein TERG_05511 [Trichophyton rubrum CBS 118892]
          Length = 301

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 75/154 (48%), Gaps = 26/154 (16%)

Query: 2   AYWLVKSEPSEWSWK-----MQQDKGRVG---EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP     K        D  R     E W GVRN  ARN+MR M+ GD  FFYH
Sbjct: 133 SYWLMKAEPETRLEKGVDVRFSIDDLRAATEPEGWDGVRNPAARNHMRAMKKGDLAFFYH 192

Query: 54  SN-KGREIVGIFEVITCT------------YPDPTAEQSS-CWECVDICAVCSMPCPVSL 99
           SN K   I G  E++  +            Y DP + + +  W+ V +         V+L
Sbjct: 193 SNCKVPGIAGTMEIVRESSVDESAFDPAHPYYDPKSSRDNPKWDWVHVQFRSKFKNLVTL 252

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
             IK++ +    L ++ ++  SRLSV PVT +++
Sbjct: 253 ADIKSHAKPGGALENLQMVKQSRLSVSPVTAEQW 286


>gi|213514436|ref|NP_001135132.1| thymocyte nuclear protein 1 [Salmo salar]
 gi|209734430|gb|ACI68084.1| Thymocyte nuclear protein 1 [Salmo salar]
 gi|223647096|gb|ACN10306.1| Thymocyte nuclear protein 1 [Salmo salar]
 gi|223672969|gb|ACN12666.1| Thymocyte nuclear protein 1 [Salmo salar]
 gi|303664581|gb|ADM16150.1| Thymocyte nuclear protein 1 [Salmo salar]
          Length = 239

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 72/158 (45%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           +WL+KSEP        +  + ++  K    +   W GVRNYQARN MR M+ G   FFYH
Sbjct: 70  HWLMKSEPESRLENGIDVKFGIEDLKTLPNQTGCWDGVRNYQARNFMRDMKEGQHAFFYH 129

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
           SN K   I G+ +++  +Y D T                +  W  VD+     +   + L
Sbjct: 130 SNCKEPGIAGVMKIVKESYVDHTQFDKKDVHYDATSKADNPKWSMVDVQFERMLKRFIPL 189

Query: 100 MAIK--------ANPRLSSMILIVSSRLSVQPVTTDEY 129
             +K            L+ M L   +RLSVQP+T +E+
Sbjct: 190 SELKKIHLQHKAKGGSLNGMALFTRARLSVQPLTREEF 227


>gi|312884209|ref|ZP_07743920.1| hypothetical protein VIBC2010_05970 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309368137|gb|EFP95678.1| hypothetical protein VIBC2010_05970 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 151

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 77/149 (51%), Gaps = 18/149 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S  +   K +    W GVRNYQARN +R ++++GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDSFS--IDTLKAQKVSCWEGVRNYQARNLLRDEVKLGDLVLIYHSSCKNV 58

Query: 59  EIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKAN 105
            + G+  V+  +YPD  A  +               W  VD+  V      + L  +K+ 
Sbjct: 59  GVAGVARVVKESYPDYFAHDADSPYFDPKSTPDKPRWFMVDVEFVRKTHRLIPLSVMKSM 118

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVC 133
           P LS+M L+   SRLSV PV+  E++ + 
Sbjct: 119 PELSAMPLVKKGSRLSVMPVSESEWMAIL 147


>gi|312217318|emb|CBX97266.1| hypothetical protein [Leptosphaeria maculans]
          Length = 346

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 56/114 (49%), Gaps = 18/114 (15%)

Query: 26  EAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPTA-------- 76
           E W+GVRN QARNNM+ MRVGD GFFYHSN K   + GI  V+     D TA        
Sbjct: 200 EPWSGVRNPQARNNMQAMRVGDLGFFYHSNAKPSGVAGILRVVEEAKVDETAFDPKDPYY 259

Query: 77  -----EQSSCWECVDICAVCSMPCPVSLMAIKANPR----LSSMILIVSSRLSV 121
                 +   W CV +  V      VSL  +K        L  M ++ +SRLSV
Sbjct: 260 DAKSKREEPKWWCVGVEFVKKFDNVVSLEVLKREAAKGGVLKDMQVVHNSRLSV 313


>gi|15838608|ref|NP_299296.1| hypothetical protein XF2014 [Xylella fastidiosa 9a5c]
 gi|9107129|gb|AAF84816.1|AE004020_7 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 147

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 73/143 (51%), Gaps = 22/143 (15%)

Query: 6   VKSEPSEWSWKMQQDKGRVG-EAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREIVG 62
           +KSEP  +S     D  RVG E W G+RNYQARN +R K+ +GD   FYHSN K   IVG
Sbjct: 1   MKSEPDAFSI---DDLQRVGTEPWNGIRNYQARNFIRDKIHIGDSVLFYHSNCKPPGIVG 57

Query: 63  IFEVITCTYP------------DPTAEQSSC-WECVDICAVCSMPCPVSLMAIKANPRLS 109
           + ++ +  YP            DP A++    W  VDI     +   ++L  IK +    
Sbjct: 58  LAKIASAAYPDESQFDPNSDYYDPKAKREQPRWYLVDIAFERKLARTITLEHIKQHAEAL 117

Query: 110 SMILIVSS---RLSVQPVTTDEY 129
                +++   RLSV PVTT ++
Sbjct: 118 GEGFPLTTRGNRLSVFPVTTTQW 140


>gi|260219524|emb|CBA26369.1| hypothetical protein Csp_E34570 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 167

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 76/149 (51%), Gaps = 21/149 (14%)

Query: 3   YWLVKSEPSEWSWK--MQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           YWL+K+EP+E S    +      VG  WTGVRNYQARN MR  M+VGD   FYHS+  + 
Sbjct: 14  YWLMKAEPAEASIDDVLAMPDATVG--WTGVRNYQARNFMRDSMQVGDGVLFYHSSCAQP 71

Query: 60  -IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI  V +    DPT               ++  W  VD+  V      ++L  ++A+
Sbjct: 72  GVVGIARVASGIKVDPTQFDPASPYFDAASKPEAPRWLLVDVQVVHKTRN-LTLPELRAD 130

Query: 106 PRLSS-MILIVSSRLSVQPVTTDEYLEVC 133
             L+  +IL   +RLS+ PV    + ++ 
Sbjct: 131 AALADLLILKKGNRLSITPVEPAHWQQIV 159


>gi|119180483|ref|XP_001241707.1| hypothetical protein CIMG_08870 [Coccidioides immitis RS]
          Length = 304

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 74/155 (47%), Gaps = 28/155 (18%)

Query: 2   AYWLVKSEPSEWSWKMQQD---------KGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           +YWL+K+EP E  ++   D         + +  EAW GVRN  ARN+MR M+ GD  FFY
Sbjct: 137 SYWLMKAEP-ESRFEKGVDVKFSIDDLREAKEPEAWDGVRNAAARNHMRAMKKGDLAFFY 195

Query: 53  HSN-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G  E++     D +A               +  WE V +         V+
Sbjct: 196 HSNCKVPGIAGTMEIVREHSVDESAFDPAHPYYDAKSSRDNPKWEVVHVEFRSKFKNLVT 255

Query: 99  LMAIK--ANP--RLSSMILIVSSRLSVQPVTTDEY 129
           L  +K  A P   L ++ ++  SRLSV PV  +E+
Sbjct: 256 LAELKSLAKPGDALENLQMLKQSRLSVSPVRPEEW 290


>gi|320035851|gb|EFW17791.1| hypothetical protein CPSG_05428 [Coccidioides posadasii str.
           Silveira]
          Length = 299

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 74/155 (47%), Gaps = 28/155 (18%)

Query: 2   AYWLVKSEPSEWSWKMQQD---------KGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           +YWL+K+EP E  ++   D         + +  EAW GVRN  ARN+MR M+ GD  FFY
Sbjct: 132 SYWLMKAEP-ESRFEKGVDVKFSIDDLREAKEPEAWDGVRNAAARNHMRAMKKGDLAFFY 190

Query: 53  HSN-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G  E++     D +A               +  WE V +         V+
Sbjct: 191 HSNCKVPGIAGTMEIVREHSVDESAFDPAHPYYDAKSSRDNPKWEVVHVEFRSKFQNLVT 250

Query: 99  LMAIK--ANP--RLSSMILIVSSRLSVQPVTTDEY 129
           L  +K  A P   L ++ ++  SRLSV PV  +E+
Sbjct: 251 LAELKSLAKPGDALENLQMLKQSRLSVSPVRPEEW 285


>gi|303321323|ref|XP_003070656.1| hypothetical protein CPC735_063840 [Coccidioides posadasii C735
           delta SOWgp]
 gi|240110352|gb|EER28511.1| hypothetical protein CPC735_063840 [Coccidioides posadasii C735
           delta SOWgp]
          Length = 299

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 74/155 (47%), Gaps = 28/155 (18%)

Query: 2   AYWLVKSEPSEWSWKMQQD---------KGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           +YWL+K+EP E  ++   D         + +  EAW GVRN  ARN+MR M+ GD  FFY
Sbjct: 132 SYWLMKAEP-ESRFEKGVDVKFSIDDLREAKEPEAWDGVRNAAARNHMRAMKKGDLAFFY 190

Query: 53  HSN-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVS 98
           HSN K   I G  E++     D +A               +  WE V +         V+
Sbjct: 191 HSNCKVPGIAGTMEIVREHSVDESAFDPAHPYYDAKSSRDNPKWEVVHVEFRSKFQNLVT 250

Query: 99  LMAIK--ANP--RLSSMILIVSSRLSVQPVTTDEY 129
           L  +K  A P   L ++ ++  SRLSV PV  +E+
Sbjct: 251 LAELKSLAKPGDALENLQMLKQSRLSVSPVRPEEW 285


>gi|189207394|ref|XP_001940031.1| thymocyte nuclear protein 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187976124|gb|EDU42750.1| thymocyte nuclear protein 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 314

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 58/122 (47%), Gaps = 18/122 (14%)

Query: 26  EAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPTA-------- 76
           E W GVRN QARNNM+ MR  D GFFYHSN K   +VGI  V+     D TA        
Sbjct: 152 EPWGGVRNPQARNNMQAMRKDDLGFFYHSNAKPSGVVGILRVVEEAKVDETAFDPKDPYY 211

Query: 77  -----EQSSCWECVDICAVCSMPCPVSLMAIKANPR----LSSMILIVSSRLSVQPVTTD 127
                 +   W CV +  V      V L  IK   +    L  M L+ +SRLSV  V  +
Sbjct: 212 DKKSDPEKPKWFCVGVEFVKEFEKAVDLHKIKEFAKDGGPLKDMQLVTNSRLSVCKVRKE 271

Query: 128 EY 129
           E+
Sbjct: 272 EW 273


>gi|149619053|ref|XP_001518164.1| PREDICTED: similar to Thymocyte nuclear protein 1 [Ornithorhynchus
           anatinus]
          Length = 676

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 77/158 (48%), Gaps = 31/158 (19%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           +WL+KSEP        +  + ++  K +  +   W GVRNYQARN MR+M+VG++ FFYH
Sbjct: 507 HWLMKSEPESRLEKGVDVKFSIEDLKAQPNQTTCWDGVRNYQARNFMRRMKVGEESFFYH 566

Query: 54  SN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSL 99
            N +   IVG+  V+   YPD T             ++ +  W  VD+  V      + L
Sbjct: 567 CNCRHPGIVGVMRVVKTAYPDHTQFEPKAPHYDASSSKDNPKWCMVDVQFVRMTKRLIPL 626

Query: 100 MAIKA--------NPRLSSMILIVSSRLSVQPVTTDEY 129
             +KA           L ++ L    +L VQPVT +E+
Sbjct: 627 AELKAYHLEHKASGGPLKALALFTRPKLIVQPVTPEEF 664


>gi|134109597|ref|XP_776913.1| hypothetical protein CNBC4040 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50259593|gb|EAL22266.1| hypothetical protein CNBC4040 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 249

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/173 (30%), Positives = 76/173 (43%), Gaps = 40/173 (23%)

Query: 4   WLVKSEPSEWSWKMQQ------DKGRVG-EAWTGVRNYQARNNMR-KMRVGDKGFFYHSN 55
           WL+K+EP     K +       D  RVG   W GVRN++A+  MR KM++GDK  FYHSN
Sbjct: 3   WLMKAEPDSRIVKGKDVKFSVDDFERVGVSPWDGVRNHEAKKIMREKMKLGDKVLFYHSN 62

Query: 56  -KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDI-------------- 87
            K   +  + E+    YPD TA             + S  W  VD+              
Sbjct: 63  CKVPGVFAVAEISKEGYPDFTAWDPDHPYFDPKSKQDSPTWFMVDVRFKRRLDYPPTLAL 122

Query: 88  ----CAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
                 + ++P  VS +  +    + +M L+   RLSVQPV    Y  +  +G
Sbjct: 123 IKHLATLSNLPKEVSYIGDRGLEAIKNMSLVNRGRLSVQPVDDAAYNAIVELG 175


>gi|307579838|gb|ADN63807.1| hypothetical protein XFLM_09620 [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 147

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 70/142 (49%), Gaps = 20/142 (14%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREIVGI 63
           +KSEP  +S    Q  G   E W GVRNYQARN +R K+ +GD   FYHSN K   IVG+
Sbjct: 1   MKSEPDAFSIDDLQQVGT--EPWNGVRNYQARNFIRDKIHIGDGVLFYHSNCKPPGIVGL 58

Query: 64  FEVITCTYP------------DPTAEQSSC-WECVDICAVCSMPCPVSLMAIKANPRLSS 110
            ++ +  YP            DP A +    W  VDI     +   ++L  IK   +   
Sbjct: 59  AKIASAAYPDESQFDPNSDYYDPKANREQPRWYLVDIAFERKLARTITLENIKQYAKTLG 118

Query: 111 M---ILIVSSRLSVQPVTTDEY 129
               ++   +RLSV PVTT ++
Sbjct: 119 EGFPLITRGNRLSVFPVTTSQW 140


>gi|225849060|ref|YP_002729224.1| hypothetical protein SULAZ_1254 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643235|gb|ACN98285.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 132

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 70/122 (57%), Gaps = 8/122 (6%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           Y+L+K+EPSE+S+   + +GR    W GV+N  A+  ++ M+  DK F YHS K + IVG
Sbjct: 4   YYLLKTEPSEYSYDDLEKEGRT--VWNGVKNPLAQKFIKSMKPKDKVFIYHSGKEKAIVG 61

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           + EVI+    +P  ++++ +  VDI  +  +   ++L  IK+        L+   RLSV 
Sbjct: 62  LGEVIS----EPYLDENNLY-VVDIKPLKRL-KLLTLKEIKSITDFKDFYLVRMPRLSVM 115

Query: 123 PV 124
           PV
Sbjct: 116 PV 117


>gi|322699355|gb|EFY91117.1| AT DNA binding protein [Metarhizium acridum CQMa 102]
          Length = 320

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 71/152 (46%), Gaps = 17/152 (11%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHS 54
           YWL+K+EP        +  + +   +G+   E W G+R Y ARN MR M  GDK FFYHS
Sbjct: 126 YWLMKAEPETRYENGIDVRFSIDDLRGKTKPEGWDGIRAYAARNYMRNMNAGDKAFFYHS 185

Query: 55  N-KGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCP----VSLMAIKANPRLS 109
           N K   IVGI EV+     D       C E + I +V S   P        + K  PR S
Sbjct: 186 NCKEPGIVGIMEVVKEFSEDGWPLLDCCPEFLLIKSVVSARRPGTPYYDPQSTKDKPRWS 245

Query: 110 SMILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
            + +    + +V P+T  E  E   MGK   P
Sbjct: 246 LVHVEFRKKFAV-PITLKELRE---MGKPGGP 273


>gi|148693366|gb|EDL25313.1| thymocyte nuclear protein 1, isoform CRA_b [Mus musculus]
          Length = 207

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 52/88 (59%), Gaps = 10/88 (11%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP        +  + ++  K +  +   W GVRNYQARN +R M++ D+ FFYH
Sbjct: 97  YWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFYH 156

Query: 54  SN-KGREIVGIFEVITCTYPDPTAEQSS 80
           SN K   IVG+ +++   YPD T  + S
Sbjct: 157 SNCKQPGIVGLMKIVKEAYPDHTQFEKS 184


>gi|240281730|gb|EER45233.1| AT DNA binding protein [Ajellomyces capsulatus H143]
          Length = 298

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 73/154 (47%), Gaps = 26/154 (16%)

Query: 2   AYWLVKSEPSEW-----SWKMQQDKGRVG---EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP          K   D  R     EAW GVRN  ARNNMR M+ GD  FFYH
Sbjct: 135 SYWLMKAEPESRMEKGVDVKFSIDDLREASEPEAWDGVRNPTARNNMRAMKKGDLAFFYH 194

Query: 54  SN-KGREIVGIFEVI------------TCTYPDP-TAEQSSCWECVDICAVCSMPCPVSL 99
           SN K   I GI E++               Y DP ++ ++  WE V +         ++L
Sbjct: 195 SNCKVPGIAGIMEIVREHSVDESAFDPAHPYYDPKSSRENPKWEVVHVEFRRKFKDLITL 254

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
             +K+  +    L +M ++  SRLSV  V   E+
Sbjct: 255 AELKSFAKPGGPLENMQMMKQSRLSVSVVGGKEW 288


>gi|325087873|gb|EGC41183.1| AT DNA binding protein [Ajellomyces capsulatus H88]
          Length = 298

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 73/154 (47%), Gaps = 26/154 (16%)

Query: 2   AYWLVKSEPSEW-----SWKMQQDKGRVG---EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP          K   D  R     EAW GVRN  ARNNMR M+ GD  FFYH
Sbjct: 135 SYWLMKAEPESRMEKGVDVKFSIDDLREASEPEAWDGVRNPTARNNMRAMKKGDLAFFYH 194

Query: 54  SN-KGREIVGIFEVI------------TCTYPDP-TAEQSSCWECVDICAVCSMPCPVSL 99
           SN K   I GI E++               Y DP ++ ++  WE V +         ++L
Sbjct: 195 SNCKVPGIAGIMEIVREHSVDESAFDPAHPYYDPKSSRENPKWEVVHVEFRRKFKDLITL 254

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
             +K+  +    L +M ++  SRLSV  V   E+
Sbjct: 255 AELKSFAKPGGPLENMQMMKQSRLSVSVVGGKEW 288


>gi|298241553|ref|ZP_06965360.1| protein of unknown function DUF55 [Ktedonobacter racemifer DSM
           44963]
 gi|297554607|gb|EFH88471.1| protein of unknown function DUF55 [Ktedonobacter racemifer DSM
           44963]
          Length = 136

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAY+L K++P  ++ +  + + R    W GVRN QA   ++ M+ GD    YHS  G  +
Sbjct: 1   MAYFLAKTDPETYAIEQLEQEQRT--TWDGVRNAQAVRFIQTMKPGDTMLIYHSMGGAAL 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG   VI+   P P    S  W  VD+  V     PV+L  IK         LI  SRLS
Sbjct: 59  VGEARVISE--PRPDEHDSKSW-VVDVEFVRRFATPVTLREIKETHLFDDWSLIRQSRLS 115

Query: 121 VQPV 124
              V
Sbjct: 116 TMSV 119


>gi|297566542|ref|YP_003685514.1| hypothetical protein Mesil_2135 [Meiothermus silvanus DSM 9946]
 gi|296850991|gb|ADH64006.1| protein of unknown function DUF55 [Meiothermus silvanus DSM 9946]
          Length = 151

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 48/77 (62%), Gaps = 5/77 (6%)

Query: 1  MAYWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
          MAYWL+KSEP  +  + +++ K  V   W GVRNYQARN +R M+VGD  FFYHS+    
Sbjct: 1  MAYWLLKSEPDVYGIRDLERQKTTV---WDGVRNYQARNFLRAMQVGDLVFFYHSSTAFP 57

Query: 60 -IVGIFEVITCTYPDPT 75
           I G+  VI     DPT
Sbjct: 58 GIAGLCRVIETEVVDPT 74


>gi|329918093|ref|ZP_08276521.1| hypothetical protein IMCC9480_2869 [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327544444|gb|EGF30009.1| hypothetical protein IMCC9480_2869 [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 150

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 71/140 (50%), Gaps = 17/140 (12%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREIVGI 63
           +KSEP+E S             W G+RNYQ+RN MR  MRVGD   FYHS+     IVG+
Sbjct: 1   MKSEPTEVSIDDVLAAPDQTMPWFGIRNYQSRNFMRDAMRVGDGVLFYHSSCAAPGIVGL 60

Query: 64  FEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSS 110
            EV +  YPD T               ++  W  VDI A+ ++P  V L A++A   L+ 
Sbjct: 61  AEVASTAYPDFTQFEPRSHYFDPKATPENPRWMMVDIRALRAVPL-VPLSALRAAEELAD 119

Query: 111 M-ILIVSSRLSVQPVTTDEY 129
           M +L   +RLS+  V   ++
Sbjct: 120 MQVLKRGNRLSISRVEAADW 139


>gi|213407976|ref|XP_002174759.1| thymocyte nuclear protein [Schizosaccharomyces japonicus yFS275]
 gi|212002806|gb|EEB08466.1| thymocyte nuclear protein [Schizosaccharomyces japonicus yFS275]
          Length = 219

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 88/169 (52%), Gaps = 28/169 (16%)

Query: 1   MAYWLVKSEPS---------EWSWKMQQDKGRVGE--AWTGVRNYQARNNMR-KMRVGDK 48
           + YWL+K+EP           + ++M ++  + GE  AW GVRNY+ARN ++ +M++GD 
Sbjct: 29  LHYWLMKAEPDTRFVNGTDIAFDYEMLEELTKNGEYKAWGGVRNYEARNMIKSEMKLGDL 88

Query: 49  GFFYHSN-KGREIVGIFEVITCTYP------------DPTAE-QSSCWECVDICAVCSMP 94
            FFY+SN K   I G+ E+    +P            DP ++ +   W  + + A   + 
Sbjct: 89  VFFYYSNCKPPRIAGVMEICREAFPEANAFNKENPYYDPKSDPERPRWFSIGVKAKFKLK 148

Query: 95  --CPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
              P+  + + +N +L++M  +  SRLSV  V+  E+  +  + + ++P
Sbjct: 149 REIPLHELRMYSNNQLANMESLKRSRLSVSRVSPREWQFILDLAEQASP 197


>gi|183219657|ref|YP_001837653.1| hypothetical protein LEPBI_I0232 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189909794|ref|YP_001961349.1| hypothetical protein LBF_0225 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167774470|gb|ABZ92771.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167778079|gb|ABZ96377.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 155

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 74/156 (47%), Gaps = 20/156 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMR-KMRVGDKGFFYHSN-KG 57
           M YWL K+EP  +S     D  R   + W GVRNYQARN +R ++++GD   FYHS  + 
Sbjct: 1   MKYWLFKTEPDVFSI---DDLIREKLSYWEGVRNYQARNYLRDEVKIGDLVLFYHSRLEP 57

Query: 58  REIVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKA 104
             +VGI EV     PDP     +              W  V +         + L ++K 
Sbjct: 58  PGVVGIAEVAKEASPDPYQFDPNHKYFDPKLKGPEPRWFGVHLKPHTKFKELIPLESLKQ 117

Query: 105 NPRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGKLS 139
              L  M++    SRLS+QPVT  E+  V ++  ++
Sbjct: 118 TKGLEKMVVTQKGSRLSIQPVTKKEFEIVTKLAGVT 153


>gi|195952871|ref|YP_002121161.1| protein of unknown function DUF55 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932483|gb|ACG57183.1| protein of unknown function DUF55 [Hydrogenobaculum sp. Y04AAS1]
          Length = 132

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 7/124 (5%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M Y+L+K+EPS +S+ M + +G+    W GV+N  A+  ++  +  D  + YH+   + I
Sbjct: 1   MKYFLLKTEPSSYSYDMLEKEGKT--VWDGVKNPLAQKFIKSAKPEDMAYIYHTGDEKAI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ ++++  Y D     SS     DI  +  +   +SL  IK+        L+   RLS
Sbjct: 59  VGLAKIVSSPYQD-----SSGLFVFDIVPIRRLKRKISLSEIKSIEAFKDFYLVKMPRLS 113

Query: 121 VQPV 124
           V  V
Sbjct: 114 VMEV 117


>gi|26346536|dbj|BAC36919.1| unnamed protein product [Mus musculus]
          Length = 167

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 52/88 (59%), Gaps = 10/88 (11%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP        +  + ++  K +  +   W GVRNYQARN +R M++ D+ FFYH
Sbjct: 57  YWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFYH 116

Query: 54  SN-KGREIVGIFEVITCTYPDPTAEQSS 80
           SN K   IVG+ +++   YPD T  + S
Sbjct: 117 SNCKQPGIVGLMKIVKEAYPDHTQFEKS 144


>gi|115497434|ref|NP_001069890.1| thymocyte nuclear protein 1 [Bos taurus]
 gi|111305160|gb|AAI20287.1| Thymocyte nuclear protein 1 [Bos taurus]
 gi|296479450|gb|DAA21565.1| thymocyte nuclear protein 1 [Bos taurus]
          Length = 196

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 50/84 (59%), Gaps = 10/84 (11%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           +YWL+KSEP          ++S +  Q + R    W GVRNYQARN +R MR+ ++ FFY
Sbjct: 53  SYWLMKSEPESRLEKGVDVKFSIEDLQAQPRQTTCWDGVRNYQARNFLRAMRLDEEAFFY 112

Query: 53  HSN-KGREIVGIFEVITCTYPDPT 75
           HSN +   I G+ +++   YPD T
Sbjct: 113 HSNCREPGIAGLVKIVKEAYPDHT 136


>gi|94970625|ref|YP_592673.1| hypothetical protein Acid345_3598 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94552675|gb|ABF42599.1| conserved hypothetical protein [Candidatus Koribacter versatilis
           Ellin345]
          Length = 125

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 66/127 (51%), Gaps = 10/127 (7%)

Query: 4   WLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           +L+K+EP  +S+  +Q+DK      W GV N  A  ++R+M+ GD+   YH+   R  VG
Sbjct: 3   YLLKTEPGTYSFADLQRDKE---TTWDGVSNPTAVKHLREMKKGDELVIYHTGDERTAVG 59

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
              V++    DP          V I A  ++  P +L  +KA+ R +   L+  SRLSV 
Sbjct: 60  TATVLSVDAADPKK------PLVKIKAGKAIANPKTLEVVKADRRFTESPLVRQSRLSVV 113

Query: 123 PVTTDEY 129
           P+T  ++
Sbjct: 114 PLTAVQF 120


>gi|317145993|ref|XP_001821215.2| AT DNA binding protein (Thy28) [Aspergillus oryzae RIB40]
          Length = 289

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 78/162 (48%), Gaps = 26/162 (16%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVG--------EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP     K    K  +         E W GVRN  ARN++R+M+ GD  FFYH
Sbjct: 111 SYWLMKAEPESRLEKGVDVKFSIDDLASRSKPEPWDGVRNPAARNHIREMKKGDYAFFYH 170

Query: 54  SN-KGREIVGIFEVITCTYPDPTA---------EQSS----CWECVDICAVCSMPCPVSL 99
           SN K   + G  E++    PD +A         E+SS     W+ V +         VSL
Sbjct: 171 SNCKVPGVAGFMEIVQEHTPDESAFDPAHPYYDEKSSREDPKWDVVHVEFRRKFQNFVSL 230

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             +KA+ +    L ++ ++  SRLSV  VT  E+  +  + K
Sbjct: 231 NDLKAHAKAGDPLENLQVLKQSRLSVSRVTKKEWDFILGLAK 272


>gi|225631161|ref|ZP_03787868.1| hypothetical protein WUni_003190 [Wolbachia endosymbiont of
          Muscidifurax uniraptor]
 gi|225591140|gb|EEH12315.1| hypothetical protein WUni_003190 [Wolbachia endosymbiont of
          Muscidifurax uniraptor]
          Length = 62

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 2/58 (3%)

Query: 1  MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGR 58
          M +WL+KSEPSE+SW+ + +K +V E W GVRNYQA+N M+ M+  D  FFYH+ K +
Sbjct: 1  MQFWLLKSEPSEYSWQ-KMEKDQVVE-WDGVRNYQAQNYMKIMKASDLAFFYHTGKEK 56


>gi|85094407|ref|XP_959884.1| hypothetical protein NCU05893 [Neurospora crassa OR74A]
 gi|28921340|gb|EAA30648.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 287

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 70/157 (44%), Gaps = 28/157 (17%)

Query: 3   YWLVKSEP-------SEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHS 54
           YWL+K+EP        +  + +     R   E W G+RNY ARNN+R MRVGD  FFYHS
Sbjct: 117 YWLLKAEPLPRLENGYDVHFSIDDLAARTSPEPWDGIRNYSARNNLRSMRVGDLAFFYHS 176

Query: 55  N-KGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMP-----------CPVSLMAI 102
           N     IVG+ E++         E    W  VD  A    P            P SL+ +
Sbjct: 177 NCANPGIVGVMEIVR--------EAEEDWTAVDPKAAYFDPKSKKAKEEGKENPWSLVHV 228

Query: 103 KANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLS 139
           +   +    + +   R   +     E +E+ R+G+LS
Sbjct: 229 EFREKFERELGLKELREWGKGGGPLEGMELLRLGRLS 265


>gi|154294361|ref|XP_001547622.1| hypothetical protein BC1G_13953 [Botryotinia fuckeliana B05.10]
 gi|150844792|gb|EDN19985.1| hypothetical protein BC1G_13953 [Botryotinia fuckeliana B05.10]
          Length = 276

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 71/148 (47%), Gaps = 21/148 (14%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGE--AWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           YWL+K+EP     K    K  + +  A T    + ARNN+R M+ GD  FFYHS+ K   
Sbjct: 113 YWLMKAEPESRIEKGHDIKFSIDDLAAKTEPEPWDARNNLRAMKKGDLAFFYHSSCKIPA 172

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKA-- 104
           IVGI E++    PD +A                  W  V +     +  P++L  IKA  
Sbjct: 173 IVGIMEIVEEHSPDLSAHDPKAPYYDPKSSPDDPKWSVVHVEFRQKLKTPITLKEIKAWF 232

Query: 105 ---NPRLSSMILIVSSRLSVQPVTTDEY 129
                 L++M ++  +RLSV  V++DE+
Sbjct: 233 EEKGNALNNMQMLKLARLSVSKVSSDEW 260


>gi|332264028|ref|XP_003281050.1| PREDICTED: thymocyte nuclear protein 1-like isoform 3 [Nomascus
           leucogenys]
 gi|332264030|ref|XP_003281051.1| PREDICTED: thymocyte nuclear protein 1-like isoform 4 [Nomascus
           leucogenys]
          Length = 176

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/84 (41%), Positives = 51/84 (60%), Gaps = 10/84 (11%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + R    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPRQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT 75
           HSN K   I GI +++   YPD T
Sbjct: 115 HSNCKEPGIAGIMKIVKEAYPDHT 138


>gi|238491480|ref|XP_002376977.1| AT DNA binding protein (Thy28), putative [Aspergillus flavus
           NRRL3357]
 gi|220697390|gb|EED53731.1| AT DNA binding protein (Thy28), putative [Aspergillus flavus
           NRRL3357]
          Length = 307

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 78/162 (48%), Gaps = 26/162 (16%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVG--------EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP     K    K  +         E W GVRN  ARN++R+M+ GD  FFYH
Sbjct: 129 SYWLMKAEPESRLEKGVDVKFSIDDLASRSKPEPWDGVRNPAARNHIREMKKGDYAFFYH 188

Query: 54  SN-KGREIVGIFEVITCTYPDPTA---------EQSS----CWECVDICAVCSMPCPVSL 99
           SN K   + G  E++    PD +A         E+SS     W+ V +         VSL
Sbjct: 189 SNCKVPGVAGFMEIVQEHTPDESAFDPAHPYYDEKSSREDPKWDVVHVEFRRKFQNFVSL 248

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             +KA+ +    L ++ ++  SRLSV  VT  E+  +  + K
Sbjct: 249 NDLKAHAKAGDPLENLQVLKQSRLSVSRVTKKEWDFILGLAK 290


>gi|83769076|dbj|BAE59213.1| unnamed protein product [Aspergillus oryzae]
          Length = 304

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 78/162 (48%), Gaps = 26/162 (16%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVG--------EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP     K    K  +         E W GVRN  ARN++R+M+ GD  FFYH
Sbjct: 126 SYWLMKAEPESRLEKGVDVKFSIDDLASRSKPEPWDGVRNPAARNHIREMKKGDYAFFYH 185

Query: 54  SN-KGREIVGIFEVITCTYPDPTA---------EQSS----CWECVDICAVCSMPCPVSL 99
           SN K   + G  E++    PD +A         E+SS     W+ V +         VSL
Sbjct: 186 SNCKVPGVAGFMEIVQEHTPDESAFDPAHPYYDEKSSREDPKWDVVHVEFRRKFQNFVSL 245

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             +KA+ +    L ++ ++  SRLSV  VT  E+  +  + K
Sbjct: 246 NDLKAHAKAGDPLENLQVLKQSRLSVSRVTKKEWDFILGLAK 287


>gi|264678408|ref|YP_003278315.1| hypothetical protein CtCNB1_2273 [Comamonas testosteroni CNB-2]
 gi|262208921|gb|ACY33019.1| hypothetical conserved protein [Comamonas testosteroni CNB-2]
          Length = 162

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 71/143 (49%), Gaps = 17/143 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+K+EP E+S        +   AW GVRNYQARN MR  M+VGD   ++HS+     I
Sbjct: 11  YWLMKNEPDEYSIDHALASPQQTIAWNGVRNYQARNFMRDDMQVGDGVLYWHSSCAEPGI 70

Query: 61  VGI-------------FEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI             F+     Y   +      W  +D+ A+  +  P+ +  ++  P+
Sbjct: 71  YGIARIAGNLRVDPSQFDPADPYYDSKSQNDKPRWLMLDVQALKKI-RPLLMPELREQPQ 129

Query: 108 LSSM-ILIVSSRLSVQPVTTDEY 129
           L+ M +L   +RLS+ PVT  E+
Sbjct: 130 LAQMRVLQKGNRLSITPVTEAEW 152


>gi|291296513|ref|YP_003507911.1| hypothetical protein Mrub_2137 [Meiothermus ruber DSM 1279]
 gi|290471472|gb|ADD28891.1| protein of unknown function DUF55 [Meiothermus ruber DSM 1279]
          Length = 152

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 1  MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
          M +WL+KSEP  +S  +   K +    W GVRNYQARN +R M+VGD  FFYHS+ +   
Sbjct: 1  MNHWLLKSEPDVFS--IDDLKKQKTTLWDGVRNYQARNFLRAMQVGDLAFFYHSSTEPPG 58

Query: 60 IVGIFEVITCTYPDPT 75
          IVG+ +V+     DP+
Sbjct: 59 IVGLCQVLETHIADPS 74


>gi|296416993|ref|XP_002838152.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634061|emb|CAZ82343.1| unnamed protein product [Tuber melanosporum]
          Length = 259

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 68/147 (46%), Gaps = 24/147 (16%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGE--------AWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP     K +  K  + +         W GVRNY ARNN++ M+ GD  FFYH
Sbjct: 94  SYWLMKAEPGTRVEKGKDVKFSIDDLRACKKPAGWDGVRNYGARNNLKSMKKGDLAFFYH 153

Query: 54  SN-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSL 99
           SN +   IVGI E++     D TA               +  W  V +     +   V L
Sbjct: 154 SNCREPGIVGIMEIVQEATIDETAFNPEEPYYDPKSSRDNPKWFLVHVEFRRKLERLVGL 213

Query: 100 MAIK--ANPRLSSMILIVSSRLSVQPV 124
             +K  A+  LS + L+   RLSV  V
Sbjct: 214 AELKRYASKELSVLPLLKMGRLSVSAV 240


>gi|47227741|emb|CAG08904.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 227

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 74/161 (45%), Gaps = 35/161 (21%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFYH 53
           +WL+KSEP        +  + ++  K    +   W GVR++QARN MR+M+ G   FFYH
Sbjct: 56  HWLMKSEPESRFENGVDVKFGIEDLKAMPDQTSCWDGVRSFQARNFMRQMKKGQMAFFYH 115

Query: 54  SN-KGREIVGIF--EVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPV 97
           SN K   I G+   +V+   Y D T                +  W  VD+  +  M   +
Sbjct: 116 SNCKEPGIAGLMKAQVVKEAYVDHTQFDKKDVHFDGSSKPDNPKWSMVDVQYLRMMKRFI 175

Query: 98  SLMAIK---------ANPRLSSMILIVSSRLSVQPVTTDEY 129
            L  +K           P L  M L   +RLSVQP+TT+E+
Sbjct: 176 PLSELKRYHLQHRAEGGP-LKDMALFTKARLSVQPLTTEEF 215


>gi|195996501|ref|XP_002108119.1| hypothetical protein TRIADDRAFT_52267 [Trichoplax adhaerens]
 gi|190588895|gb|EDV28917.1| hypothetical protein TRIADDRAFT_52267 [Trichoplax adhaerens]
          Length = 184

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 68/145 (46%), Gaps = 38/145 (26%)

Query: 4   WLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYH 53
           WL+KSEP          ++S+   +        W GVRN+QARN MR  M+VG  GFFYH
Sbjct: 45  WLLKSEPDSRFENGVDMKFSFDDLKSSPDQITQWDGVRNFQARNLMRDCMKVGHLGFFYH 104

Query: 54  SN-KGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKA-------- 104
           SN K   I GI +V                   D+  V  +   +SL  +K+        
Sbjct: 105 SNCKNPGIAGIVKV-------------------DVKYVRDLKRFISLSELKSYHEKHKTN 145

Query: 105 NPRLSSMILIVSSRLSVQPVTTDEY 129
           +  L +M L  + RLSVQPVT +EY
Sbjct: 146 DGPLKNMRLFTNRRLSVQPVTDEEY 170


>gi|313199938|ref|YP_004038596.1| hypothetical protein MPQ_0171 [Methylovorus sp. MP688]
 gi|312439254|gb|ADQ83360.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 148

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 64/124 (51%), Gaps = 17/124 (13%)

Query: 28  WTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-IVGIFEVITCTYP------------D 73
           W GVRNYQARN MR +M+VGD   FYHSN     IVGI EV    YP            D
Sbjct: 23  WYGVRNYQARNFMRDQMKVGDGVLFYHSNCAEPGIVGIAEVSRLAYPDRLQFVEGHKYYD 82

Query: 74  PTAE-QSSCWECVDICAVCSMPCPVSLMAIKANPRLSSM-ILIVSSRLSVQPVTTDEYLE 131
           P A  ++  W  VD+  V      +SL  ++  P L S+ IL   +RLS+ PV   E+  
Sbjct: 83  PKATPENPRWFNVDVKLVRKTRL-LSLKEMRETPELESLRILQRGNRLSITPVDPREWNF 141

Query: 132 VCRM 135
           + ++
Sbjct: 142 IMKL 145


>gi|332838241|ref|XP_003313469.1| PREDICTED: thymocyte nuclear protein 1 isoform 2 [Pan troglodytes]
 gi|332838243|ref|XP_003313470.1| PREDICTED: thymocyte nuclear protein 1 isoform 3 [Pan troglodytes]
          Length = 166

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 10/84 (11%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT 75
           HSN K   I G+ +++   YPD T
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHT 138


>gi|40806219|ref|NP_954994.1| thymocyte nuclear protein 1 isoform 2 [Homo sapiens]
 gi|83267859|ref|NP_001032381.1| thymocyte nuclear protein 1 isoform 2 [Homo sapiens]
 gi|10197626|gb|AAG14949.1|AF182413_1 MDS012 [Homo sapiens]
 gi|13937763|gb|AAH06978.1| Thymocyte nuclear protein 1 [Homo sapiens]
 gi|119588236|gb|EAW67832.1| thymocyte nuclear protein 1, isoform CRA_c [Homo sapiens]
 gi|325463977|gb|ADZ15759.1| thymocyte nuclear protein 1 [synthetic construct]
          Length = 166

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 10/84 (11%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT 75
           HSN K   I G+ +++   YPD T
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHT 138


>gi|119588233|gb|EAW67829.1| thymocyte nuclear protein 1, isoform CRA_b [Homo sapiens]
          Length = 166

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 10/84 (11%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT 75
           HSN K   I G+ +++   YPD T
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHT 138


>gi|296216690|ref|XP_002754678.1| PREDICTED: thymocyte nuclear protein 1-like [Callithrix jacchus]
          Length = 166

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (60%), Gaps = 10/84 (11%)

Query: 2   AYWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP          ++S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPT 75
           HSN K   I G+ +++   YPD T
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHT 138


>gi|148240321|ref|YP_001225708.1| hypothetical protein SynWH7803_1985 [Synechococcus sp. WH 7803]
 gi|147848860|emb|CAK24411.1| Conserved hypothetical protein [Synechococcus sp. WH 7803]
          Length = 142

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 55/112 (49%), Gaps = 15/112 (13%)

Query: 28  WTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPTAEQSSC----- 81
           W G+RNYQARN MR M +GD+ FFYHSN K   I+G+ EV      DPT    S      
Sbjct: 15  WDGIRNYQARNFMRSMAIGDQAFFYHSNCKPLGIIGLMEVSETGLVDPTQFDPSSKYHDP 74

Query: 82  --------WECVDICAVCSMPCPVSLMAIKANPRLSSMILIV-SSRLSVQPV 124
                   W+CV +         +SL  ++   +   + ++   +RLS+ PV
Sbjct: 75  ASKPEAPRWDCVKLTYKGRFGSLLSLDDLRQAYQPEQLAVVKRGNRLSILPV 126


>gi|33865065|ref|NP_896624.1| hypothetical protein SYNW0529 [Synechococcus sp. WH 8102]
 gi|33638749|emb|CAE07044.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
          Length = 148

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 22/151 (14%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIF 64
           +KSEP  +     + +G     W G+RNYQARN MR M +GD+ FFYHSN K   I+G+ 
Sbjct: 1   MKSEPEAYGIDDLRREGST--LWDGIRNYQARNFMRSMAIGDQAFFYHSNCKPPGIIGLM 58

Query: 65  EVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANPRLSSM 111
           EV      DPT                   W+C  +  +      +SL  ++       +
Sbjct: 59  EVEEIGLVDPTQFDPDAKYYDPKSNRDKPRWDCARLRFLGEFQQLLSLDQLREQYSEEQL 118

Query: 112 ILIV-SSRLSVQPV---TTDEYLEVCRMGKL 138
            +I   +RLS+ PV   T  + LE  R+G L
Sbjct: 119 PVIKRGNRLSILPVPDATAADLLE--RLGPL 147


>gi|299532256|ref|ZP_07045650.1| hypothetical protein CTS44_15703 [Comamonas testosteroni S44]
 gi|298719918|gb|EFI60881.1| hypothetical protein CTS44_15703 [Comamonas testosteroni S44]
          Length = 162

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 71/143 (49%), Gaps = 17/143 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE-I 60
           YWL+K+EP E+S            AW GVRNYQARN MR  M+ GD   ++HS+     I
Sbjct: 11  YWLMKNEPDEYSIDHALASPEQTIAWNGVRNYQARNFMRDDMQAGDGVLYWHSSCAEPGI 70

Query: 61  VGIFEVI------------TCTYPDPTAEQSSC-WECVDICAVCSMPCPVSLMAIKANPR 107
            GI  +                Y DP ++     W  +D+ A+  +  P+ +  ++  P+
Sbjct: 71  YGIARIAGNLRVDPSQFDPADPYYDPKSQNDKPRWLMLDVQALKKI-RPLLMPELREQPQ 129

Query: 108 LSSM-ILIVSSRLSVQPVTTDEY 129
           L+ M +L   +RLS+ PVT  E+
Sbjct: 130 LAQMRVLQKGNRLSITPVTEAEW 152


>gi|289615561|emb|CBI57694.1| unnamed protein product [Sordaria macrospora]
          Length = 290

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 70/159 (44%), Gaps = 32/159 (20%)

Query: 3   YWLVKSEP-------SEWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHS 54
           YWL+K+EP        +  + +   + R   E W G+RNY ARNN+R M+ GD  FFYHS
Sbjct: 116 YWLLKAEPLPRLENGHDVRFSIDDLRTRTAPEPWDGIRNYSARNNLRSMKRGDLAFFYHS 175

Query: 55  N-KGREIVGIFEVI------------TCTYPDPTAE------QSSCWECVDICAVCSMPC 95
           N     IVG+ E++               Y D  A+      + + W  V +        
Sbjct: 176 NCPSPGIVGVMEIVKEAEEDWTAVDPKAAYFDAKAQAKVDKGEENPWSLVHVVFREKFER 235

Query: 96  PVSLMAIK-----ANPRLSSMILIVSSRLSVQPVTTDEY 129
            + L  ++         L +M LI  SRLSV  V+  E+
Sbjct: 236 ELGLKELREWAGEKGGALENMQLIRQSRLSVSKVSEGEW 274


>gi|261204097|ref|XP_002629262.1| AT DNA binding protein [Ajellomyces dermatitidis SLH14081]
 gi|239587047|gb|EEQ69690.1| AT DNA binding protein [Ajellomyces dermatitidis SLH14081]
          Length = 289

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 73/154 (47%), Gaps = 26/154 (16%)

Query: 2   AYWLVKSEPS-------EWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP        +  + +   +G    E W GVRN  ARNNMR M+ GD  FFYH
Sbjct: 126 SYWLMKAEPESRIEKGIDVRFSIDDLRGASEPEPWDGVRNPTARNNMRAMKKGDLAFFYH 185

Query: 54  SN-KGREIVGIFEVI------------TCTYPDPTAEQSS-CWECVDICAVCSMPCPVSL 99
           SN K   I GI E++               Y DP + + +  WE V +         ++L
Sbjct: 186 SNCKVPGIAGIMEIVREHSVDESAFDPAHPYYDPKSNRENPKWELVHVEFRRKFRDLITL 245

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
             +K+  +    L +M ++  SRLSV  V   E+
Sbjct: 246 AELKSFAKPGGPLENMQMMKQSRLSVSAVNGKEW 279


>gi|307135954|gb|ADN33814.1| hypothetical protein [Cucumis melo subsp. melo]
          Length = 201

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 71/136 (52%), Gaps = 8/136 (5%)

Query: 3   YWLVKSEPSEWSWKMQQ-DKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           YWL+K+EP+EWSW  Q  + GR    W GV+N QA+ +++ M++GD+ FFYHS      V
Sbjct: 57  YWLLKTEPAEWSWADQAANDGR--SKWDGVKNKQAQKHLKSMKLGDRCFFYHSGAKARRV 114

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKAN-PRLSSMILIVSSRLS 120
                +   +     ++      VD+ AV  M  PV L  +K     + +  L    RLS
Sbjct: 115 VGVVAVAREWYSSVEDEVV----VDVEAVGEMREPVDLKEMKKGMEGMKNFALFRQPRLS 170

Query: 121 VQPVTTDEYLEVCRMG 136
           V PV  + + ++C +G
Sbjct: 171 VVPVAKEIWDKICELG 186


>gi|149027882|gb|EDL83342.1| thymocyte nuclear protein 1, isoform CRA_c [Rattus norvegicus]
          Length = 168

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 10/83 (12%)

Query: 3   YWLVKSEPS---------EWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           YWL+KSEP          ++S +  Q + +    W GVRNYQA N +R M++ D+ FFYH
Sbjct: 57  YWLMKSEPESRLEKGIDMKFSIEDLQAQPKQTTCWDGVRNYQAWNFLRAMKLEDEAFFYH 116

Query: 54  SN-KGREIVGIFEVITCTYPDPT 75
           SN K   IVG+ +++   YPD T
Sbjct: 117 SNCKQPGIVGLMKIVKEAYPDHT 139


>gi|327283902|ref|XP_003226679.1| PREDICTED: thymocyte nuclear protein 1-like isoform 3 [Anolis
           carolinensis]
          Length = 171

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (59%), Gaps = 10/84 (11%)

Query: 2   AYWLVKSEPS-------EWSWKMQQDKGRVGEA--WTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP        +  + ++  K +  +   W GVRNYQARN ++ M+VG + FFY
Sbjct: 60  SHWLMKSEPESRFEKGVDVKFGIEDLKAQPNQTACWDGVRNYQARNFLKDMKVGQEAFFY 119

Query: 53  HSN-KGREIVGIFEVITCTYPDPT 75
           HSN K   I GI +++   YPD T
Sbjct: 120 HSNCKEPGIAGIVKIVQEAYPDHT 143


>gi|322434926|ref|YP_004217138.1| protein of unknown function DUF55 [Acidobacterium sp. MP5ACTX9]
 gi|321162653|gb|ADW68358.1| protein of unknown function DUF55 [Acidobacterium sp. MP5ACTX9]
          Length = 125

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 65/127 (51%), Gaps = 10/127 (7%)

Query: 4   WLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           +L+K+EP+++S+  + +DK  V   W G+ N QA   +R M+ G+K   YHSN G+  +G
Sbjct: 3   FLLKTEPNKYSYDDLLRDKETV---WDGIANNQALLYLRNMKKGEKLVIYHSNIGKAAIG 59

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
             +V++    DP   Q      V I     +     L  I+A    +  IL    RLSV 
Sbjct: 60  TAKVVSVDATDPKNPQ------VRIAPGKRLKNEKPLDQIRAAAVFTDSILFRQFRLSVV 113

Query: 123 PVTTDEY 129
           P+T ++Y
Sbjct: 114 PITDEQY 120


>gi|160899406|ref|YP_001564988.1| hypothetical protein Daci_3972 [Delftia acidovorans SPH-1]
 gi|160364990|gb|ABX36603.1| protein of unknown function DUF55 [Delftia acidovorans SPH-1]
          Length = 162

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 71/143 (49%), Gaps = 17/143 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE-I 60
           +WL+K+EP E+S        +   AW GVRNYQARN MR  M+VGD   ++HS+     I
Sbjct: 11  FWLMKNEPDEFSIDHALAAPQATIAWDGVRNYQARNFMRDAMQVGDGVLYWHSSCAEPGI 70

Query: 61  VGI-------------FEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI             F+  +  Y   ++     W  +D+ A+      + +  ++ +P 
Sbjct: 71  YGIARIAGNLRVDASQFDPRSPYYDPKSSPDKPRWLTLDVQALRKTRT-LQIAELREHPE 129

Query: 108 LSSM-ILIVSSRLSVQPVTTDEY 129
           L+ M +L   +RLS+ PVT  E+
Sbjct: 130 LAGMRVLQKGNRLSITPVTPKEW 152


>gi|239608722|gb|EEQ85709.1| AT DNA binding protein [Ajellomyces dermatitidis ER-3]
          Length = 289

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 73/154 (47%), Gaps = 26/154 (16%)

Query: 2   AYWLVKSEPS-------EWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           ++WL+K+EP        +  + +   +G    E W GVRN  ARNNMR M+ GD  FFYH
Sbjct: 126 SHWLMKAEPESRIEKGIDVRFSIDDLRGASEPEPWDGVRNPTARNNMRAMKKGDLAFFYH 185

Query: 54  SN-KGREIVGIFEVI------------TCTYPDPTAEQSS-CWECVDICAVCSMPCPVSL 99
           SN K   I GI E++               Y DP + + +  WE V +         ++L
Sbjct: 186 SNCKVPGIAGIMEIVREHSVDESAFDPAHPYYDPKSNRENPKWELVHVEFRRKFRDLITL 245

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
             +K+  +    L +M ++  SRLSV  V   E+
Sbjct: 246 AELKSFAKPGGPLENMQMMKQSRLSVSAVNGKEW 279


>gi|194290537|ref|YP_002006444.1| hypothetical protein RALTA_A2449 [Cupriavidus taiwanensis LMG
           19424]
 gi|193224372|emb|CAQ70383.1| conserved hypothetical protein, DUF589 COG2947 [Cupriavidus
           taiwanensis LMG 19424]
          Length = 146

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 74/150 (49%), Gaps = 23/150 (15%)

Query: 6   VKSEPSEWSWKMQQDKGRVGE-AWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREIVG 62
           +KSEP E S     D  R     WTGVRNYQARN MR  M++GD   FYHS+     I G
Sbjct: 1   MKSEPDEASI---DDLAREHTLPWTGVRNYQARNFMRDAMQIGDGVLFYHSSCPEPGIAG 57

Query: 63  IFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPRLS 109
           + EV +  YPDPT               ++  W  VD+         + L  ++ +  L+
Sbjct: 58  LAEVCSVPYPDPTQFDRKSPYFDAASKPEAPRWLLVDVRFDRKSRL-IPLAELREHEALA 116

Query: 110 SMILI-VSSRLSVQPVTTDEYLEVCRMGKL 138
            M+++   +RLS+ PVT  E+  +   GKL
Sbjct: 117 DMVVLRRGNRLSITPVTPAEWRYIT--GKL 144


>gi|34495957|ref|NP_900172.1| hypothetical protein CV_0502 [Chromobacterium violaceum ATCC 12472]
 gi|34101811|gb|AAQ58179.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 159

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 77/159 (48%), Gaps = 25/159 (15%)

Query: 1   MAYWLVKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGR 58
           M YWL+KSEP E S   +  +  R+ E WTGVRNYQARN MR  M+ GD   F+HS+   
Sbjct: 3   MRYWLMKSEPDETSIDHLAAEPARLFE-WTGVRNYQARNFMRDDMQPGDLLLFWHSSCPE 61

Query: 59  EIVGIFEVI-------------TCTYPDPTAEQSSC-WECVDICAVCSMPCPVSLMAIKA 104
             +     +                Y DP ++ +   W CVD+  V      +    ++ 
Sbjct: 62  PGIAGIAEVAAAAHADSSQFDPASPYHDPKSDPADPRWLCVDVRFVRKTRL-LPPAELRR 120

Query: 105 NPRLSSM-ILIVSSRLSVQPVTTDEY------LEVCRMG 136
           +P L  M +L   +RLS+ PVT +E+      L++ R G
Sbjct: 121 HPPLEGMTVLKRGNRLSITPVTAEEWAYLMDLLDIRRAG 159


>gi|121707169|ref|XP_001271753.1| AT DNA binding protein (Thy28), putative [Aspergillus clavatus NRRL
           1]
 gi|119399901|gb|EAW10327.1| AT DNA binding protein (Thy28), putative [Aspergillus clavatus NRRL
           1]
          Length = 303

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 70/147 (47%), Gaps = 20/147 (13%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVG--EAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           YWL+K+EP     K    K  +   EA T    + ARN+MR M+ GD  FFYHSN K   
Sbjct: 145 YWLMKAEPESRIEKGTDVKFSIDDLEAATEPEPWDARNHMRAMKKGDYAFFYHSNCKVPG 204

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI E++    PD +A                  W+ V +         V+L  +KA+ 
Sbjct: 205 IVGIMEIVQEHTPDESAFDPAHPYYDAKSNRDDPKWDVVHVEFRRKFDKMVTLNDLKAHA 264

Query: 107 R----LSSMILIVSSRLSVQPVTTDEY 129
           +    L ++ ++  SRLSV  VT +E+
Sbjct: 265 KSGQALENLQVLKQSRLSVSSVTPEEW 291


>gi|327354281|gb|EGE83138.1| AT DNA binding protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 289

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 72/154 (46%), Gaps = 26/154 (16%)

Query: 2   AYWLVKSEPS-------EWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           ++WL+K+EP        +  + +   +G    E W GVRN  ARNNMR M+ GD  FFYH
Sbjct: 126 SHWLMKAEPESRIEKGIDVRFSIDDLRGASEPEPWDGVRNPTARNNMRAMKKGDLAFFYH 185

Query: 54  SN-KGREIVGIFEVI------------TCTYPDPTAEQSS-CWECVDICAVCSMPCPVSL 99
           SN K   I GI E++               Y DP + +    WE V +         ++L
Sbjct: 186 SNCKVPGIAGIMEIVREHSVDESAFDPAHPYYDPKSNREKPKWELVHVEFRRKFRDLITL 245

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
             +K+  +    L +M ++  SRLSV  V   E+
Sbjct: 246 AELKSFAKPGGPLENMQMMKQSRLSVSAVNGKEW 279


>gi|67522467|ref|XP_659294.1| hypothetical protein AN1690.2 [Aspergillus nidulans FGSC A4]
 gi|40745654|gb|EAA64810.1| hypothetical protein AN1690.2 [Aspergillus nidulans FGSC A4]
 gi|259487030|tpe|CBF85374.1| TPA: AT DNA binding protein (Thy28), putative (AFU_orthologue;
           AFUA_4G08590) [Aspergillus nidulans FGSC A4]
          Length = 324

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 70/154 (45%), Gaps = 26/154 (16%)

Query: 2   AYWLVKSEPSEWSWKMQQDK--------GRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP     K +  K         +  E W GVRN  AR NM+ M+ GD  FFYH
Sbjct: 130 SYWLMKAEPESRIEKGKDVKFSIDDLRAAKEPEPWDGVRNPVARKNMQSMKKGDLAFFYH 189

Query: 54  SN-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSL 99
           SN K   I G+ E++    PD TA              ++  W  V +         ++L
Sbjct: 190 SNCKVPGIAGVMEIVQEHSPDETAFDPSHPYYDEKSKRENPRWVVVHVEFRRKFDKLITL 249

Query: 100 MAIK----ANPRLSSMILIVSSRLSVQPVTTDEY 129
             +K    AN  L ++ ++   RLSV  V+  E+
Sbjct: 250 NELKSHAGANAPLENLQMLKQGRLSVSAVSPQEW 283


>gi|147845298|emb|CAN83372.1| hypothetical protein VITISV_034945 [Vitis vinifera]
          Length = 1471

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 62/133 (46%), Gaps = 3/133 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL+K+EP EWSW+ Q     +   W GV+N QA+ N++ M +GD  FFYHS      V 
Sbjct: 7   YWLLKTEPGEWSWEDQAANEGLSN-WDGVKNKQAQKNLKAMHLGDLCFFYHSGAKARRVV 65

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
               +   + +     +     VD+  V  M   V L  +K    L    L    RLSV 
Sbjct: 66  GVVSVVREWYEEGDGGAGG--AVDVRCVGEMRRAVDLGEMKKESGLKGFGLFRQPRLSVV 123

Query: 123 PVTTDEYLEVCRM 135
           PV  + +  VC M
Sbjct: 124 PVPEEVWKRVCEM 136


>gi|255942699|ref|XP_002562118.1| Pc18g02770 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586851|emb|CAP94501.1| Pc18g02770 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 319

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 73/150 (48%), Gaps = 26/150 (17%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVG--------EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           ++WL+K+EP     K +  K  +         E W GVRN+ A+N MR M+ GD  FFYH
Sbjct: 141 SFWLMKAEPESRLEKGKDVKFSIDDLAAADSPEPWDGVRNHVAKNLMRDMKKGDFAFFYH 200

Query: 54  SN-KGREIVGIFEVI------------TCTYPDPTAEQSSC-WECVDICAVCSMPCPVSL 99
           SN K   +VG+ E++               Y DP +++    W  V +     +   V+L
Sbjct: 201 SNCKVPGVVGVMEIVEEHSTDESAFDPKHPYYDPKSKRDDPKWVVVHVEYRRKLGKQVTL 260

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVT 125
             +K++ +    L ++ +I  SRLSV  VT
Sbjct: 261 QDLKSHGQTGKPLENLQMIKQSRLSVSSVT 290


>gi|58265774|ref|XP_570043.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57226275|gb|AAW42736.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 237

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 64/142 (45%), Gaps = 33/142 (23%)

Query: 28  WTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREIVGIFEVITCTYPD------------ 73
           W GVRN++A+  MR KM++GDK  FYHSN K   +  + E+    YPD            
Sbjct: 22  WDGVRNHEAKKIMREKMKLGDKVLFYHSNCKVPGVFAVAEISKEGYPDSHSRNRDHPYFD 81

Query: 74  PTAEQSS-CWECVDI------------------CAVCSMPCPVSLMAIKANPRLSSMILI 114
           P ++Q S  W  VD+                    + ++P  VS +  +    + +M L+
Sbjct: 82  PKSKQDSPTWFMVDVRFKRRLDYPPTLALIKHLATLSNLPKEVSYIGDRGLEAIKNMSLV 141

Query: 115 VSSRLSVQPVTTDEYLEVCRMG 136
              RLSVQPV    Y  +  +G
Sbjct: 142 NRGRLSVQPVDDAAYNAIVELG 163


>gi|224083580|ref|XP_002192877.1| PREDICTED: thymocyte nuclear protein 1 [Taeniopygia guttata]
          Length = 196

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 46/83 (55%), Gaps = 10/83 (12%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEA---------WTGVRNYQARNNMRKMRVGDKGFFYH 53
           +WL+KSEP     K    K  V +          W GVRNYQARN +R M++G + FFYH
Sbjct: 71  HWLLKSEPESRLEKGVDVKFSVDDLKAQPNQTTCWDGVRNYQARNFLRSMKLGQQAFFYH 130

Query: 54  SN-KGREIVGIFEVITCTYPDPT 75
           SN K   IV + +++   YPD T
Sbjct: 131 SNCKEPGIVALVKIVKEAYPDHT 153


>gi|328861006|gb|EGG10110.1| hypothetical protein MELLADRAFT_103498 [Melampsora larici-populina
           98AG31]
          Length = 237

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 77/181 (42%), Gaps = 54/181 (29%)

Query: 4   WLVKSEPSEWSWKMQQ--------DKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHS 54
           WL+K+EP     K +         +K  V E W GVRN++A+N MR +M+VGD   FYHS
Sbjct: 9   WLMKAEPETRIVKGKDVAFSATHLEKAGV-EHWDGVRNHEAKNLMRDRMKVGDPVLFYHS 67

Query: 55  N-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAV---------- 90
           N K   I  I ++    YPD TA             E S  W  VD+  V          
Sbjct: 68  NCKVPGISAIAKIHRAGYPDFTAFDPSHPYHDPKSSESSPTWYMVDVEFVSHLTHFVPLK 127

Query: 91  -------CSMPCPV-------SLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
                   S P P+        L AI+       M L+   RLSVQPV+   +  +  +G
Sbjct: 128 FLQSLTEASHPIPLPEYITSEDLTAIR------EMALLNRGRLSVQPVSLQAFSAIKLLG 181

Query: 137 K 137
           +
Sbjct: 182 E 182


>gi|116621696|ref|YP_823852.1| hypothetical protein Acid_2578 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116224858|gb|ABJ83567.1| protein of unknown function DUF55 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 138

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 59/125 (47%), Gaps = 7/125 (5%)

Query: 1   MAYWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE 59
           M Y+L K+EPS +S   +++D+  V   W GV N QA   +  M+ GD+ F YHS     
Sbjct: 1   MKYFLAKTEPSVYSIDDLERDQETV---WDGVTNPQAVRAILNMKTGDRVFIYHSGGVSA 57

Query: 60  IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRL 119
           IVG+  V +   PDP   +S+    VD+         ++L  IK         L+   RL
Sbjct: 58  IVGMAAVRSDGRPDPKNPKSA---IVDLAFAVKFEHQLTLTEIKQTGEFDDWALVRQGRL 114

Query: 120 SVQPV 124
           S   V
Sbjct: 115 STMEV 119


>gi|115397851|ref|XP_001214517.1| hypothetical protein ATEG_05339 [Aspergillus terreus NIH2624]
 gi|114192708|gb|EAU34408.1| hypothetical protein ATEG_05339 [Aspergillus terreus NIH2624]
          Length = 279

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 74/156 (47%), Gaps = 20/156 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGE--AWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           +YWL+K+EP     K    K  + +    T    + ARNNMR+M+ GD  FFYHSN K  
Sbjct: 109 SYWLMKAEPESRIEKGVDVKFSIDDLRERTKPEPWDARNNMREMKKGDYAFFYHSNCKTP 168

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI E++    PD +A              ++  WE V +         VSL  +KA+
Sbjct: 169 GVAGIMEIVQEHTPDESAFDPNHPYYDEKSTRENPKWEVVHVEFRRKFDNFVSLNDLKAH 228

Query: 106 PR----LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
            +    L ++ ++  SRLSV  V+  E+  +  + K
Sbjct: 229 SQPGQPLENLQVLKQSRLSVSRVSKKEWKFILGLAK 264


>gi|145257371|ref|XP_001401706.1| AT DNA binding protein (Thy28) [Aspergillus niger CBS 513.88]
 gi|134058620|emb|CAK38604.1| unnamed protein product [Aspergillus niger]
          Length = 304

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 77/161 (47%), Gaps = 26/161 (16%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVG--------EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP     K    K  +         E W GVRN  A+ ++R M+ GD  FFYH
Sbjct: 118 SYWLMKAEPESRLEKGVDVKFSIDDLASRKEPEPWDGVRNPVAQKHIRDMKKGDLAFFYH 177

Query: 54  SN-KGREIVGIFEVITCTYPDPTA---------EQSS----CWECVDICAVCSMPCPVSL 99
           SN K   I GI E++    PD +A         E+S+     W+ V +         ++L
Sbjct: 178 SNCKVPGIAGIMEIVQEHSPDESAFDPAHPYYDEKSNRDDPKWQVVHVEFRRKFNKMITL 237

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
             +K+  +    L +M ++  SRLSV PV+  E+  + R+ 
Sbjct: 238 NDLKSYAQSERALENMQVLKQSRLSVTPVSVTEWAFIMRVA 278


>gi|315040221|ref|XP_003169488.1| hypothetical protein MGYG_08392 [Arthroderma gypseum CBS 118893]
 gi|311346178|gb|EFR05381.1| hypothetical protein MGYG_08392 [Arthroderma gypseum CBS 118893]
          Length = 288

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 74/148 (50%), Gaps = 20/148 (13%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGE--AWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           +YWL+K+EP     K    +  + +  A T    + ARN+MR M+ GD  FFYHSN K  
Sbjct: 126 SYWLMKAEPETRLEKGVDVRFSIDDLRAATEPEGWDARNHMRAMKKGDLAFFYHSNCKVP 185

Query: 59  EIVGIFEVITCT------------YPDPTAEQSS-CWECVDICAVCSMPCPVSLMAIKAN 105
            I GI E++  +            Y DP + + +  W+ V +         V+L  IK++
Sbjct: 186 GIAGIMEIVRESSVDESAFDPAHPYYDPKSSRDNPKWDWVHVQFRSKFKNLVTLADIKSH 245

Query: 106 PR----LSSMILIVSSRLSVQPVTTDEY 129
            +    L ++ ++  SRLSV PVT +++
Sbjct: 246 AKPGGALENLQMVRQSRLSVSPVTAEQW 273


>gi|322707617|gb|EFY99195.1| thymocyte nuclear protein 1 [Metarhizium anisopliae ARSEF 23]
          Length = 303

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 74/160 (46%), Gaps = 26/160 (16%)

Query: 3   YWLVKSEPS-------EWSWKMQQDKGRVG-EAWTGVRNYQARNNMRKMRVGDKGFFYHS 54
           YWL+K+EP        +  + +   + +   E W G+R Y ARN+MR M  GDK FFYHS
Sbjct: 126 YWLMKAEPETRYENGIDVRFSIDDLRAKTKPEGWDGIRAYAARNHMRNMNAGDKAFFYHS 185

Query: 55  N-KGREIVGIFEVI-------------TCTYPDPTAEQSSCWECVDICAVCSMPCPVSLM 100
           N K   I G  EV+             T  Y   + +    W  V +        P+SL 
Sbjct: 186 NCKEPGIAGTMEVVKEFSEDVSARRPGTPYYDSQSTKDKPRWSLVHVEFRKKFAVPISLK 245

Query: 101 AI----KANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
            +    K    L +M ++  SRLSV  V+++E+  +C++ 
Sbjct: 246 ELREMGKPGGPLENMQMLKQSRLSVSRVSSEEWAALCKVA 285


>gi|321253969|ref|XP_003192915.1| hypothetical protein CGB_C5020C [Cryptococcus gattii WM276]
 gi|317459384|gb|ADV21128.1| conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 244

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 61/142 (42%), Gaps = 33/142 (23%)

Query: 28  WTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPTA--------- 76
           W GVRN++A+  MR +M++GDK  FYHSN K   +  + E+    YPD TA         
Sbjct: 23  WDGVRNHEAKKIMRERMKLGDKVLFYHSNCKMPGVFAVAEIAKEGYPDFTAWDPDHPYFD 82

Query: 77  ----EQSSCWECVDI------------------CAVCSMPCPVSLMAIKANPRLSSMILI 114
                 S  W  VD+                    + ++P  VS +       + +M L+
Sbjct: 83  PKSKRDSPTWFMVDVRFDRRLHYPPTLALIKHLATLSNLPKKVSYIGDHGLEAIKNMPLV 142

Query: 115 VSSRLSVQPVTTDEYLEVCRMG 136
              RLSVQPV    Y  +  +G
Sbjct: 143 NRGRLSVQPVDDAAYNAIVELG 164


>gi|225429201|ref|XP_002276295.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 158

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 61/131 (46%), Gaps = 3/131 (2%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL+K+EP EWSW+ Q     +   W GV+N QA+ N++ M +GD  FFYHS      V 
Sbjct: 7   YWLLKTEPGEWSWEDQAANEGLSN-WDGVKNKQAQKNLKAMHLGDLCFFYHSGAKARRVV 65

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
               +   + +     +     VD+  V  M   V L  +K    L    L    RLSV 
Sbjct: 66  GVVSVVREWYEEGDGGAG--GAVDVRCVGEMRRAVDLGEMKKESGLKGFGLFRQPRLSVV 123

Query: 123 PVTTDEYLEVC 133
           PV  + +  VC
Sbjct: 124 PVPEEVWKRVC 134


>gi|221067165|ref|ZP_03543270.1| protein of unknown function DUF55 [Comamonas testosteroni KF-1]
 gi|220712188|gb|EED67556.1| protein of unknown function DUF55 [Comamonas testosteroni KF-1]
          Length = 162

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 68/143 (47%), Gaps = 17/143 (11%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGR--- 58
           YWL+K+EP E+S            AW GVRNYQARN MR  M+VGD   ++HS+  +   
Sbjct: 11  YWLMKNEPDEYSIDHALAAPGQTIAWNGVRNYQARNFMRDDMQVGDGVLYWHSSCAKPGI 70

Query: 59  ----EIVGIFEVITCTYP--DPTAEQSSC-----WECVDICAVCSMPCPVSLMAIKANPR 107
                I G   V    +   DP  +  S      W  +D+ A+     P+ +  ++    
Sbjct: 71  YGLARIAGNLRVDPSQFDPEDPYYDPKSPVDKPRWLTLDVQALKKT-RPLLMAELRGQAP 129

Query: 108 LSSM-ILIVSSRLSVQPVTTDEY 129
           L  M +L   +RLS+ PVT  E+
Sbjct: 130 LQQMRVLQKGNRLSITPVTEAEW 152


>gi|302696251|ref|XP_003037804.1| hypothetical protein SCHCODRAFT_44168 [Schizophyllum commune
          H4-8]
 gi|300111501|gb|EFJ02902.1| hypothetical protein SCHCODRAFT_44168 [Schizophyllum commune
          H4-8]
          Length = 206

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 45/80 (56%), Gaps = 9/80 (11%)

Query: 4  WLVKSEPSEWSWKMQQDKGRVGE-------AWTGVRNYQARNNMRKMRVGDKGFFYHSNK 56
          WL+K+EP     K +  K  V +        W GVRNY+ARN +R+M+VGDK  FYHSN 
Sbjct: 1  WLLKAEPDSRVVKGKDVKFSVDDFEAVKTSPWEGVRNYEARNLLREMKVGDKVLFYHSNC 60

Query: 57 GREIVGIFEVITCTYPDPTA 76
               G+ ++    YPD TA
Sbjct: 61 KNP--GVLDIAKEAYPDYTA 78


>gi|116206112|ref|XP_001228865.1| hypothetical protein CHGG_02349 [Chaetomium globosum CBS 148.51]
 gi|88182946|gb|EAQ90414.1| hypothetical protein CHGG_02349 [Chaetomium globosum CBS 148.51]
          Length = 180

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 54/122 (44%), Gaps = 18/122 (14%)

Query: 26  EAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPTAEQSSC--- 81
           E W G+R Y ARNN+R M+ G+  FFYHSN K   IVG  E++    PD +A        
Sbjct: 48  EPWDGIRAYAARNNLRAMKKGELAFFYHSNCKEPGIVGTMEIVREHSPDLSAHDPKAPYY 107

Query: 82  ----------WECVDICAVCSMPCPVSLMAIKA----NPRLSSMILIVSSRLSVQPVTTD 127
                     W  V +         + L  ++        L +M ++  SRLSV  V+  
Sbjct: 108 DPKSKPDDPKWSVVHVKFRSKFSASIGLKELREMGGPGKPLENMQMLKQSRLSVSRVSPA 167

Query: 128 EY 129
           E+
Sbjct: 168 EW 169


>gi|332526722|ref|ZP_08402824.1| hypothetical protein RBXJA2T_12552 [Rubrivivax benzoatilyticus JA2]
 gi|332111125|gb|EGJ11157.1| hypothetical protein RBXJA2T_12552 [Rubrivivax benzoatilyticus JA2]
          Length = 154

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 68/148 (45%), Gaps = 19/148 (12%)

Query: 3   YWLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE- 59
           +WL+KSEP E S   +    GR    WTGVRNYQARN MR  MR GD   FYHS+     
Sbjct: 4   HWLMKSEPDEVSIDDLAAAPGR-HLPWTGVRNYQARNFMRDAMRPGDDVLFYHSSCAEPG 62

Query: 60  IVGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+  V     PD T                   W  V++  V      +SL  ++  P
Sbjct: 63  IAGLARVSGPAVPDETQFDPASPYHDPKSTRDQPRWLQVEVELVRKTRL-LSLREMRQAP 121

Query: 107 RLSSM-ILIVSSRLSVQPVTTDEYLEVC 133
            L++M +L   +RLS+  V   E+  V 
Sbjct: 122 ELATMRVLQPGNRLSITEVDDAEWAAVL 149


>gi|154275502|ref|XP_001538602.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150415042|gb|EDN10404.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 314

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 74/170 (43%), Gaps = 42/170 (24%)

Query: 2   AYWLVKSEPSEW-----SWKMQQDKGRVG---EAWTGVRN----------------YQAR 37
           +YWL+K+EP          K   D  R     EAW GVRN                + AR
Sbjct: 135 SYWLMKAEPESRMEKGVDVKFSIDDLREASEPEAWDGVRNPTAQVIIHFETKKKRTHVAR 194

Query: 38  NNMRKMRVGDKGFFYHSN-KGREIVGIFEVI------------TCTYPDP-TAEQSSCWE 83
           NNMR M+ GD  FFYHSN K   I GI E++               Y DP ++ ++  WE
Sbjct: 195 NNMRAMKKGDLAFFYHSNCKVPGIAGIMEIVREHSVDESAFDPAHPYYDPKSSRENPKWE 254

Query: 84  CVDICAVCSMPCPVSLMAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
            V +         ++L  +K+  +    L +M ++  SRLSV  V   E+
Sbjct: 255 VVHVEFKRKFKELITLAELKSFAKPGGPLENMQMMKQSRLSVSVVGGKEW 304


>gi|326470167|gb|EGD94176.1| hypothetical protein TESG_01701 [Trichophyton tonsurans CBS 112818]
 gi|326483916|gb|EGE07926.1| AT DNA binding protein [Trichophyton equinum CBS 127.97]
          Length = 300

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 73/154 (47%), Gaps = 27/154 (17%)

Query: 2   AYWLVKSEPSEWSWK-----MQQDKGRVG---EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP     K        D  R     E W G +   +RN+MR M+ GD  FFYH
Sbjct: 133 SYWLMKAEPETRLEKGVDVRFSIDDLRAATEPEGWDG-KQISSRNHMRAMKKGDLAFFYH 191

Query: 54  SN-KGREIVGIFEVITCT------------YPDPTAEQSS-CWECVDICAVCSMPCPVSL 99
           SN K   I G  E++  +            Y DP + + +  W+ V +         V+L
Sbjct: 192 SNCKVPGIAGTMEIVRESSVDESAFDPAHPYYDPKSSRDNPKWDWVHVQFRSKFKNLVTL 251

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
             IK++ +    L ++ ++  SRLSV PVT +++
Sbjct: 252 ADIKSHAKPGGALENLQMVKQSRLSVSPVTAEQW 285


>gi|298489818|ref|YP_003719995.1| hypothetical protein Aazo_0283 ['Nostoc azollae' 0708]
 gi|298231736|gb|ADI62872.1| protein of unknown function DUF55 ['Nostoc azollae' 0708]
          Length = 148

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 65/135 (48%), Gaps = 19/135 (14%)

Query: 6   VKSEPSEWSW-KMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE-IVGI 63
           +KSEP  +S   +Q  +  +   W GVRNYQARN + +M +GD  FFYH N     IVG+
Sbjct: 1   MKSEPEVYSITDLQHQRETI---WDGVRNYQARNFLLQMELGDLTFFYHFNTSYPGIVGL 57

Query: 64  FEVITCTYPDPTA-EQSSCW------------ECVDICAVCSMPCPVSLMAIKANPRLSS 110
             ++     DPT  E +S +            + V +  V +   P+ L  +K       
Sbjct: 58  MPIVKTAIADPTQFEPTSKYYDPKSSPESPRCQTVGVEFVETFSNPILLSTLKEKFSSDE 117

Query: 111 MILI-VSSRLSVQPV 124
           ++L+   +RL V PV
Sbjct: 118 LLLVRPGNRLWVMPV 132


>gi|119513776|ref|ZP_01632757.1| hypothetical protein N9414_12578 [Nodularia spumigena CCY9414]
 gi|119461573|gb|EAW42629.1| hypothetical protein N9414_12578 [Nodularia spumigena CCY9414]
          Length = 94

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 1/95 (1%)

Query: 43  MRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAI 102
           M++ D+  FYHS +G  I+G  +VI   + DPT      W       V +    + L  I
Sbjct: 1   MQLNDEVLFYHSQEGNSIMGKMKVIVTAHQDPTTNDPK-WLSATFEPVQTFEKAIVLSQI 59

Query: 103 KANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           K  P L+++ L+   RL+V P+T  E+  + ++ K
Sbjct: 60  KETPELANIGLVKQPRLAVMPLTKSEFELIIKLAK 94


>gi|149027879|gb|EDL83339.1| thymocyte nuclear protein 1, isoform CRA_a [Rattus norvegicus]
          Length = 121

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 52/109 (47%), Gaps = 22/109 (20%)

Query: 43  MRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPT-------------AEQSSCWECVDIC 88
           M++ D+ FFYHSN K   IVG+ +++   YPD T              E +  W  VD+ 
Sbjct: 1   MKLEDEAFFYHSNCKQPGIVGLMKIVKEAYPDHTQFEKNDPHYDPSSKEDNPKWSMVDVQ 60

Query: 89  AVCSMPCPVSLMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY 129
            V  M   +SL  +K   +        L SM L    RLSVQP+T +E+
Sbjct: 61  FVRMMKRFISLDELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEF 109


>gi|91782204|ref|YP_557410.1| hypothetical protein Bxe_A3630 [Burkholderia xenovorans LB400]
 gi|91686158|gb|ABE29358.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 124

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 60/116 (51%), Gaps = 17/116 (14%)

Query: 35  QARNNMR-KMRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPT-------------AEQS 79
           +ARN MR +M+VGD   FYHS+     I GI EV +  YPDPT             +++S
Sbjct: 7   KARNFMRDQMQVGDGVLFYHSSCPEPGIAGIAEVSSTAYPDPTQFDRKSPYYDAKSSQES 66

Query: 80  SCWECVDICAVCSMPCPVSLMAIKANPRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             W  VD+     +P  + L A++ +  L  M +L   +RLS+ PVT  E+  + +
Sbjct: 67  PRWVLVDVVFRKKIPL-IPLAALREHDELKDMRVLAKGNRLSITPVTEAEWRFITK 121


>gi|302668280|ref|XP_003025713.1| hypothetical protein TRV_00127 [Trichophyton verrucosum HKI 0517]
 gi|291189838|gb|EFE45102.1| hypothetical protein TRV_00127 [Trichophyton verrucosum HKI 0517]
          Length = 305

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 72/157 (45%), Gaps = 29/157 (18%)

Query: 2   AYWLVKSEPSEWSWK-----MQQDKGRVG---EAWTGVRNYQ---ARNNMRKMRVGDKGF 50
           +YWL+K+EP     K        D  R     E W    N     ARN+MR M+ GD  F
Sbjct: 134 SYWLMKAEPETRLEKGVDVRFSIDDLRAATEPEGWDAPINTHVIAARNHMRAMKKGDLAF 193

Query: 51  FYHSN-KGREIVGIFEVITCT------------YPDPTAEQSS-CWECVDICAVCSMPCP 96
           FYHSN K   I G  E++  +            Y DP + + +  W+ V +         
Sbjct: 194 FYHSNCKVPGIAGTMEIVRESSVDESAFDPAHPYYDPKSSRDNPKWDWVHVQFRSKFKNL 253

Query: 97  VSLMAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
           V+L  IK++ +    L ++ ++  SRLSV PVT +++
Sbjct: 254 VTLADIKSHAKPGGALENLQMVKQSRLSVSPVTAEQW 290


>gi|302507310|ref|XP_003015616.1| hypothetical protein ARB_05927 [Arthroderma benhamiae CBS 112371]
 gi|291179184|gb|EFE34971.1| hypothetical protein ARB_05927 [Arthroderma benhamiae CBS 112371]
          Length = 305

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 72/157 (45%), Gaps = 29/157 (18%)

Query: 2   AYWLVKSEPSEWSWK-----MQQDKGRVG---EAWTGVRNYQ---ARNNMRKMRVGDKGF 50
           +YWL+K+EP     K        D  R     E W    N     ARN+MR M+ GD  F
Sbjct: 134 SYWLMKAEPETRLEKGVDVRFSIDDLRAATEPEGWDAPINTHVIAARNHMRAMKKGDLAF 193

Query: 51  FYHSN-KGREIVGIFEVITCT------------YPDPTAEQSS-CWECVDICAVCSMPCP 96
           FYHSN K   I G  E++  +            Y DP + + +  W+ V +         
Sbjct: 194 FYHSNCKVPGIAGTMEIVRESSVDESAFDPAHPYYDPKSSRDNPKWDWVHVQFRSKFKNL 253

Query: 97  VSLMAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
           V+L  IK++ +    L ++ ++  SRLSV PVT +++
Sbjct: 254 VTLADIKSHAKPGDALENLQMVKQSRLSVSPVTAEQW 290


>gi|299137117|ref|ZP_07030300.1| protein of unknown function DUF55 [Acidobacterium sp. MP5ACTX8]
 gi|298601632|gb|EFI57787.1| protein of unknown function DUF55 [Acidobacterium sp. MP5ACTX8]
          Length = 128

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 62/127 (48%), Gaps = 8/127 (6%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           +L+KSEP ++S+    D  R GE  W G++N QA   +R M+ G+    YHSN G+  VG
Sbjct: 3   YLLKSEPDKYSF---DDLLRDGETVWDGIKNPQALITLRNMKRGEDCIIYHSNVGKAAVG 59

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
             +V++ T    T   +     V + A   +     L  I+        I+    RLSV 
Sbjct: 60  TAKVVSVT----TDPDNPKIPIVRLKAGKRLKSEKPLAEIRDASVFHGSIMFRQFRLSVV 115

Query: 123 PVTTDEY 129
           P++ +++
Sbjct: 116 PLSDEQF 122


>gi|242215800|ref|XP_002473712.1| predicted protein [Postia placenta Mad-698-R]
 gi|220727157|gb|EED81085.1| predicted protein [Postia placenta Mad-698-R]
          Length = 180

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 67/162 (41%), Gaps = 41/162 (25%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGE-------AWTGVRNYQARNNMRKMRVGDKGFFYHSN- 55
           WL+K+EP     K +  K  V +        W GVRN +ARN M++M+VGDK  FYHSN 
Sbjct: 1   WLMKAEPDSRIVKEKDVKFSVDDFDSVKTTPWEGVRNAEARNLMKEMKVGDKVLFYHSNC 60

Query: 56  KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSL--- 99
           K  E   + +V    YPD TA             + +  W  V++  V      VSL   
Sbjct: 61  KTPEAHCLSQVSQEAYPDYTAWDPSHPYYDAKTDKDNPKWYMVNVTFVARTAHFVSLALL 120

Query: 100 -----MAIKANPR------------LSSMILIVSSRLSVQPV 124
                 A    P             +  M L+   RLSVQ V
Sbjct: 121 RRIAGAATDDTPEDIGYIHSDGVKAIKQMALVTRGRLSVQRV 162


>gi|164655954|ref|XP_001729105.1| hypothetical protein MGL_3572 [Malassezia globosa CBS 7966]
 gi|159102995|gb|EDP41891.1| hypothetical protein MGL_3572 [Malassezia globosa CBS 7966]
          Length = 211

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 73/156 (46%), Gaps = 25/156 (16%)

Query: 2   AYWLVKSEPS-------EWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYH 53
           ++WLVK+EP        + ++ + + +     +W GVRNYQAR  +R +M+ G +  FYH
Sbjct: 3   SHWLVKAEPLSRLVKGIDVAFSVDRFEKEKVCSWEGVRNYQARKYLRDQMKTGHRVLFYH 62

Query: 54  SN-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSL 99
           S+ K   IV +  V    YPD TA              ++  W  VD+     +  PV L
Sbjct: 63  SSCKVPGIVALASVCKDGYPDNTAWEPGNPYFDPRSDPKAPQWYMVDLQFEGRLTHPVPL 122

Query: 100 MAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRM 135
             +K    L+S  L  + R  V+ ++ D  L V  M
Sbjct: 123 GVLK---HLTSSDLSDAQREDVKYLSEDHLLAVANM 155


>gi|225558796|gb|EEH07079.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
          Length = 292

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 69/154 (44%), Gaps = 32/154 (20%)

Query: 2   AYWLVKSEPSEW-----SWKMQQDKGRVG---EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP          K   D  R     EAW       ARNNMR M+ GD  FFYH
Sbjct: 135 SYWLMKAEPESRMEKGVDVKFSIDDLREASEPEAW------DARNNMRAMKKGDLAFFYH 188

Query: 54  SN-KGREIVGIFEVI------------TCTYPDP-TAEQSSCWECVDICAVCSMPCPVSL 99
           SN K   I GI E++               Y DP ++ ++  WE V +         ++L
Sbjct: 189 SNCKVPGIAGIMEIVREHSVDESAFDPAHPYYDPKSSRENPKWEVVHVEFRRKFKDLITL 248

Query: 100 MAIKANPR----LSSMILIVSSRLSVQPVTTDEY 129
             +K+  +    L +M ++  SRLSV  V   E+
Sbjct: 249 AELKSFAKPGGPLENMQMMKQSRLSVSVVGGKEW 282


>gi|218658658|ref|ZP_03514588.1| hypothetical protein RetlI_02816 [Rhizobium etli IE4771]
          Length = 37

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/37 (62%), Positives = 27/37 (72%)

Query: 1  MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQAR 37
          MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY AR
Sbjct: 1  MAHWLYKSEPASWSWEQQKAAGEKGTEWTGVRNYLAR 37


>gi|119500814|ref|XP_001267164.1| AT DNA binding protein (Thy28), putative [Neosartorya fischeri NRRL
           181]
 gi|119415329|gb|EAW25267.1| AT DNA binding protein (Thy28), putative [Neosartorya fischeri NRRL
           181]
          Length = 277

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 66/145 (45%), Gaps = 20/145 (13%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGE--AWTGVRNYQARNNMRKMRVGDKGFFYHSN-KG 57
            +YWL+K+EP     K    K  + +  A      + ARN++R M+ GD  FFYHSN K 
Sbjct: 114 QSYWLMKAEPESRMEKGVDVKFSIDDLQAAEKPEPWDARNHIRAMKKGDYAFFYHSNCKV 173

Query: 58  REIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKA 104
             +VG+ E++    PD +A               +  WE V +         V+L  +KA
Sbjct: 174 PGVVGMMEIVQEHTPDESAFDPAHPYYDPKSKRDNPKWEVVHVEFRRKFKKMVTLNDLKA 233

Query: 105 NPR----LSSMILIVSSRLSVQPVT 125
           + +    L  +  +  +RLSV  VT
Sbjct: 234 HAKPGGPLEDLQALKQTRLSVSSVT 258


>gi|295442878|ref|NP_596337.2| DUF55 family protein [Schizosaccharomyces pombe 972h-]
 gi|259016415|sp|O94645|YBV3_SCHPO RecName: Full=Uncharacterized protein C21.03c
 gi|254745605|emb|CAB36883.2| DUF55 family protein [Schizosaccharomyces pombe]
          Length = 261

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 84/189 (44%), Gaps = 50/189 (26%)

Query: 3   YWLVKSEPS---------EWSWKMQQDKGRVG--EAWTGVRNYQARNNMR-KMRVGDKGF 50
           YWL+K+E            ++++M ++    G  E+W+GVRNY+ARN +R ++++GD  F
Sbjct: 10  YWLMKAEGEPRYVKGINVAFTFEMLEEITEDGKMESWSGVRNYEARNMIRDEIKIGDYAF 69

Query: 51  FYHSN-KGREIVGIFEV-ITCT---------------------------------YPDPT 75
            Y SN K   I G+  V IT                                   Y DP 
Sbjct: 70  LYCSNCKFPHIKGVMRVSITFLLQISSRRTFSNTENYLFQFSSRWYNSAWNSNDPYYDPK 129

Query: 76  AE-QSSCWECVDICAVCSMPCPVSLMAIKANP--RLSSMILIVSSRLSVQPVTTDEYLEV 132
           +  Q+  W  V + +   +  PV+L  +K +   +L SM L+  SRLS+  V  +E+  +
Sbjct: 130 STPQNPRWYSVGVQSEYKLDRPVTLRELKMHKENQLKSMELLNRSRLSISRVKPEEWKFI 189

Query: 133 CRMGKLSNP 141
             + K   P
Sbjct: 190 HELSKQPEP 198


>gi|70994242|ref|XP_751968.1| AT DNA binding protein (Thy28) [Aspergillus fumigatus Af293]
 gi|66849602|gb|EAL89930.1| AT DNA binding protein (Thy28), putative [Aspergillus fumigatus
           Af293]
 gi|159125119|gb|EDP50236.1| AT DNA binding protein (Thy28), putative [Aspergillus fumigatus
           A1163]
          Length = 277

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 66/144 (45%), Gaps = 20/144 (13%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGE--AWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           +YWL+K+EP     K    K  + +  A      + ARN++R M+ GD  FFYHSN K  
Sbjct: 115 SYWLMKAEPESRMEKGVDVKFSIDDLQAAEKPEPWDARNHIRAMKKGDYAFFYHSNCKVP 174

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VG+ E++    PD +A               +  WE V +         V+L  +KA+
Sbjct: 175 GVVGMMEIVQEHTPDESAFDPAHPYYDPKSKRDNPKWEVVHVEFRRKFKKMVTLNDLKAH 234

Query: 106 PR----LSSMILIVSSRLSVQPVT 125
                 L  + ++  +RLSV  VT
Sbjct: 235 ATPGGPLEDLQVLKQTRLSVSSVT 258


>gi|258578175|ref|XP_002543269.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237903535|gb|EEP77936.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 338

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 67/150 (44%), Gaps = 32/150 (21%)

Query: 2   AYWLVKSEPSEW-----SWKMQQDKGRVG---EAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +YWL+K+EP          K   D  R     EAW       ARN+MR M+ GD  FFYH
Sbjct: 140 SYWLMKAEPESRLEKGVDVKFSIDDLREATEPEAW------DARNHMRTMKKGDLAFFYH 193

Query: 54  SN-KGREIVGIFEVITCTYPDPTA---------EQSS----CWECVDICAVCSMPCPVSL 99
           SN K   I G+ E++     D +A         E+S+     WE V +         V L
Sbjct: 194 SNCKVPGIAGVMEIVKEHSVDESAFDPAHPYYDEKSNRDNPKWEVVHVEFRRKFKSLVKL 253

Query: 100 MAIK--ANP--RLSSMILIVSSRLSVQPVT 125
             +K  A P   L ++ ++  SRLSV  VT
Sbjct: 254 TELKSFAKPGGALENLQMMRQSRLSVSSVT 283


>gi|71017873|ref|XP_759167.1| hypothetical protein UM03020.1 [Ustilago maydis 521]
 gi|46098788|gb|EAK84021.1| hypothetical protein UM03020.1 [Ustilago maydis 521]
          Length = 308

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/185 (27%), Positives = 74/185 (40%), Gaps = 51/185 (27%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGE-------AWTGVRNYQARNNMR-KMRVGDKGFFY 52
           + +WL+K+EP     +       +          W GVRN +AR  M+ KM+ GD   FY
Sbjct: 25  IGHWLMKAEPDTRYERGHDVAFSIDHLAACKITKWDGVRNPEARTIMKEKMQFGDPVLFY 84

Query: 53  HSN-KGREIVGIFEVIT-CTYPDPTA--------------EQSSCWECVDICAVCSMP-- 94
           HSN K   + G+  + +  +YPDP+A              EQ   W  VD+  V  +   
Sbjct: 85  HSNTKIPGVAGLARICSKQSYPDPSAFDRNHAYYDVKSDPEQPKWW-LVDVEYVQKLQRL 143

Query: 95  CPVSLM------AIKANP------------------RLSSMILIVSSRLSVQPVTTDEYL 130
            P+ L+         A P                   +  M L+   RLSVQPV+ D Y 
Sbjct: 144 VPLGLLQKLAGKGADAKPLSKVERHDIAYLKNTHLQAIKDMALLNRGRLSVQPVSKDAYD 203

Query: 131 EVCRM 135
            V  +
Sbjct: 204 AVIAL 208


>gi|212540726|ref|XP_002150518.1| AT DNA binding protein (Thy28), putative [Penicillium marneffei
           ATCC 18224]
 gi|210067817|gb|EEA21909.1| AT DNA binding protein (Thy28), putative [Penicillium marneffei
           ATCC 18224]
          Length = 513

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 43/148 (29%), Positives = 68/148 (45%), Gaps = 20/148 (13%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGE--AWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           +YWL+K+EP     K    K  + +  A      + ARNNMR M+ GD  FFYHS+ K  
Sbjct: 217 SYWLMKAEPESRIVKGVDVKFSIDDLRATREPEPWDARNNMRAMKQGDYAFFYHSSCKVP 276

Query: 59  EIVGIFEVIT-------------CTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKA- 104
            IVG  E++                Y + ++ ++  WECV +         ++L  +K+ 
Sbjct: 277 GIVGQMEIVKEHSVDESAFDPAHPYYDEKSSRENPKWECVHVEFRRKFDQTLTLETLKSY 336

Query: 105 ---NPRLSSMILIVSSRLSVQPVTTDEY 129
                 L +M  +  SR+SV  V+  E+
Sbjct: 337 GFPGQPLENMQTLRQSRVSVSRVSPQEW 364


>gi|125587451|gb|EAZ28115.1| hypothetical protein OsJ_12084 [Oryza sativa Japonica Group]
          Length = 116

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 47/105 (44%), Gaps = 13/105 (12%)

Query: 43  MRVGDKGFFYHSNKG---REIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSL 99
           MRVGD+  FYHS  G   R +VG+ EV    Y      +++    VD+ AV     PV+L
Sbjct: 1   MRVGDRCLFYHSGAGAASRRVVGVVEVAREWYEGEG--EAASGGAVDVRAVGEFRRPVAL 58

Query: 100 MAIKANP--------RLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
             IK            +    L+   RLSV PV    +  +C MG
Sbjct: 59  GEIKKAAGGGGGEVEGMREFALLRQPRLSVMPVPAKVWDWICEMG 103


>gi|242800926|ref|XP_002483672.1| AT DNA binding protein (Thy28), putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218717017|gb|EED16438.1| AT DNA binding protein (Thy28), putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 474

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 42/148 (28%), Positives = 69/148 (46%), Gaps = 20/148 (13%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVG--EAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGR 58
           +YWL+K+EP     K    K  +   +A +    + ARNNMR M+ GD  FFYHS+ K  
Sbjct: 200 SYWLMKAEPQSRIVKGVDVKFSIDDLQAASEPEPWDARNNMRAMKKGDFAFFYHSSCKVP 259

Query: 59  EIVGIFEVIT-------------CTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIK-- 103
            IVG  E++                Y + ++ ++  WE V +        P++L  +K  
Sbjct: 260 GIVGQMEIVREHSVDESAFDPAHPYYDEKSSRENPKWEVVHVEFRRKFDQPLTLETLKSY 319

Query: 104 --ANPRLSSMILIVSSRLSVQPVTTDEY 129
             +   L ++  +  SR+SV  V+  E+
Sbjct: 320 ALSGQPLENLQTLRQSRVSVSRVSPQEW 347


>gi|163783968|ref|ZP_02178935.1| hypothetical protein HG1285_05410 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880764|gb|EDP74301.1| hypothetical protein HG1285_05410 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 58

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 36/54 (66%), Gaps = 2/54 (3%)

Query: 3  YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK 56
          Y+L+K+EP+E+S++  + +G+    W GV+N  A   +++M+ GD  F YH+ K
Sbjct: 4  YYLLKTEPTEYSYEDLEKEGKT--VWDGVKNKFALKFVKQMKPGDLAFIYHTEK 55


>gi|225874675|ref|YP_002756134.1| hypothetical protein ACP_3126 [Acidobacterium capsulatum ATCC
           51196]
 gi|225793925|gb|ACO34015.1| conserved hypothetical protein [Acidobacterium capsulatum ATCC
           51196]
          Length = 126

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 59/127 (46%), Gaps = 10/127 (7%)

Query: 4   WLVKSEPSEWSWK-MQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           +L+K+EP  +S   +++D+  +   W GV N QA   + +M +G+    YH++  +   G
Sbjct: 3   YLLKTEPDVYSIDDLERDRETI---WDGVGNPQAVGYLARMPIGEMLVIYHTSGEKRATG 59

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           + + +     +P   +      V I  V  +  P +L  +K     +   L+   RL V 
Sbjct: 60  LAKCVAVNAENPKVPE------VRIRFVKKLKTPRTLAGMKEMKLFAESPLVRQGRLGVV 113

Query: 123 PVTTDEY 129
           P+T  +Y
Sbjct: 114 PLTAAQY 120


>gi|310817778|ref|YP_003950136.1| putative GTPase subunit of restriction endonuclease [Stigmatella
           aurantiaca DW4/3-1]
 gi|309390850|gb|ADO68309.1| predicted GTPase subunit of restriction endonuclease [Stigmatella
           aurantiaca DW4/3-1]
          Length = 913

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 71/138 (51%), Gaps = 7/138 (5%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGI 63
           W+V++  S+ +++ +  +GR    WT ++   +R  +R    GD  F Y ++  RE++G+
Sbjct: 256 WVVRNMLSKRNFRAEIRRGR-RSTWTALQR-GSREWLRDAEPGDLVFLYQASPVREVLGL 313

Query: 64  FEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQP 123
            ++   + P    +++  +E   +  V + P P+S  AI+A+  LS M++       V P
Sbjct: 314 GKL--ASEPASVGDETR-FEVEFLTDVLAQPIPLS--AIQAHSTLSGMMMASPRSGMVLP 368

Query: 124 VTTDEYLEVCRMGKLSNP 141
           +  DE   + R+ +  NP
Sbjct: 369 IRADELPPLARLIRDRNP 386


>gi|115378762|ref|ZP_01465907.1| ATPase family associated with various cellular activities (AAA),
           putative [Stigmatella aurantiaca DW4/3-1]
 gi|115364246|gb|EAU63336.1| ATPase family associated with various cellular activities (AAA),
           putative [Stigmatella aurantiaca DW4/3-1]
          Length = 948

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 71/138 (51%), Gaps = 7/138 (5%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGI 63
           W+V++  S+ +++ +  +GR    WT ++   +R  +R    GD  F Y ++  RE++G+
Sbjct: 291 WVVRNMLSKRNFRAEIRRGR-RSTWTALQR-GSREWLRDAEPGDLVFLYQASPVREVLGL 348

Query: 64  FEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQP 123
            ++   + P    +++  +E   +  V + P P+S  AI+A+  LS M++       V P
Sbjct: 349 GKL--ASEPASVGDETR-FEVEFLTDVLAQPIPLS--AIQAHSTLSGMMMASPRSGMVLP 403

Query: 124 VTTDEYLEVCRMGKLSNP 141
           +  DE   + R+ +  NP
Sbjct: 404 IRADELPPLARLIRDRNP 421


>gi|222631620|gb|EEE63752.1| hypothetical protein OsJ_18571 [Oryza sativa Japonica Group]
          Length = 291

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 28  WTGVRNYQARNNMRKMRVGDKGFFYHSNKG---REIVGIFEV 66
           W GV N QA N++R MR GD+  FYHS  G   R IV + EV
Sbjct: 215 WDGVCNRQAINSLRAMRRGDRYLFYHSGAGAASRHIVSVVEV 256


>gi|328472423|gb|EGF43289.1| hypothetical protein VP10329_00278 [Vibrio parahaemolyticus 10329]
          Length = 120

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 15/112 (13%)

Query: 42  KMRVGDKGFFYHSN-KGREIVGIFEVITCTYPD------------PTAEQSSC-WECVDI 87
           +++VGD    YHS+ K   + GI +V+   YPD            P ++  +  W  VDI
Sbjct: 5   QVKVGDFVLIYHSSCKNVGVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDI 64

Query: 88  CAVCSMPCPVSLMAIKANPRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
             V      + L  +KA P L +M L+   +RLS+ PVT DE+  +    KL
Sbjct: 65  EFVRKTARVIPLSVMKAMPELENMPLVKRGNRLSIMPVTEDEWEAILSKEKL 116


>gi|307110799|gb|EFN59034.1| hypothetical protein CHLNCDRAFT_137727 [Chlorella variabilis]
          Length = 188

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%), Gaps = 2/79 (2%)

Query: 29  TGVRNYQARNNMRKMRVGDKGFFYHSNKGRE--IVGIFEVITCTYPDPTAEQSSCWECVD 86
           TG+ +Y A+  +  M+VGD+  F+ S K     +  ++ V    YPDP  E++  +   D
Sbjct: 63  TGLHHYGAKKVIETMQVGDEVLFWQSGKASAAGVYALYSVARAAYPDPEDEKNKGFLAFD 122

Query: 87  ICAVCSMPCPVSLMAIKAN 105
           +        PV L  +K +
Sbjct: 123 LKLEEHFDKPVLLSELKEH 141


>gi|262392893|ref|YP_003284747.1| hypothetical protein VEA_002119 [Vibrio sp. Ex25]
 gi|262336487|gb|ACY50282.1| hypothetical protein VEA_002119 [Vibrio sp. Ex25]
          Length = 120

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 54/112 (48%), Gaps = 15/112 (13%)

Query: 42  KMRVGDKGFFYHSN-KGREIVGIFEVITCTYPD------------PTAEQSSC-WECVDI 87
           +++VGD    YHS+ K   + GI +V+   YPD            P ++  +  W  VD+
Sbjct: 5   QVKVGDFVLIYHSSCKNVGVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDV 64

Query: 88  CAVCSMPCPVSLMAIKANPRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
             V      + L  +KA P L +M L+   +RLS+ PVT +E+  +    KL
Sbjct: 65  EFVRKTTRVIPLSVMKAMPELENMPLVKRGNRLSIMPVTEEEWEAILGKEKL 116


>gi|42408170|dbj|BAD09307.1| hypothetical protein [Oryza sativa Japonica Group]
 gi|42409408|dbj|BAD10721.1| hypothetical protein [Oryza sativa Japonica Group]
          Length = 215

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 28  WTGVRNYQARNNMRKMRVGDKGFFYHSNKG---REIVGIFEVITCTYPDPTAEQSSCWEC 84
           W  V N QA N++  +R GD+  FYHS+ G   R IVG+ EV    Y       S     
Sbjct: 139 WDSVCNRQAINSLYALRRGDRCLFYHSSAGATSRHIVGVMEVAREWYEGEGEAASGG--A 196

Query: 85  VDICAVCSMPCPVSLMAIK 103
           VD+ AV      V+L  I+
Sbjct: 197 VDVRAVGEFRLLVALGEIR 215


>gi|254508825|ref|ZP_05120936.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Vibrio
           parahaemolyticus 16]
 gi|219548282|gb|EED25296.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Vibrio
           parahaemolyticus 16]
          Length = 123

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 49/111 (44%), Gaps = 15/111 (13%)

Query: 43  MRVGDKGFFYHSN-KGREIVGIFEVITCTYPDPTAEQSSC-------------WECVDIC 88
           ++ GD    YHS+ K   + GI +VI   YPD  A  +               W  VDI 
Sbjct: 6   VKEGDLVLIYHSSCKKVGVAGIAKVIREAYPDHFAFDADSDYYDPKSTPENPRWVMVDIE 65

Query: 89  AVCSMPCPVSLMAIKANPRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
            V      + L  +KA P L +M L+   +RLS+ PVT  E+  +    KL
Sbjct: 66  FVRKTERVIPLSVLKAMPELENMPLVKRGNRLSIMPVTDQEWQAILGKEKL 116


>gi|218196814|gb|EEC79241.1| hypothetical protein OsI_19992 [Oryza sativa Indica Group]
          Length = 149

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 28  WTGVRNYQARNNMRKMRVGDKGFFYHSN---KGREIVGIFEV 66
           W GV N QA N++R MR GD+  FYHS+       IVG+ EV
Sbjct: 61  WDGVCNRQAINSLRAMRRGDRYLFYHSSADAASHHIVGVVEV 102


>gi|261250023|ref|ZP_05942600.1| hypothetical protein VIA_000044 [Vibrio orientalis CIP 102891]
 gi|260939527|gb|EEX95512.1| hypothetical protein VIA_000044 [Vibrio orientalis CIP 102891]
          Length = 120

 Score = 40.4 bits (93), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 42  KMRVGDKGFFYHSN-KGREIVGIFEVITCTYPD-------------PTAEQSSCWECVDI 87
           +++ GD    YHS+ K   + GI +V    YPD              ++  +  W  VDI
Sbjct: 5   EVKEGDLVLIYHSSCKKVGVAGIAKVTKEAYPDHFAFDPESDYYDPKSSPDNPRWVMVDI 64

Query: 88  CAVCSMPCPVSLMAIKANPRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
             V      + L  +KA P L +M L+   +RLS+ PV+  E+L +    KL
Sbjct: 65  EFVRKTQRLIPLTVMKAMPELENMPLVKRGNRLSIMPVSEQEWLAILDKEKL 116


>gi|320154956|ref|YP_004187335.1| hypothetical protein VVM_00215 [Vibrio vulnificus MO6-24/O]
 gi|319930268|gb|ADV85132.1| protein of unknown function DUF55 [Vibrio vulnificus MO6-24/O]
          Length = 120

 Score = 40.0 bits (92), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 15/112 (13%)

Query: 42  KMRVGDKGFFYHSN-KGREIVGIFEVITCTYPD-------------PTAEQSSCWECVDI 87
           +++ GD    YHS+ K   + GI +V+   YPD              +  ++  W  VD+
Sbjct: 5   EVKEGDWVMIYHSSCKHVGVAGIAKVVREAYPDHFQFDANSDYYDVKSTPENPRWIMVDV 64

Query: 88  CAVCSMPCPVSLMAIKANPRLSSMILIVS-SRLSVQPVTTDEYLEVCRMGKL 138
             V      + L  +KA P L +M L+   +RLSV PVT  E+  +    KL
Sbjct: 65  EFVRKTERVIPLAVLKAMPELENMPLVKKGNRLSVMPVTEQEWQAILTKEKL 116


>gi|167767083|ref|ZP_02439136.1| hypothetical protein CLOSS21_01601 [Clostridium sp. SS2/1]
 gi|167711058|gb|EDS21637.1| hypothetical protein CLOSS21_01601 [Clostridium sp. SS2/1]
 gi|291559580|emb|CBL38380.1| GTPase subunit of restriction endonuclease [butyrate-producing
           bacterium SSC/2]
          Length = 668

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 60/151 (39%), Gaps = 28/151 (18%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARN---NMRKM-------RVGDKGFFY 52
           YW + + P  WS         VGE    V+NY   N   N R++       + GD    Y
Sbjct: 247 YWFLNANPKMWSMSSMP----VGE----VQNYTLFNDNGNKRRIFQNFLDAKAGDMVIGY 298

Query: 53  HSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMI 112
            S   ++IV IF V         AEQ    E +    +  +  P+    +KA P L  M 
Sbjct: 299 ESTPVKQIVAIFRV--------NAEQDG--ERIYFEKLEGLSSPIDFATLKACPELEKME 348

Query: 113 LIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL 143
                + S+  +T DEY  +  + +  NP L
Sbjct: 349 YFSIIQGSLFKLTKDEYEFIIDLIREENPVL 379


>gi|218196976|gb|EEC79403.1| hypothetical protein OsI_20342 [Oryza sativa Indica Group]
          Length = 305

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 30 GVRNYQARNNMRKMRVGDKGFFYHSNKG---REIVGIFEV 66
          GV N QA N++R MR GD   FYHS  G   R IVG+ EV
Sbjct: 14 GVCNRQAINSLRAMRRGDCCLFYHSGAGAASRHIVGVVEV 53


>gi|218201337|gb|EEC83764.1| hypothetical protein OsI_29658 [Oryza sativa Indica Group]
          Length = 265

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 28  WTGVRNYQARNNMRKMRVGDKGFFYHSNKG---REIVGIFEV 66
           W  V N QA N++  +R GD+  FYHS+ G   R IVG+ EV
Sbjct: 151 WDSVCNRQAINSLYALRRGDRCLFYHSSAGATSRHIVGVMEV 192


>gi|269961529|ref|ZP_06175892.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269833758|gb|EEZ87854.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 120

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 15/112 (13%)

Query: 42  KMRVGDKGFFYHSN-KGREIVGIFEVITCTYPD------------PTAE-QSSCWECVDI 87
           ++++GD    YHS+ K   + GI +V    YPD            P ++  +  W  VDI
Sbjct: 5   QVKLGDLVLIYHSSCKNVGVAGIAKVTREAYPDHFQFDLESDYYDPKSDPDNPRWIMVDI 64

Query: 88  CAVCSMPCPVSLMAIKANPRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
             V      + L  +KA P L +M L+   +RLS+ PV+ +E+  +    KL
Sbjct: 65  EFVRKTERLIPLSVMKAMPELENMPLVKRGNRLSIMPVSEEEWQAILGKEKL 116


>gi|125603805|gb|EAZ43130.1| hypothetical protein OsJ_27719 [Oryza sativa Japonica Group]
          Length = 281

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 28  WTGVRNYQARNNMRKMRVGDKGFFYHSNKG---REIVGIFEVITCTYPDPTAEQSSCWEC 84
           W  V N QA N++  +R GD+  FYHS+ G   R IVG+ EV    Y       S     
Sbjct: 167 WDSVCNRQAINSLYALRRGDRCLFYHSSAGATSRHIVGVMEVAREWYEGEGEAASG--GA 224

Query: 85  VDICAV 90
           VD+ A+
Sbjct: 225 VDVRAI 230


>gi|14521083|ref|NP_126558.1| hypothetical protein PAB1780 [Pyrococcus abyssi GE5]
 gi|47117637|sp|Q9V0B5|Y875_PYRAB RecName: Full=UPF0310 protein PYRAB08750
 gi|5458300|emb|CAB49789.1| Uncharacterized ArCR [Pyrococcus abyssi GE5]
          Length = 142

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 43/82 (52%), Gaps = 15/82 (18%)

Query: 1  MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
          M+YWL  +     +WK+ ++K      W   R ++  N M++++ GDK  FY   + R+ 
Sbjct: 1  MSYWLCITNRD--NWKVVKEKN----VWGVPRRHE--NTMKRVKPGDKLVFYVKQESRKG 52

Query: 60 ------IVGIFEVITCTYPDPT 75
                IVGIFEV++  Y D T
Sbjct: 53 EVLEPMIVGIFEVVSEPYSDST 74


>gi|260774845|ref|ZP_05883747.1| hypothetical protein VIC_000215 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609270|gb|EEX35425.1| hypothetical protein VIC_000215 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 120

 Score = 38.1 bits (87), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 50/112 (44%), Gaps = 15/112 (13%)

Query: 42  KMRVGDKGFFYHSN-KGREIVGIFEVITCTYPD-------------PTAEQSSCWECVDI 87
           +++ GD    YHS+ K   + GI +V    YPD              ++  +  W  VDI
Sbjct: 5   EVKEGDLVLIYHSSCKKVGVAGIAKVTKEAYPDHFAFDPESDYFDPKSSPDNPRWVMVDI 64

Query: 88  CAVCSMPCPVSLMAIKANPRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
             V      + L  +KA P L +M L+   +RLS+ PV+  E+  +    KL
Sbjct: 65  EFVRKTERLIPLTVMKAMPELENMPLVKRGNRLSIMPVSEQEWQAILDKEKL 116


>gi|331746848|ref|YP_004422885.1| hypothetical protein TERMP_02270 [Thermococcus barophilus MP]
 gi|315185059|gb|ADT85243.1| hypothetical protein TERMP_02270 [Thermococcus barophilus MP]
          Length = 143

 Score = 37.0 bits (84), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 53/125 (42%), Gaps = 15/125 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
           MAYWL  +    W    +++       W   + +  RN + K+++GDK   Y   + ++ 
Sbjct: 1   MAYWLCITNRDNWEVIKKEN------VWGVPKRH--RNTIAKVKLGDKLVIYVKQERKDK 52

Query: 60  ------IVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMIL 113
                 IVGIFEV++  Y D T    S     +   +     PV L  ++  P +  +  
Sbjct: 53  QILEPKIVGIFEVVSEPYQDSTKIFKSPPHLNETYPLRVKIKPVKLGEVEFKPLIPKLKF 112

Query: 114 IVSSR 118
           I + +
Sbjct: 113 ITNKK 117


>gi|91782324|ref|YP_557530.1| hypothetical protein Bxe_A3507 [Burkholderia xenovorans LB400]
 gi|91686278|gb|ABE29478.1| Conserved hypothetical protein [Burkholderia xenovorans LB400]
          Length = 50

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 20/36 (55%)

Query: 1  MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQA 36
          M YWL+KSEP E S     +       WTGVRNYQ 
Sbjct: 1  MRYWLMKSEPDEASIDHLANAPHRTLPWTGVRNYQG 36


>gi|58699055|ref|ZP_00373896.1| DUF589 [Wolbachia endosymbiont of Drosophila ananassae]
 gi|58534432|gb|EAL58590.1| DUF589 [Wolbachia endosymbiont of Drosophila ananassae]
          Length = 54

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 25/40 (62%)

Query: 97  VSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
           V+L  IK NP L +M ++   RLS+ PV+  E+ E+ RM 
Sbjct: 13  VTLNNIKQNPLLKNMTILKQPRLSIAPVSEIEWNEIIRMS 52


>gi|332158838|ref|YP_004424117.1| hypothetical protein PNA2_1198 [Pyrococcus sp. NA2]
 gi|331034301|gb|AEC52113.1| hypothetical protein PNA2_1198 [Pyrococcus sp. NA2]
          Length = 142

 Score = 34.7 bits (78), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 15/82 (18%)

Query: 1  MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGRE- 59
          M YWL  +  S  +WK+ ++K      W   + ++  N +R+++ GDK  FY   + R+ 
Sbjct: 1  MRYWLCIT--SRDNWKVIREKN----VWGVPKRHE--NTIRRVKPGDKLVFYVKQENRKG 52

Query: 60 ------IVGIFEVITCTYPDPT 75
                IVGIFEV +  Y D T
Sbjct: 53 EVLEPMIVGIFEVASEPYNDST 74


>gi|315660300|ref|ZP_07913155.1| conserved hypothetical protein [Staphylococcus lugdunensis M23590]
 gi|315494727|gb|EFU83067.1| conserved hypothetical protein [Staphylococcus lugdunensis M23590]
          Length = 458

 Score = 34.3 bits (77), Expect = 6.1,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 20  DKGRVGEAWTGVRNYQARNNMR---KMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTA 76
           + G +   +T   N   RN      ++ VGD   FY+ NK + ++GI EV    +  P  
Sbjct: 152 EPGEIYTIYTHTYNGIKRNGYHFYNQLEVGDNLVFYNRNKNQSVIGIGEVTKHIHEKPPI 211

Query: 77  EQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSM-ILIVSSRLSVQPVTTDEYLEVCRM 135
              +    +++    ++  PV+L  +  +P+L ++  L  +++ ++  ++  +Y  +  M
Sbjct: 212 PGRTNSTAIEVRYDKNI-TPVTLSQLNKHPKLKNLYFLQENAKQAIASMSQTQYDAIIDM 270

Query: 136 GK 137
            K
Sbjct: 271 SK 272


>gi|289550235|ref|YP_003471139.1| hypothetical protein SLGD_00874 [Staphylococcus lugdunensis
           HKU09-01]
 gi|289179767|gb|ADC87012.1| Hypothetical protein SLGD_00874 [Staphylococcus lugdunensis
           HKU09-01]
          Length = 458

 Score = 33.9 bits (76), Expect = 7.0,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 20  DKGRVGEAWTGVRNYQARNNMR---KMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTA 76
           + G +   +T   N   RN      ++ VGD   FY+ NK + ++GI EV    +  P  
Sbjct: 152 EPGEIYTIYTHTYNGIKRNGYHFYNQLEVGDNLVFYNRNKNQAVIGIGEVTKHIHEKPPI 211

Query: 77  EQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSM-ILIVSSRLSVQPVTTDEYLEVCRM 135
              +    +++    ++  PV+L  +  +P+L ++  L  +++ ++  ++  +Y  +  M
Sbjct: 212 PGRTNSTAIEVRYDKNI-TPVTLSQLNKHPKLKNLYFLQENTKQAIASMSQTQYDAIIDM 270

Query: 136 GK 137
            K
Sbjct: 271 SK 272


Searching..................................................done


Results from round 2




>gi|260431932|ref|ZP_05785903.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260415760|gb|EEX09019.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 140

 Score =  241 bits (616), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 97/140 (69%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + I
Sbjct: 1   MAYWLFKSEPSTWSWDQQVAKGDAGEEWDGVRNYQARNFMRQMKLGDRGFFYHSQKDKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV     PV+L  IKA+PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTDDE-RWECVDIRAVRPFAKPVTLDQIKADPRLADMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV+  E+  +C +G+   
Sbjct: 120 VQPVSDAEWAVICELGQTEP 139


>gi|254781040|ref|YP_003065453.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040717|gb|ACT57513.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 143

 Score =  239 bits (612), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 143/143 (100%), Positives = 143/143 (100%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI
Sbjct: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS
Sbjct: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVTTDEYLEVCRMGKLSNPPL
Sbjct: 121 VQPVTTDEYLEVCRMGKLSNPPL 143


>gi|254512217|ref|ZP_05124284.1| hypothetical protein RKLH11_2762 [Rhodobacteraceae bacterium KLH11]
 gi|221535928|gb|EEE38916.1| hypothetical protein RKLH11_2762 [Rhodobacteraceae bacterium KLH11]
          Length = 147

 Score =  239 bits (610), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 78/139 (56%), Positives = 94/139 (67%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M+VGD+GFFYHS K + I
Sbjct: 8   MAYWLFKSEPSTWSWDQQVAKGDAGEEWDGVRNYQARNFMRQMQVGDRGFFYHSQKEKAI 67

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T +    WECVDI AV     PV+L  IK   RL+ M+L+ S+RLS
Sbjct: 68  VGIVEICAEAHPDSTTDDE-RWECVDIKAVRPFTTPVTLEQIKTEERLADMVLVKSARLS 126

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT  E+  +C +G+  
Sbjct: 127 VQPVTEAEWRVICGLGETE 145


>gi|163742575|ref|ZP_02149961.1| hypothetical protein RG210_06799 [Phaeobacter gallaeciensis 2.10]
 gi|161384160|gb|EDQ08543.1| hypothetical protein RG210_06799 [Phaeobacter gallaeciensis 2.10]
          Length = 140

 Score =  237 bits (606), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 80/140 (57%), Positives = 99/140 (70%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  QQ KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MAYWLFKSEPSTWSWADQQAKGETGEEWDGVRNYQARNFMREMKIGDRGFFYHSMKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T +    WECVDI AV S   PV+L  IK +PRL +M+L+ +SRLS
Sbjct: 61  VGIVEICADVHPDSTTDD-PRWECVDIKAVRSFAVPVTLDQIKGDPRLENMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT +E+  +C +GK   
Sbjct: 120 VQPVTAEEWAHICALGKTDP 139


>gi|84501226|ref|ZP_00999431.1| hypothetical protein OB2597_12713 [Oceanicola batsensis HTCC2597]
 gi|84390517|gb|EAQ03005.1| hypothetical protein OB2597_12713 [Oceanicola batsensis HTCC2597]
          Length = 137

 Score =  237 bits (605), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 81/138 (58%), Positives = 95/138 (68%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP  WSW  Q  KG  GE W GVRNYQARN MR+M++GD+GFFYHS K REI
Sbjct: 1   MRYWLFKSEPDTWSWGDQVAKGAAGEEWDGVRNYQARNFMREMKLGDRGFFYHSQKTREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  +P PV+L  IKA P L+ M+L+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTDDE-RWECVDIRAVEPVPTPVTLDQIKATPELAGMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV   E+  +CRM  L
Sbjct: 120 VQPVEEAEWRVICRMAGL 137


>gi|254463760|ref|ZP_05077171.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Rhodobacterales bacterium Y4I]
 gi|206684668|gb|EDZ45150.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Rhodobacterales bacterium Y4I]
          Length = 140

 Score =  236 bits (603), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 80/140 (57%), Positives = 93/140 (66%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR M VGD+GFFYHS K + +
Sbjct: 1   MRYWLFKSEPSTWSWDDQVSKGDTGEEWDGVRNYQARNFMRDMNVGDRGFFYHSQKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T      WECVDI AV     PVSL  IKA+PRL  M+L+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTVDD-RWECVDIKAVRPFAKPVSLDQIKADPRLEDMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV+ +E+  VC +G+   
Sbjct: 120 VQPVSEEEWSAVCALGETDP 139


>gi|163738029|ref|ZP_02145445.1| hypothetical protein RGBS107_06444 [Phaeobacter gallaeciensis
           BS107]
 gi|161388645|gb|EDQ12998.1| hypothetical protein RGBS107_06444 [Phaeobacter gallaeciensis
           BS107]
          Length = 140

 Score =  236 bits (603), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  QQ KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MAYWLFKSEPSTWSWADQQAKGETGEEWDGVRNYQARNFMREMKIGDRGFFYHSMKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T +    WECVDI AV S   PV+L  IK + RL +M+L+ +SRLS
Sbjct: 61  VGIVEICADVHPDSTTDD-PRWECVDIKAVRSFAVPVTLDQIKGDSRLENMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT +E+  +C +GK   
Sbjct: 120 VQPVTAEEWAHICALGKTDP 139


>gi|126738542|ref|ZP_01754247.1| hypothetical protein RSK20926_08757 [Roseobacter sp. SK209-2-6]
 gi|126720341|gb|EBA17047.1| hypothetical protein RSK20926_08757 [Roseobacter sp. SK209-2-6]
          Length = 140

 Score =  235 bits (601), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 77/139 (55%), Positives = 97/139 (69%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS WSW+ Q +KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MRYWLFKSEPSTWSWQDQINKGDAGEEWDGVRNYQARNFMREMKLGDRGFFYHSQKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    W+CVDI    S   PVSL  IK++PRL  MIL+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTDDD-RWDCVDIKFFRSFIKPVSLDQIKSDPRLEEMILVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT +E+  +C +G+  
Sbjct: 120 VQPVTAEEWGVICALGQTE 138


>gi|163745145|ref|ZP_02152505.1| hypothetical protein OIHEL45_06140 [Oceanibulbus indolifex HEL-45]
 gi|161381963|gb|EDQ06372.1| hypothetical protein OIHEL45_06140 [Oceanibulbus indolifex HEL-45]
          Length = 139

 Score =  235 bits (600), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 81/140 (57%), Positives = 97/140 (69%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ WSW  Q+ KG  GE W GVRNYQARN MR+M+VGD GFFYHS K REI
Sbjct: 1   MAYWLFKSEPATWSWADQKAKGDAGEEWDGVRNYQARNFMREMKVGDLGFFYHSQKDREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD + +    WECVDI A+ S   PV+L  IKA+PRL  M+L  + RLS
Sbjct: 61  VGIVEVCAEAHPDSSTDD-PRWECVDIKALRSFSVPVTLDTIKADPRLEDMVLAKNPRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT  E+  +C +GK + 
Sbjct: 120 VQPVTEAEWELICALGKTTP 139


>gi|254477687|ref|ZP_05091073.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Ruegeria sp.
           R11]
 gi|214031930|gb|EEB72765.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Ruegeria sp.
           R11]
          Length = 147

 Score =  234 bits (599), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 81/140 (57%), Positives = 98/140 (70%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  QQ KG  GE W GVRNYQARN MR M++GD+GFFYHS K + +
Sbjct: 8   MAYWLFKSEPSTWSWDDQQAKGDAGEEWDGVRNYQARNFMRDMKLGDRGFFYHSQKEKSV 67

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+   ++PD + +    WECVDI A+ S   PV+L  IKA+PRLS M L+ SSRLS
Sbjct: 68  VGIVEICAESHPDSSTDDE-RWECVDIKAIRSFVTPVTLEQIKADPRLSDMALVKSSRLS 126

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT +E+  VC +G    
Sbjct: 127 VQPVTAEEWKIVCALGNTDP 146


>gi|254462027|ref|ZP_05075443.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Rhodobacterales bacterium HTCC2083]
 gi|206678616|gb|EDZ43103.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 138

 Score =  234 bits (599), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 76/139 (54%), Positives = 94/139 (67%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W  Q  KG  GE W GVRNYQARN MR M VGD+GFFYHS K + +
Sbjct: 1   MQYWLFKSEPSVWGWDDQVAKGGTGEEWDGVRNYQARNFMRDMSVGDRGFFYHSQKEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI A+  +   V+L  IKA+PRL+ M L+ SSRLS
Sbjct: 61  VGIVEVCKEAHPDSTTDD-PRWECVDIKAIEPLKTAVTLETIKADPRLAEMSLVKSSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV  +E+  +C +G+++
Sbjct: 120 VQPVRAEEWQIICALGEIA 138


>gi|259417456|ref|ZP_05741375.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259346362|gb|EEW58176.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 140

 Score =  234 bits (599), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 78/137 (56%), Positives = 97/137 (70%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ W W  Q  KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MAYWLFKSEPNTWGWHDQVAKGDAGEEWDGVRNYQARNFMREMKLGDRGFFYHSLKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD   +    WECVDI A+ +   PVSL  IK+NP L +M+L+ +SRLS
Sbjct: 61  VGIVEVCAEVHPDSKTDD-PRWECVDIKAIRAFAQPVSLDQIKSNPTLENMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT DE+ E+C+MG 
Sbjct: 120 VQPVTEDEWNEICKMGH 136


>gi|56698668|ref|YP_169045.1| hypothetical protein SPO3857 [Ruegeria pomeroyi DSS-3]
 gi|56680405|gb|AAV97071.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 140

 Score =  234 bits (598), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 77/140 (55%), Positives = 92/140 (65%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  W W  Q  KG  GE W GVRNYQARN MR M +GD+GFFYHS   + +
Sbjct: 1   MAYWLFKSEPETWGWDDQVAKGDAGEEWDGVRNYQARNFMRAMALGDRGFFYHSQSDKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD  ++    WECVDI AV     PV+L  IKA+PRLS M+L+ +SRLS
Sbjct: 61  VGIVEVCAEVHPDSKSDD-PRWECVDIRAVRPFQQPVTLEQIKADPRLSEMVLVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT  E+  +C MG+   
Sbjct: 120 VQPVTEAEWRAICAMGQTDP 139


>gi|328541992|ref|YP_004302101.1| Ubiquinol-cytochrome c reductase, iron-sulfur subunit [polymorphum
           gilvum SL003B-26A1]
 gi|326411741|gb|ADZ68804.1| Ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Polymorphum
           gilvum SL003B-26A1]
          Length = 141

 Score =  234 bits (597), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 83/140 (59%), Positives = 102/140 (72%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP +WSW+MQ+ KG  G+ W GVRNYQARNNMR M++GD+GFFYHSN+G+EI
Sbjct: 1   MRYWLFKSEPFKWSWEMQKAKGAAGQEWDGVRNYQARNNMRTMQIGDRGFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI A+  +P PV+L  +KA PRL+ M L+ S RLS
Sbjct: 61  VGIVEVCELAHPDSTTDD-PRWECVDIRALRDLPRPVTLAEVKAEPRLADMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT +E+  VC MG L  
Sbjct: 120 VQPVTEEEWRIVCAMGGLPE 139


>gi|89056568|ref|YP_512019.1| hypothetical protein Jann_4077 [Jannaschia sp. CCS1]
 gi|88866117|gb|ABD56994.1| protein of unknown function DUF589 [Jannaschia sp. CCS1]
          Length = 137

 Score =  233 bits (596), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 78/138 (56%), Positives = 91/138 (65%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  WSW  Q  KG  GE W GVRNYQARN MR M VGD+GFFYHS   + +
Sbjct: 1   MAYWLFKSEPGVWSWDDQVAKGDAGEEWDGVRNYQARNFMRDMAVGDRGFFYHSQAEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    W+CVDI AV  +  PV+L  IKA   L+ M L+ S+RLS
Sbjct: 61  VGIVEVCAEAHPDSTTDDD-RWDCVDIKAVKPLAQPVTLGQIKARDDLADMALVKSARLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  VC+MG L
Sbjct: 120 VQPVTDAEWKIVCKMGGL 137


>gi|119384733|ref|YP_915789.1| hypothetical protein Pden_2001 [Paracoccus denitrificans PD1222]
 gi|119374500|gb|ABL70093.1| protein of unknown function DUF55 [Paracoccus denitrificans PD1222]
          Length = 141

 Score =  233 bits (596), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 74/137 (54%), Positives = 92/137 (67%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  +S+     KG  GE W GVRNYQARNNMR M+ G++GFFYHSN G+EI
Sbjct: 1   MAYWLFKSEPDVFSFDDLIAKGETGEQWDGVRNYQARNNMRAMKKGERGFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD TA+    WECVD+ AV  +  P+SL   KA PRL  M+L+ +SRLS
Sbjct: 61  VGICEVAAEAHPDSTADD-PKWECVDVRAVARVRRPISLDEAKAEPRLKDMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPV+  E+  +  +  
Sbjct: 120 VQPVSDAEWEIILELAG 136


>gi|292490246|ref|YP_003525685.1| hypothetical protein Nhal_0077 [Nitrosococcus halophilus Nc4]
 gi|291578841|gb|ADE13298.1| protein of unknown function DUF55 [Nitrosococcus halophilus Nc4]
          Length = 141

 Score =  233 bits (596), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M+YWL KSEPS+WSW+ Q+ KG  GE W GVRNYQARNNMR M++GDKGFFYHSNKG E+
Sbjct: 1   MSYWLFKSEPSKWSWEDQKKKGAAGEEWDGVRNYQARNNMRAMKLGDKGFFYHSNKGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T E    WECVD+ A+C MP PVSL  IKANP+L+ M L+ S+RLS
Sbjct: 61  VGIIEVCKPAHPDSTTED-PRWECVDVRALCDMPKPVSLRKIKANPKLAKMALVTSARLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L   P
Sbjct: 120 VQPVTEDEWREVCRMGGLDPAP 141


>gi|86136720|ref|ZP_01055298.1| hypothetical protein MED193_13637 [Roseobacter sp. MED193]
 gi|85826044|gb|EAQ46241.1| hypothetical protein MED193_13637 [Roseobacter sp. MED193]
          Length = 140

 Score =  233 bits (595), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 80/139 (57%), Positives = 96/139 (69%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+MR+GD+GFFYHS K + +
Sbjct: 1   MRYWLFKSEPSTWGWPDQVAKGETGEEWDGVRNYQARNFMREMRLGDRGFFYHSQKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD T E    W+CVDI A+ +   PVSL  IKA+PRL  MIL+ +SRLS
Sbjct: 61  VGIVEVCAESHPDSTTEDD-RWDCVDIKALRAFTQPVSLDQIKADPRLEEMILVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT  E+  VC +G+  
Sbjct: 120 VQPVTEAEWRAVCALGQTE 138


>gi|222087472|ref|YP_002546009.1| hypothetical protein Arad_4351 [Agrobacterium radiobacter K84]
 gi|221724920|gb|ACM28076.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 143

 Score =  232 bits (593), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 98/143 (68%), Positives = 111/143 (77%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEPS WSW+ Q+D G  G AWTGVRNY ARNNMR M++GDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPSSWSWQQQKDAGSEGTAWTGVRNYLARNNMRTMQIGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TA+    W+CVDI AV  MP PVSL  IKANP+LS M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDATAKDDPRWDCVDIRAVRDMPKPVSLKDIKANPKLSQMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT DEYLEVCRMG+L NPP+
Sbjct: 121 VQPVTDDEYLEVCRMGELDNPPV 143


>gi|163732932|ref|ZP_02140376.1| hypothetical protein RLO149_09740 [Roseobacter litoralis Och 149]
 gi|161393467|gb|EDQ17792.1| hypothetical protein RLO149_09740 [Roseobacter litoralis Och 149]
          Length = 147

 Score =  232 bits (593), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 80/140 (57%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M+VGD GFFYHS K + I
Sbjct: 1   MAYWLFKSEPSTWSWDDQMAKGEAGEEWDGVRNYQARNFMRQMKVGDLGFFYHSQKEKSI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T E    W+CVDI AV  +  PVSL A+K + RL+ M L+  SRLS
Sbjct: 61  VGIVEVIAEAHPDSTTEDE-RWDCVDIKAVRPVKTPVSLEAVKQDERLADMALLKMSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV  +E+  +C M  + +
Sbjct: 120 VQPVQPEEWAVICDMAGVPD 139


>gi|255261429|ref|ZP_05340771.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255103764|gb|EET46438.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 139

 Score =  232 bits (593), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 79/139 (56%), Positives = 97/139 (69%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEPS WSW  Q  KG  GE W GVRNYQARN MR M +GD+GFFYHS K +EI
Sbjct: 1   MAFWLFKSEPSVWSWDDQVAKGDAGEEWDGVRNYQARNFMRSMAIGDRGFFYHSQKDKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T   +  WECVDI AV  +  P+SL  IK + RL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCAEAHPDSTT-DNDRWECVDIKAVEPLLQPISLDQIKGDERLAEMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT +E+  +C +G +S
Sbjct: 120 VQPVTENEFALICTLGGVS 138


>gi|99082672|ref|YP_614826.1| hypothetical protein TM1040_2832 [Ruegeria sp. TM1040]
 gi|99038952|gb|ABF65564.1| protein of unknown function DUF589 [Ruegeria sp. TM1040]
          Length = 140

 Score =  232 bits (593), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 77/136 (56%), Positives = 97/136 (71%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ W W  Q  KG  GE W GVRNYQARN MR+M++GD+GFFYHS K + +
Sbjct: 1   MAYWLFKSEPNTWGWDDQVAKGEAGEEWDGVRNYQARNFMREMKLGDRGFFYHSLKEKSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD T +    W+CVDI A+     PVSL  IK+NP L +M+L+ +SRLS
Sbjct: 61  VGIVEVCAKSHPDSTTDD-PRWDCVDIKAIRPFVKPVSLDQIKSNPMLENMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT  E+ E+C+MG
Sbjct: 120 VQPVTDAEWQEICKMG 135


>gi|260464229|ref|ZP_05812422.1| protein of unknown function DUF55 [Mesorhizobium opportunistum
           WSM2075]
 gi|259030032|gb|EEW31315.1| protein of unknown function DUF55 [Mesorhizobium opportunistum
           WSM2075]
          Length = 141

 Score =  232 bits (592), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 79/142 (55%), Positives = 98/142 (69%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS +S++  + KG+ G  W GVRNY ARNNM+ M++GD GFFYHSN+G  +
Sbjct: 1   MNYWLFKSEPSVFSFEALKAKGKAGTQWDGVRNYAARNNMKAMQIGDLGFFYHSNEGLNV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  MP P +L  +KANP+L+ M L+   RLS
Sbjct: 61  VGIAEVCALAHPDSTTDD-PRWECVDIRAVRDMPNPPTLEEVKANPKLADMALVRLGRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT  E+ EVCRMG L+  P
Sbjct: 120 VQPVTPAEWKEVCRMGGLTPAP 141


>gi|310817095|ref|YP_003965059.1| Thymocyte nuclear protein 1 [Ketogulonicigenium vulgare Y25]
 gi|308755830|gb|ADO43759.1| Thymocyte nuclear protein 1 [Ketogulonicigenium vulgare Y25]
          Length = 142

 Score =  231 bits (591), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 82/140 (58%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP E+ W  QQ  G  G AW+GVRNYQARNNMR M VGD  FFYHSN G+EI
Sbjct: 1   MRYWLMKSEPDEFGWDHQQALGPAGGAWSGVRNYQARNNMRAMSVGDLVFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI  VI     DPT +    W+CV + AV  +P PV+L  IKA P L+ M L+ SSRLS
Sbjct: 61  VGIMRVIAPAAQDPTTDD-PRWDCVSVTAVEKLPRPVTLDTIKATPALADMALVKSSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV TDE+  +CRMG L  
Sbjct: 120 VQPVATDEWKLICRMGGLDR 139


>gi|110677856|ref|YP_680863.1| hypothetical protein RD1_0467 [Roseobacter denitrificans OCh 114]
 gi|3925819|dbj|BAA34646.1| unnamed protein product [Roseobacter denitrificans]
 gi|109453972|gb|ABG30177.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 140

 Score =  231 bits (591), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M+VGD GFFYHS K + I
Sbjct: 1   MAYWLFKSEPSAWSWDDQVAKGEAGEEWDGVRNYQARNFMREMKVGDLGFFYHSQKEKSI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T +    WECVDI AV ++  PVSL  +K + RL+ M L+  SRLS
Sbjct: 61  VGIVEVIAEAHPDSTTQDD-RWECVDIKAVRAVKTPVSLEDVKQDDRLADMALLKMSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV  +E+  +C M  ++ 
Sbjct: 120 VQPVRPEEWAIICEMAGVAE 139


>gi|126732173|ref|ZP_01747974.1| hypothetical protein SSE37_17820 [Sagittula stellata E-37]
 gi|126707255|gb|EBA06320.1| hypothetical protein SSE37_17820 [Sagittula stellata E-37]
          Length = 139

 Score =  231 bits (590), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 83/137 (60%), Positives = 97/137 (70%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL KSEPS WSW  Q  KG  GE W GVRNYQARN MR+M  GD GFFYHS K REI
Sbjct: 1   MKFWLFKSEPSTWSWNDQVAKGDAGEEWDGVRNYQARNFMREMTPGDLGFFYHSQKDREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T + +  WECVDI AV  +P PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVSAPAHPDSTTDDA-RWECVDIKAVEPLPAPVTLDAIKAEPRLADMVLVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT +E+  +C MG 
Sbjct: 120 VQPVTAEEWDVICTMGG 136


>gi|240851349|ref|YP_002972752.1| hypothetical protein Bgr_19720 [Bartonella grahamii as4aup]
 gi|240268472|gb|ACS52060.1| hypothetical protein Bgr_19720 [Bartonella grahamii as4aup]
          Length = 144

 Score =  231 bits (590), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 93/143 (65%), Positives = 108/143 (75%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPHKWSWEMQKKKGADGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T+     WECVDI A+C MP PVSL  IKANP+L++M+L+ +SRLS
Sbjct: 61  VGIVEICAEAHPDSTSSD-PRWECVDIRALCDMPTPVSLKQIKANPKLANMVLVKASRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT DE+ EVC MG L    L
Sbjct: 120 VQPVTEDEWKEVCLMGNLKREML 142


>gi|319409421|emb|CBI83067.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 144

 Score =  231 bits (590), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 93/143 (65%), Positives = 103/143 (72%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPQKWSWAMQKQKGAHGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T      WECVDI A+C MP PVSL  IKANP+L +M L+ + RLS
Sbjct: 61  VGIVEVCAQAHPDSTTSD-PRWECVDIRALCDMPNPVSLKQIKANPKLKNMALVKTMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT DE+ EVC MG L    L
Sbjct: 120 VQPVTEDEWKEVCSMGGLKPEML 142


>gi|319406354|emb|CBI79993.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 142

 Score =  231 bits (590), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 88/138 (63%), Positives = 102/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSN+G EI
Sbjct: 1   MAYWLFKSEPHKWSWDMQKQKGGDGEQWDGVRNYQARNNMRAMKCGDKGFFYHSNQGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T+     WECVDI A+C +P PVSL  IKANP+L +M L+ + RLS
Sbjct: 61  VGIVEVCAEAHPDSTSLD-PRWECVDIRAICDIPNPVSLKQIKANPKLKNMTLVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT DE+ E+C MG L
Sbjct: 120 VQSVTEDEWKEICSMGGL 137


>gi|163869278|ref|YP_001610534.1| hypothetical protein Btr_2586 [Bartonella tribocorum CIP 105476]
 gi|161018981|emb|CAK02539.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 142

 Score =  231 bits (590), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 93/143 (65%), Positives = 108/143 (75%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPHKWSWEMQKKKGAGGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PD T+     WECVDI A+C MP PVSL  IKANP+L++M+L+ +SRLS
Sbjct: 61  VGIVEICAEAHPDSTSSD-PRWECVDIRALCDMPTPVSLKQIKANPKLANMVLVNASRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT DE+ EVC MG L    L
Sbjct: 120 VQPVTEDEWKEVCLMGNLKKEML 142


>gi|110635535|ref|YP_675743.1| hypothetical protein Meso_3206 [Mesorhizobium sp. BNC1]
 gi|110286519|gb|ABG64578.1| protein of unknown function DUF55 [Chelativorans sp. BNC1]
          Length = 141

 Score =  231 bits (590), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 85/142 (59%), Positives = 101/142 (71%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ WSW+MQ+ KG  G+ W GVRNYQARNNMR M+VGD GFFYHS K   +
Sbjct: 1   MAYWLFKSEPTSWSWEMQKKKGAQGQEWDGVRNYQARNNMRAMKVGDLGFFYHSVKETSV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T +    WECVDI AV  +P PVSL  IK NP+L  M+L+ +SRLS
Sbjct: 61  VGIVEVIAPAHPDSTTDD-PRWECVDIRAVLDVPKPVSLEEIKTNPKLKDMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPV+  E+ E+C MG L   P
Sbjct: 120 VQPVSNAEWREICHMGGLDKAP 141


>gi|319899473|ref|YP_004159570.1| hypothetical protein BARCL_1337 [Bartonella clarridgeiae 73]
 gi|319403441|emb|CBI77009.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 142

 Score =  231 bits (589), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 90/138 (65%), Positives = 104/138 (75%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSN+G EI
Sbjct: 1   MAYWLFKSEPHKWSWDMQKQKGVYGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNQGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T+  S  WECVDI A+C +P PVSL  IKANP+L +MIL+ + RLS
Sbjct: 61  VGIVEVCAEAHPDSTSFDS-RWECVDIRAICDIPNPVSLKQIKANPKLKNMILVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT DE+ E+C MG L
Sbjct: 120 VQSVTEDEWKEICSMGGL 137


>gi|254439422|ref|ZP_05052916.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
 gi|198254868|gb|EDY79182.1| conserved hypothetical protein [Octadecabacter antarcticus 307]
          Length = 139

 Score =  231 bits (589), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 77/140 (55%), Positives = 94/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M  GD+GFFYHS K + +
Sbjct: 1   MRYWLFKSEPSTWGWDDQVAKGDAGEEWDGVRNYQARNFMREMACGDRGFFYHSQKEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV     PV+L  IKA+  LS M+L+ +SRLS
Sbjct: 61  VGIVEVCAPAHPDSTIDDD-RWECVDIKAVRPFETPVTLDQIKADDSLSEMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV+ DE+L +C +G+ + 
Sbjct: 120 VQPVSDDEWLAICALGRTNP 139


>gi|13473581|ref|NP_105149.1| hypothetical protein mlr4228 [Mesorhizobium loti MAFF303099]
 gi|14024331|dbj|BAB50935.1| mlr4228 [Mesorhizobium loti MAFF303099]
          Length = 141

 Score =  231 bits (589), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 79/142 (55%), Positives = 99/142 (69%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS +S++  + KG+ G  W GVRNY ARNNM+ M++GD GFFYHSN+G  I
Sbjct: 1   MNYWLFKSEPSVFSFEALKAKGKAGTQWDGVRNYAARNNMKAMQIGDLGFFYHSNEGLNI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T++    WECVDI AV  +P P +L  +KANP+L+ M L+   RLS
Sbjct: 61  VGIAEVCALAHPDTTSDD-PRWECVDIRAVRDVPTPPTLEQVKANPKLADMALVRLGRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT  E+ EVCRMG L+  P
Sbjct: 120 VQPVTPAEWKEVCRMGGLTPAP 141


>gi|319780783|ref|YP_004140259.1| hypothetical protein Mesci_1045 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166671|gb|ADV10209.1| protein of unknown function DUF55 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 141

 Score =  231 bits (589), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 79/142 (55%), Positives = 100/142 (70%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP ++S++M + KG+ G  W GVRNY ARNNM+ M++GD GFFYHSN+G  I
Sbjct: 1   MNYWLFKSEPFKFSFEMLKAKGKAGTQWDGVRNYAARNNMKAMQIGDLGFFYHSNEGLNI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T++    WECVDI AV  +P P +L  +KANP+L+ M L+   RLS
Sbjct: 61  VGIAEVCALAHPDTTSDD-PRWECVDIRAVRDVPNPPTLEQVKANPKLADMALVRLGRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT  E+ EVCRMG L+  P
Sbjct: 120 VQPVTPAEWKEVCRMGGLTPAP 141


>gi|85705796|ref|ZP_01036893.1| hypothetical protein ROS217_10862 [Roseovarius sp. 217]
 gi|85669786|gb|EAQ24650.1| hypothetical protein ROS217_10862 [Roseovarius sp. 217]
          Length = 139

 Score =  230 bits (587), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 75/138 (54%), Positives = 95/138 (68%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W+ Q  KG  GE W GVRNYQARN MR M +GD+GFFYHS   + +
Sbjct: 1   MQYWLFKSEPSTWGWQDQLAKGDAGEEWDGVRNYQARNFMRDMAIGDRGFFYHSQTEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD  ++    WECVDI A+ +   PV+L  IK++PRL+ MIL+ +SRLS
Sbjct: 61  VGIVEVIATAHPDSKSDD-PRWECVDIKAIETARTPVTLDTIKSDPRLAEMILVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +++  +C M  L
Sbjct: 120 VQPVTAEQWRIICDMAGL 137


>gi|84514846|ref|ZP_01002209.1| hypothetical protein SKA53_11518 [Loktanella vestfoldensis SKA53]
 gi|84511005|gb|EAQ07459.1| hypothetical protein SKA53_11518 [Loktanella vestfoldensis SKA53]
          Length = 139

 Score =  230 bits (587), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 94/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  W W  Q  KG VGE W GVRNYQARNNMR M+ GD GFFYHS  G EI
Sbjct: 1   MAYWLFKSEPDVWGWDQQTAKGAVGEEWGGVRNYQARNNMRAMKTGDLGFFYHSRTGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV T ++PD T +    W+CVD+ AV     PVSL  IKA+ RL  M+L+ ++RLS
Sbjct: 61  VGIVEVCTESHPDSTTDD-PRWDCVDVRAVRPFVKPVSLAQIKADLRLKDMVLVNNARLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT  E+  +C +G +  
Sbjct: 120 VQPVTDTEWKTICALGGIEP 139


>gi|149204338|ref|ZP_01881305.1| hypothetical protein RTM1035_18335 [Roseovarius sp. TM1035]
 gi|149142223|gb|EDM30270.1| hypothetical protein RTM1035_18335 [Roseovarius sp. TM1035]
          Length = 139

 Score =  229 bits (586), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 78/140 (55%), Positives = 96/140 (68%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS W W+ Q  KG  GE W GVRNYQARN MR+M +GD+GFFYHS   + +
Sbjct: 1   MRYWLFKSEPSTWGWQDQLAKGDAGEEWDGVRNYQARNFMREMALGDRGFFYHSQSEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EVI   +PD  ++    WECVDI AV S   PV+L  IK++PRL+ M+L+ +SRLS
Sbjct: 61  VGTVEVIATAHPDSKSDD-PRWECVDIKAVASAKTPVTLDTIKSDPRLADMVLVKNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT DE+  +C M  LS 
Sbjct: 120 VQPVTADEWRIICDMAGLSG 139


>gi|121601905|ref|YP_988399.1| hypothetical protein BARBAKC583_0060 [Bartonella bacilliformis
           KC583]
 gi|120614082|gb|ABM44683.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 142

 Score =  229 bits (586), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 91/143 (63%), Positives = 105/143 (73%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPDKWSWTMQKKKGLDGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+   T+PD T      WECVDI A+C MP PVSL  IKANP+L++M L+ + RLS
Sbjct: 61  VGIVEICAETHPDSTTSD-PRWECVDIRAICDMPNPVSLKQIKANPKLNTMTLVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT +E+ E+C MG L    L
Sbjct: 120 VQPVTEEEWKEICAMGGLQPEML 142


>gi|77462052|ref|YP_351556.1| hypothetical protein RSP_1512 [Rhodobacter sphaeroides 2.4.1]
 gi|77386470|gb|ABA77655.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1]
          Length = 137

 Score =  229 bits (586), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 81/138 (58%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  WSW  Q  KG  GE WTGVRNYQARN+MR M++GD+GFFYHSN G+E+
Sbjct: 1   MACWLFKSEPDAWSWDQQVAKGAEGEEWTGVRNYQARNHMRAMQLGDRGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV + AV  +P PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCGLSAPDSTADD-PRWDCVTVRAVEPLPKPVTLEAIKAEPRLAGMVLVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV+  E+  +C MG L
Sbjct: 120 VQPVSEAEWRTICEMGGL 137


>gi|306844861|ref|ZP_07477444.1| Hypothetical protein BIBO1_1541 [Brucella sp. BO1]
 gi|306274793|gb|EFM56574.1| Hypothetical protein BIBO1_1541 [Brucella sp. BO1]
          Length = 142

 Score =  229 bits (586), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 90/139 (64%), Positives = 105/139 (75%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ +G  GE W GVRNYQARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWEMQKTRGEKGEQWDGVRNYQARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  MP PV+L  +KANPRL  M L+ S RLS
Sbjct: 61  VGIVEVCALAHPDSTTDD-PRWECVDIKAVRDMPKPVTLKDVKANPRLQDMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE++EVCRMG L 
Sbjct: 120 VQPVTEDEWIEVCRMGGLD 138


>gi|17986456|ref|NP_539090.1| hypothetical protein BMEI0172 [Brucella melitensis bv. 1 str. 16M]
 gi|23502743|ref|NP_698870.1| hypothetical protein BR1891 [Brucella suis 1330]
 gi|62290748|ref|YP_222541.1| hypothetical protein BruAb1_1868 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700659|ref|YP_415233.1| hypothetical protein BAB1_1891 [Brucella melitensis biovar Abortus
           2308]
 gi|148560503|ref|YP_001259716.1| hypothetical protein BOV_1819 [Brucella ovis ATCC 25840]
 gi|161619808|ref|YP_001593695.1| hypothetical protein BCAN_A1934 [Brucella canis ATCC 23365]
 gi|163843915|ref|YP_001628319.1| hypothetical protein BSUIS_A1731 [Brucella suis ATCC 23445]
 gi|189024961|ref|YP_001935729.1| hypothetical protein BAbS19_I17730 [Brucella abortus S19]
 gi|225628092|ref|ZP_03786127.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225853328|ref|YP_002733561.1| hypothetical protein BMEA_A1944 [Brucella melitensis ATCC 23457]
 gi|237816254|ref|ZP_04595247.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|254690036|ref|ZP_05153290.1| hypothetical protein Babob68_07676 [Brucella abortus bv. 6 str.
           870]
 gi|254694525|ref|ZP_05156353.1| hypothetical protein Babob3T_07674 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696150|ref|ZP_05157978.1| hypothetical protein Babob28_00162 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700535|ref|ZP_05162363.1| hypothetical protein Bsuib55_06736 [Brucella suis bv. 5 str. 513]
 gi|254704906|ref|ZP_05166734.1| hypothetical protein Bsuib36_13505 [Brucella suis bv. 3 str. 686]
 gi|254707579|ref|ZP_05169407.1| hypothetical protein BpinM_11556 [Brucella pinnipedialis
           M163/99/10]
 gi|254708884|ref|ZP_05170695.1| hypothetical protein BpinB_01208 [Brucella pinnipedialis B2/94]
 gi|254713692|ref|ZP_05175503.1| hypothetical protein BcetM6_10115 [Brucella ceti M644/93/1]
 gi|254715957|ref|ZP_05177768.1| hypothetical protein BcetM_05902 [Brucella ceti M13/05/1]
 gi|254731068|ref|ZP_05189646.1| hypothetical protein Babob42_07706 [Brucella abortus bv. 4 str.
           292]
 gi|256030410|ref|ZP_05444024.1| hypothetical protein BpinM2_07140 [Brucella pinnipedialis
           M292/94/1]
 gi|256045500|ref|ZP_05448383.1| hypothetical protein Bmelb1R_13431 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256059868|ref|ZP_05450055.1| hypothetical protein Bneo5_05887 [Brucella neotomae 5K33]
 gi|256112226|ref|ZP_05453147.1| hypothetical protein Bmelb3E_05992 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158393|ref|ZP_05456291.1| hypothetical protein BcetM4_06030 [Brucella ceti M490/95/1]
 gi|256253812|ref|ZP_05459348.1| hypothetical protein BcetB_05872 [Brucella ceti B1/94]
 gi|256258290|ref|ZP_05463826.1| hypothetical protein Babob9C_13288 [Brucella abortus bv. 9 str.
           C68]
 gi|256263185|ref|ZP_05465717.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|256370292|ref|YP_003107803.1| hypothetical protein BMI_I1912 [Brucella microti CCM 4915]
 gi|260169319|ref|ZP_05756130.1| hypothetical protein BruF5_13365 [Brucella sp. F5/99]
 gi|260546011|ref|ZP_05821751.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260562809|ref|ZP_05833295.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260567620|ref|ZP_05838090.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260755572|ref|ZP_05867920.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758795|ref|ZP_05871143.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260760519|ref|ZP_05872862.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884596|ref|ZP_05896210.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214843|ref|ZP_05929124.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261217720|ref|ZP_05932001.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261220945|ref|ZP_05935226.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315066|ref|ZP_05954263.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316377|ref|ZP_05955574.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261321432|ref|ZP_05960629.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261323838|ref|ZP_05963035.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261751039|ref|ZP_05994748.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261755600|ref|ZP_05999309.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|261758832|ref|ZP_06002541.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|265987449|ref|ZP_06100006.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991922|ref|ZP_06104479.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993653|ref|ZP_06106210.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265996905|ref|ZP_06109462.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|294851129|ref|ZP_06791802.1| hypothetical protein BAZG_00028 [Brucella sp. NVSL 07-0026]
 gi|297247134|ref|ZP_06930852.1| hypothetical protein BAYG_00027 [Brucella abortus bv. 5 str. B3196]
 gi|306842955|ref|ZP_07475589.1| Hypothetical protein BIBO2_2729 [Brucella sp. BO2]
 gi|17982053|gb|AAL51354.1| hypothetical protein BMEI0172 [Brucella melitensis bv. 1 str. 16M]
 gi|23348760|gb|AAN30785.1| conserved hypothetical protein [Brucella suis 1330]
 gi|62196880|gb|AAX75180.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616760|emb|CAJ11847.1| Family of unknown function DUF589 [Brucella melitensis biovar
           Abortus 2308]
 gi|148371760|gb|ABQ61739.1| conserved hypothetical protein [Brucella ovis ATCC 25840]
 gi|161336619|gb|ABX62924.1| protein of unknown function DUF55 [Brucella canis ATCC 23365]
 gi|163674638|gb|ABY38749.1| protein of unknown function DUF55 [Brucella suis ATCC 23445]
 gi|189020533|gb|ACD73255.1| Family of unknown function DUF589 [Brucella abortus S19]
 gi|225616917|gb|EEH13964.1| Hypothetical protein, conserved [Brucella ceti str. Cudo]
 gi|225641693|gb|ACO01607.1| protein of unknown function DUF55 [Brucella melitensis ATCC 23457]
 gi|237788321|gb|EEP62536.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A]
 gi|256000455|gb|ACU48854.1| hypothetical protein BMI_I1912 [Brucella microti CCM 4915]
 gi|260096118|gb|EEW79994.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260152825|gb|EEW87917.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260157138|gb|EEW92218.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260669113|gb|EEX56053.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260670951|gb|EEX57772.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675680|gb|EEX62501.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260874124|gb|EEX81193.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916450|gb|EEX83311.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260919529|gb|EEX86182.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260922809|gb|EEX89377.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294122|gb|EEX97618.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|261295600|gb|EEX99096.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261299818|gb|EEY03315.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261304092|gb|EEY07589.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261738816|gb|EEY26812.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261740792|gb|EEY28718.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261745353|gb|EEY33279.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262551373|gb|EEZ07363.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262764634|gb|EEZ10555.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002988|gb|EEZ15281.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093107|gb|EEZ17242.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659646|gb|EEZ29907.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|294819718|gb|EFG36717.1| hypothetical protein BAZG_00028 [Brucella sp. NVSL 07-0026]
 gi|297174303|gb|EFH33650.1| hypothetical protein BAYG_00027 [Brucella abortus bv. 5 str. B3196]
 gi|306286883|gb|EFM58408.1| Hypothetical protein BIBO2_2729 [Brucella sp. BO2]
 gi|326409892|gb|ADZ66957.1| Family of unknown function DUF589 [Brucella melitensis M28]
 gi|326539605|gb|ADZ87820.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 142

 Score =  229 bits (586), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 90/139 (64%), Positives = 105/139 (75%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ +G  GE W GVRNYQARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWEMQKARGEKGEQWDGVRNYQARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  MP PV+L  +KANPRL  M L+ S RLS
Sbjct: 61  VGIVEVCALAHPDSTTDD-PRWECVDIKAVRDMPKPVTLKDVKANPRLQDMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE++EVCRMG L 
Sbjct: 120 VQPVTEDEWIEVCRMGGLD 138


>gi|254717958|ref|ZP_05179769.1| hypothetical protein Bru83_00130 [Brucella sp. 83/13]
 gi|265982901|ref|ZP_06095636.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306838954|ref|ZP_07471778.1| Hypothetical protein BROD_1789 [Brucella sp. NF 2653]
 gi|264661493|gb|EEZ31754.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306405957|gb|EFM62212.1| Hypothetical protein BROD_1789 [Brucella sp. NF 2653]
          Length = 142

 Score =  229 bits (585), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 90/139 (64%), Positives = 106/139 (76%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ +G  GE W GVRNYQARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWEMQKARGEKGEQWDGVRNYQARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AVC MP PV+L  +KANP+L  M L+ S RLS
Sbjct: 61  VGIVEVCALAHPDSTTDD-PRWECVDIKAVCDMPKPVTLKDVKANPKLQDMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE++EVCRMG L 
Sbjct: 120 VQPVTEDEWIEVCRMGGLD 138


>gi|227823728|ref|YP_002827701.1| hypothetical protein NGR_c32150 [Sinorhizobium fredii NGR234]
 gi|227342730|gb|ACP26948.1| conserved hypothetical protein [Sinorhizobium fredii NGR234]
          Length = 143

 Score =  229 bits (585), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 93/142 (65%), Positives = 110/142 (77%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP++WSW+MQ+D G  G  WTGVRNY ARNNMR M++GDKGFFYHSN+G EI
Sbjct: 1   MAHWLYKSEPNKWSWQMQKDAGEKGTEWTGVRNYLARNNMRAMKIGDKGFFYHSNEGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE  + W+CVDI AV  +P PVSL  IK NP L+ M L+ S RLS
Sbjct: 61  VGITEVCALSHPDSTAEGDARWDCVDIRAVRDIPRPVSLKEIKENPTLAKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE++EVCRMG L NPP
Sbjct: 121 VQPVTEDEWIEVCRMGGLDNPP 142


>gi|126460941|ref|YP_001042055.1| hypothetical protein Rsph17029_0164 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559979|ref|ZP_08414301.1| hypothetical protein RSWS8N_13000 [Rhodobacter sphaeroides WS8N]
 gi|126102605|gb|ABN75283.1| protein of unknown function DUF55 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332277691|gb|EGJ23006.1| hypothetical protein RSWS8N_13000 [Rhodobacter sphaeroides WS8N]
          Length = 141

 Score =  229 bits (585), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 81/138 (58%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  WSW  Q  KG  GE WTGVRNYQARN+MR M++GD+GFFYHSN G+E+
Sbjct: 1   MACWLFKSEPDAWSWDQQVAKGAEGEEWTGVRNYQARNHMRAMQLGDRGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV + AV  +P PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCGLSAPDSTADD-PRWDCVTVRAVEPLPKPVTLEAIKAEPRLAQMVLVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV+  E+  +C MG L
Sbjct: 120 VQPVSEAEWRTICEMGGL 137


>gi|254485940|ref|ZP_05099145.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Roseobacter
           sp. GAI101]
 gi|214042809|gb|EEB83447.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Roseobacter
           sp. GAI101]
          Length = 139

 Score =  229 bits (585), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 75/136 (55%), Positives = 88/136 (64%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M  GD GFFYHS   R I
Sbjct: 1   MAYWLFKSEPSTWGWDDQVAKGDTGEEWDGVRNYQARNFMREMAKGDLGFFYHSQGERAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   + D + +    WECVDI AV     PV+L  IK++ R   M L+ S RLS
Sbjct: 61  VGIVEVIAEAHQDSSTDDD-RWECVDIKAVRPFETPVTLDDIKSDGRFDDMPLVKSPRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT +++ ++C MG
Sbjct: 120 VQPVTAEQWQQICAMG 135


>gi|163757404|ref|ZP_02164493.1| hypothetical protein HPDFL43_18377 [Hoeflea phototrophica DFL-43]
 gi|162284906|gb|EDQ35188.1| hypothetical protein HPDFL43_18377 [Hoeflea phototrophica DFL-43]
          Length = 142

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 93/142 (65%), Positives = 108/142 (76%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W G+RNYQARNNMR M++G+KGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWDMQKAKGSEGEQWDGIRNYQARNNMRAMKLGEKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AVC MP PV+L  +KANP+L+ M L+ S RLS
Sbjct: 61  VGIVEVSALIHPDTTTDD-PRWECVDIRAVCDMPKPVTLKDVKANPKLAEMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT  EYLEVCRMG L NPP
Sbjct: 120 VQPVTEAEYLEVCRMGGLDNPP 141


>gi|89067492|ref|ZP_01155005.1| hypothetical protein OG2516_11646 [Oceanicola granulosus HTCC2516]
 gi|89047061|gb|EAR53115.1| hypothetical protein OG2516_11646 [Oceanicola granulosus HTCC2516]
          Length = 139

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 75/140 (53%), Positives = 92/140 (65%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  WSW  Q  +G  GE W GVRNYQARN MR+M+VGD GFFYHS   + +
Sbjct: 1   MAYWLFKSEPEGWSWDDQVARGEAGEEWDGVRNYQARNVMRQMKVGDLGFFYHSQSDKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T++    WECVDI AV     PV+L  IKA+PR + M L+ ++RLS
Sbjct: 61  VGIVEVIAEAHPDSTSDDD-RWECVDIRAVRPFTRPVTLEQIKADPRFADMALVKNTRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV    +  +C MG  + 
Sbjct: 120 VQPVDEAAWRAICEMGDTAP 139


>gi|221641004|ref|YP_002527266.1| hypothetical protein RSKD131_2905 [Rhodobacter sphaeroides KD131]
 gi|221161785|gb|ACM02765.1| Hypothetical Protein RSKD131_2905 [Rhodobacter sphaeroides KD131]
          Length = 137

 Score =  228 bits (583), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  WSW  Q  KG  GE WTGVRNYQARN+MR M++GD+GFFYHSN G+E+
Sbjct: 1   MACWLFKSEPDAWSWDQQVAKGAEGEEWTGVRNYQARNHMRAMQLGDRGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV + AV  +P PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCGLSAPDSTADD-PRWDCVTVRAVEPLPKPVTLEAIKAEPRLAQMVLVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV+  E+L +C MG L
Sbjct: 120 VQPVSEAEWLTICEMGGL 137


>gi|149912851|ref|ZP_01901385.1| hypothetical protein RAZWK3B_02645 [Roseobacter sp. AzwK-3b]
 gi|149813257|gb|EDM73083.1| hypothetical protein RAZWK3B_02645 [Roseobacter sp. AzwK-3b]
          Length = 139

 Score =  227 bits (581), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 93/140 (66%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP  WSW  Q  KG  GE W GVRNYQARN MR M++GD+GFFYHS   + +
Sbjct: 1   MRYWLFKSEPEAWSWNDQVAKGDSGEEWDGVRNYQARNFMRDMKLGDRGFFYHSQTEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   +PD  A+    W+CVDI AV  +  PV+L  IK +PRLS M+L+ S RLS
Sbjct: 61  VGIVEIIAEAHPDSKADD-PRWDCVDIKAVEPVKTPVTLETIKGDPRLSDMMLVKSPRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV+  E+  +C M  ++ 
Sbjct: 120 VQPVSEGEWRIICDMAGVTP 139


>gi|159045952|ref|YP_001534746.1| hypothetical protein Dshi_3412 [Dinoroseobacter shibae DFL 12]
 gi|157913712|gb|ABV95145.1| protein of unknown function DUF55 [Dinoroseobacter shibae DFL 12]
          Length = 139

 Score =  227 bits (581), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 75/140 (53%), Positives = 93/140 (66%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS WSW MQ  KG  GE W GVRNYQARN MR+M +GD+GFFYHS K + I
Sbjct: 1   MRYWLFKSEPSVWSWDMQVAKGDAGEEWDGVRNYQARNFMREMALGDRGFFYHSQKDKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EV    +PD T E    W+CVDI A+  +   V+L  IK++P L  M+L+ ++RLS
Sbjct: 61  VGTVEVCAEAHPDSTTEDD-RWDCVDIRALTPLVRHVTLDEIKSDPALGEMVLVRNARLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT  E+  +C MG +  
Sbjct: 120 VQPVTETEWRRICEMGGVDP 139


>gi|319404869|emb|CBI78470.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 140

 Score =  227 bits (581), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 89/138 (64%), Positives = 104/138 (75%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS+WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSN+G EI
Sbjct: 1   MAYWLFKSEPSKWSWDMQKQKGFDGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNQGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T+     WECVDI A+C +P PVSL  IKANP+L +M+L+ + RLS
Sbjct: 61  VGIVEVCAEAHPDSTSSD-PRWECVDIRAICDIPNPVSLKQIKANPKLKNMMLVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT DE+ E+C MG L
Sbjct: 120 VQSVTEDEWKEICSMGGL 137


>gi|126734489|ref|ZP_01750236.1| hypothetical protein RCCS2_10019 [Roseobacter sp. CCS2]
 gi|126717355|gb|EBA14219.1| hypothetical protein RCCS2_10019 [Roseobacter sp. CCS2]
          Length = 146

 Score =  227 bits (580), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  W W  Q  KG  GE W GVRNYQARNNMR M++G+KGFFYHS  G EI
Sbjct: 8   MARWLFKSEPDVWGWDAQVAKGEAGEEWDGVRNYQARNNMRAMKLGEKGFFYHSRTGLEI 67

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    W+CVDI AV     PV+L  IKA+PRLS M+L+ +SRLS
Sbjct: 68  VGIVEVCAEAHPDSTTDDD-RWDCVDIKAVRPFTKPVTLETIKADPRLSDMVLVNNSRLS 126

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT +E+  +C +G+   
Sbjct: 127 VQPVTDEEWQIICDLGETKP 146


>gi|319407830|emb|CBI81483.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 142

 Score =  227 bits (580), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 89/138 (64%), Positives = 104/138 (75%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS+WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSN+G EI
Sbjct: 1   MAYWLFKSEPSKWSWDMQKQKGIDGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNQGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T+     WECVDI A+C +P PVSL  IKANP+L +M+L+ + RLS
Sbjct: 61  VGIVEVCAEAHPDSTSSD-PRWECVDIRAICDIPNPVSLKQIKANPKLKNMMLVKAMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT DE+ E+C MG L
Sbjct: 120 VQSVTEDEWKEICFMGGL 137


>gi|83953036|ref|ZP_00961758.1| hypothetical protein NAS141_12046 [Sulfitobacter sp. NAS-14.1]
 gi|83842004|gb|EAP81172.1| hypothetical protein NAS141_12046 [Sulfitobacter sp. NAS-14.1]
          Length = 139

 Score =  227 bits (580), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 77/136 (56%), Positives = 90/136 (66%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M VGD GFFYHS   R I
Sbjct: 1   MAYWLFKSEPSTWGWLDQVAKGDTGEEWDGVRNYQARNFMREMAVGDLGFFYHSQGERAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD + E +  WECVDI AV     PV+L  IKA+ R   M+L+ S RLS
Sbjct: 61  VGIVEVCAAAHPDSSTEDA-RWECVDIKAVRPFEKPVTLDDIKADGRFDDMLLVKSPRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT +++  +C +G
Sbjct: 120 VQPVTAEQWSAICALG 135


>gi|49476264|ref|YP_034305.1| hypothetical protein BH16120 [Bartonella henselae str. Houston-1]
 gi|49239072|emb|CAF28375.1| hypothetical protein BH16120 [Bartonella henselae str. Houston-1]
          Length = 142

 Score =  227 bits (579), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 91/138 (65%), Positives = 102/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPHKWSWDMQKQKGADGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T      WECV+I A+  MP PVSL  IKANP+L +M+L+  SRLS
Sbjct: 61  VGIVEVCAEAHPDSTTAD-PRWECVNIRALYDMPTPVSLKQIKANPKLKNMVLVNVSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+ EVC MG L
Sbjct: 120 VQPVTEDEWREVCLMGNL 137


>gi|114765148|ref|ZP_01444292.1| hypothetical protein 1100011001332_R2601_15040 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542423|gb|EAU45450.1| hypothetical protein R2601_15040 [Roseovarius sp. HTCC2601]
          Length = 139

 Score =  227 bits (579), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 92/140 (65%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M+YWL KSEPS WSW+ Q  KG  GE W GVRNYQARN MR+M VGD GFFYHS K + +
Sbjct: 1   MSYWLFKSEPSTWSWQDQVAKGDAGEEWDGVRNYQARNFMRQMAVGDLGFFYHSQKEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EVI   +PD + +    WECVDI AV +   PV+L  IK  P LS M L+ S+RLS
Sbjct: 61  VGTVEVIAAAHPDSSTDD-PRWECVDIKAVQAAKTPVTLEQIKQKPALSEMALVKSARLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT  E+  VC M  L  
Sbjct: 120 VQPVTEVEWRLVCEMAGLDP 139


>gi|327188885|gb|EGE56077.1| hypothetical protein RHECNPAF_750037 [Rhizobium etli CNPAF512]
          Length = 143

 Score =  226 bits (578), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 92/142 (64%), Positives = 104/142 (73%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VGDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TA+    W+CVDI AV  MP PV+L  IKAN  LS M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSTAKGDPKWDCVDIRAVMDMPKPVTLKDIKANETLSKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|190893749|ref|YP_001980291.1| hypothetical protein RHECIAT_CH0004184 [Rhizobium etli CIAT 652]
 gi|190699028|gb|ACE93113.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 143

 Score =  226 bits (578), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 92/142 (64%), Positives = 105/142 (73%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VGDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TA+    W+CVDI AV  MP PV+L  IKAN +LS M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSTAKGDPKWDCVDIRAVMDMPKPVTLKDIKANEKLSKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|146278949|ref|YP_001169108.1| hypothetical protein Rsph17025_2917 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557190|gb|ABP71803.1| protein of unknown function DUF55 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 137

 Score =  225 bits (576), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 82/138 (59%), Positives = 104/138 (75%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP  WSW+ QQ KG+ GE WTGVRNYQARN+MR M++G++GFFYHSN G+E+
Sbjct: 1   MAFWLFKSEPDAWSWEQQQAKGQAGEEWTGVRNYQARNHMRAMKLGERGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV + AV  MP PV+L AIKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEVCGLSAPDSTADD-PRWDCVTVRAVEPMPRPVTLEAIKAEPRLAGMVLVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV  +E+  +C MG L
Sbjct: 120 VQPVGDEEWRMICEMGGL 137


>gi|83950375|ref|ZP_00959108.1| hypothetical protein ISM_04735 [Roseovarius nubinhibens ISM]
 gi|83838274|gb|EAP77570.1| hypothetical protein ISM_04735 [Roseovarius nubinhibens ISM]
          Length = 139

 Score =  225 bits (575), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 77/140 (55%), Positives = 93/140 (66%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP+ WSW+ QQ KG  GE W GVRNYQARN MR+M VGD+GFFYHS   + +
Sbjct: 1   MRYWLFKSEPATWSWEDQQAKGEAGEEWDGVRNYQARNFMREMAVGDRGFFYHSQTEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T++    WECVDI AV  +   V+L  IKA PRL+ M L+  SRLS
Sbjct: 61  VGIVEVIAEAHPDSTSDD-PRWECVDIRAVAPVARAVTLDEIKAEPRLAEMALLRQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQP    E+  VC M  ++ 
Sbjct: 120 VQPEREAEWRIVCEMAGVAP 139


>gi|90421070|ref|ZP_01228973.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90334705|gb|EAS48482.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 145

 Score =  225 bits (575), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 81/140 (57%), Positives = 101/140 (72%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP +WS+  Q+  G  G+ W GVRNYQARN MR+M+VGD+GFFYHSN+G+ +
Sbjct: 1   MRYWLFKSEPFKWSFDHQKKAGDKGQEWDGVRNYQARNFMREMKVGDRGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD TA+    WECVDI AV  +P PV+L A+KA P L  M+L+ +SRLS
Sbjct: 61  VGIVEVIAEAHPDSTAKD-GKWECVDIKAVMDVPDPVTLDAVKAEPALKDMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV  DE+ +VC MG L  
Sbjct: 120 VQPVEPDEFRKVCEMGGLDP 139


>gi|49474783|ref|YP_032825.1| hypothetical protein BQ13020 [Bartonella quintana str. Toulouse]
 gi|49240287|emb|CAF26761.1| hypothetical protein BQ13020 [Bartonella quintana str. Toulouse]
          Length = 142

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 92/138 (66%), Positives = 103/138 (74%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ KG  GE W GVRNYQARNNMR M+ GDKGFFYHSNKG EI
Sbjct: 1   MAYWLFKSEPYKWSWNMQKQKGADGEQWDGVRNYQARNNMRAMKYGDKGFFYHSNKGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T      WECVDI A+  MP PVSL  IKANP+L +M+L+ +SRLS
Sbjct: 61  VGIVEVCAEVHPDSTTSD-PQWECVDIRALFDMPTPVSLKQIKANPKLKNMVLVNASRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+ EVC MG L
Sbjct: 120 VQPVTKDEWREVCLMGNL 137


>gi|83941987|ref|ZP_00954449.1| hypothetical protein EE36_07123 [Sulfitobacter sp. EE-36]
 gi|83847807|gb|EAP85682.1| hypothetical protein EE36_07123 [Sulfitobacter sp. EE-36]
          Length = 139

 Score =  225 bits (575), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 77/136 (56%), Positives = 90/136 (66%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M VGD GFFYHS   R I
Sbjct: 1   MAYWLFKSEPSTWGWPDQVAKGDAGEEWDGVRNYQARNFMREMAVGDLGFFYHSQGERAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD + E +  WECVDI AV     PV+L  IKA+ R   M L+ S RLS
Sbjct: 61  VGIVEVCAAAHPDSSTEDA-RWECVDIKAVRPFEKPVTLDDIKADGRFDDMPLVKSPRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           VQPVT++++  +C +G
Sbjct: 120 VQPVTSEQWSAICALG 135


>gi|118592014|ref|ZP_01549408.1| hypothetical protein SIAM614_25097 [Stappia aggregata IAM 12614]
 gi|118435310|gb|EAV41957.1| hypothetical protein SIAM614_25097 [Stappia aggregata IAM 12614]
          Length = 141

 Score =  225 bits (574), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 83/141 (58%), Positives = 101/141 (71%), Gaps = 1/141 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP +WSW+ Q+ +G  GE W G+RNYQARNNMR M +GDK FFYHSN G+E+
Sbjct: 1   MQYWLIKSEPDKWSWEQQKARGDKGEQWDGIRNYQARNNMRAMEIGDKAFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV +  +PD T +    WECVD  AVC MP PV+L  +KA PRL+ M L+ S RLS
Sbjct: 61  VGIVEVCSDIHPDTTIDD-PRWECVDFKAVCDMPKPVTLADVKAEPRLAKMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           VQPVT +E+  VC MG L  P
Sbjct: 120 VQPVTEEEWKIVCEMGGLKEP 140


>gi|307942597|ref|ZP_07657945.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307774236|gb|EFO33449.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 141

 Score =  225 bits (574), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 80/141 (56%), Positives = 98/141 (69%), Gaps = 1/141 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP +WSW+ Q+ KG  GE W G+RNYQARNNMR M +GDK FFYHSN G+EI
Sbjct: 1   MQYWLIKSEPDKWSWEQQKAKGEAGEEWDGIRNYQARNNMRAMEIGDKAFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV +  +PD T +    WECVD  AVC +P PV+L  +K  PRL+ M L+ S RLS
Sbjct: 61  VGIVEVCSEIHPDSTTDD-PRWECVDFKAVCDVPKPVTLADVKGEPRLADMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           VQPV  +E+  VC+M     P
Sbjct: 120 VQPVKKEEWDLVCQMAGFKEP 140


>gi|260575769|ref|ZP_05843765.1| protein of unknown function DUF55 [Rhodobacter sp. SW2]
 gi|259021922|gb|EEW25222.1| protein of unknown function DUF55 [Rhodobacter sp. SW2]
          Length = 139

 Score =  225 bits (574), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 76/139 (54%), Positives = 94/139 (67%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP  WSW  Q  KG  GE W GVRNYQARNNMR M++GD+GFFYHSN G+ +
Sbjct: 1   MRYWLFKSEPDTWSWDQQVAKGDAGEEWHGVRNYQARNNMRAMQIGDQGFFYHSNIGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD T +    W+CV I A+ ++P PVSL A K  P L +M+L+ +SRLS
Sbjct: 61  VGIVEVCRLSAPDSTTDD-PRWDCVHIRALRALPKPVSLDACKVQPGLEAMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT +E+  V  M  + 
Sbjct: 120 VQPVTPEEWRIVLGMAGID 138


>gi|218509366|ref|ZP_03507244.1| hypothetical protein RetlB5_18569 [Rhizobium etli Brasil 5]
          Length = 142

 Score =  225 bits (574), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 91/142 (64%), Positives = 104/142 (73%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VGDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD +A+    W+CVDI AV  MP PV+L  IKAN  LS M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSSAKGDPKWDCVDIRAVMDMPKPVTLKDIKANETLSKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|222150051|ref|YP_002551008.1| hypothetical protein Avi_4141 [Agrobacterium vitis S4]
 gi|221737033|gb|ACM37996.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 143

 Score =  224 bits (573), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 91/143 (63%), Positives = 109/143 (76%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP +WSW MQ+D G  G  WTGVRNY ARNNMR M+VGDKG FYHSN+G E+
Sbjct: 1   MAFWLYKSEPFKWSWAMQKDAGEAGTEWTGVRNYLARNNMRAMQVGDKGLFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE  + W+CVDI AV  MP PV+L  +KANP+L+ M L+ S RLS
Sbjct: 61  VGITEVCALSHPDSTAEGDARWDCVDIRAVRDMPKPVTLKDVKANPKLAQMALVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT +EY E+CRMG L NPP+
Sbjct: 121 VQPVTEEEYFEICRMGGLENPPV 143


>gi|126724564|ref|ZP_01740407.1| hypothetical protein RB2150_12051 [Rhodobacterales bacterium
           HTCC2150]
 gi|126705728|gb|EBA04818.1| hypothetical protein RB2150_12051 [Rhodobacterales bacterium
           HTCC2150]
          Length = 139

 Score =  224 bits (573), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 78/140 (55%), Positives = 98/140 (70%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  WSW  Q  KG +GE W GVRNYQARN MR+M +GD GFFYHS K + +
Sbjct: 1   MAYWLFKSEPDAWSWDKQVAKGDIGEEWDGVRNYQARNFMRQMAIGDLGFFYHSQKDKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +VI   +PD T +    WECVDI AV ++P PV+L  +K +PRL+ M L+ +SRLS
Sbjct: 61  VGIVQVIATAHPDSTTDDV-RWECVDIKAVKAVPKPVTLQMVKDDPRLAEMFLVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV  DE+  +C MG ++ 
Sbjct: 120 VQPVRDDEWAMICEMGGVAP 139


>gi|254472992|ref|ZP_05086390.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Pseudovibrio
           sp. JE062]
 gi|211957713|gb|EEA92915.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Pseudovibrio
           sp. JE062]
          Length = 142

 Score =  224 bits (573), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 77/143 (53%), Positives = 95/143 (66%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP++WSW  Q+ KG  GE W GVRNYQARN MR M++GD+GFFYHSN G+E+
Sbjct: 1   MQYWLFKSEPNKWSWDQQKAKGEEGEEWDGVRNYQARNFMRDMKIGDRGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  +P  V+L  +KA  RLS M L+ S RLS
Sbjct: 61  VGIVEVCALAHPDSTTDD-PRWECVDIKAVKDLPQTVTLAQVKAEERLSDMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPV  +E+  V  M  +    +
Sbjct: 120 VQPVKPEEWAVVLEMAGMDPSEV 142


>gi|315122379|ref|YP_004062868.1| hypothetical protein CKC_03155 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495781|gb|ADR52380.1| hypothetical protein CKC_03155 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 148

 Score =  224 bits (573), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 119/143 (83%), Positives = 126/143 (88%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  WSWKMQQDKG +GEAWTGVRNYQARNNMRKMR+GDKGFFYHSNKGREI
Sbjct: 1   MAYWLVKSEPCVWSWKMQQDKGSIGEAWTGVRNYQARNNMRKMRIGDKGFFYHSNKGREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGIFEVIT TYPDPT E  S WECVDI +VCSMPCPVSL+AIK N +LS M L+  SRLS
Sbjct: 61  VGIFEVITGTYPDPTVEGYSPWECVDIRSVCSMPCPVSLVAIKGNLQLSKMALVTFSRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPV  DEYLEVCRMGKLS+PPL
Sbjct: 121 VQPVKLDEYLEVCRMGKLSSPPL 143


>gi|260428915|ref|ZP_05782892.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260419538|gb|EEX12791.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 145

 Score =  224 bits (573), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 79/139 (56%), Positives = 97/139 (69%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEPS WSW+ Q  KG  GE WTGVRNYQARN MR+M +GD+GFFYHS K + I
Sbjct: 7   MKYWLFKSEPSAWSWEDQVAKGDAGEEWTGVRNYQARNFMREMALGDRGFFYHSLKEKAI 66

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EV   ++PD + +    WECVDI A+     PV+L  IKA+PRLS M+L+ +SRLS
Sbjct: 67  VGAVEVSAESHPDSSTDDD-RWECVDIRALAPARTPVTLDDIKADPRLSDMVLVKNSRLS 125

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE+  +C M  + 
Sbjct: 126 VQPVTEDEWHAICAMAGIE 144


>gi|148251905|ref|YP_001236490.1| hypothetical protein BBta_0291 [Bradyrhizobium sp. BTAi1]
 gi|146404078|gb|ABQ32584.1| hypothetical protein BBta_0291 [Bradyrhizobium sp. BTAi1]
          Length = 137

 Score =  224 bits (573), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 79/138 (57%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M+YWLVKSEPS WSW  Q +KG  GEAWTGVRNY AR N+  M+ G+  F+YHSN+G+EI
Sbjct: 1   MSYWLVKSEPSVWSWDQQVEKGAKGEAWTGVRNYTARQNLVAMKKGELAFYYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A      PV+L AIKA P+L+ M L+  SRLS
Sbjct: 61  VGIAEIIKEAYPDPT-DKTGKFVCVDIKAHKPFKTPVTLAAIKAEPKLAEMALVKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG +
Sbjct: 120 VQPVTPEEWKLVCKMGGV 137


>gi|15966828|ref|NP_387181.1| hypothetical protein SMc03227 [Sinorhizobium meliloti 1021]
 gi|307301656|ref|ZP_07581415.1| protein of unknown function DUF55 [Sinorhizobium meliloti BL225C]
 gi|307316320|ref|ZP_07595764.1| protein of unknown function DUF55 [Sinorhizobium meliloti AK83]
 gi|15076100|emb|CAC47654.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306898160|gb|EFN28902.1| protein of unknown function DUF55 [Sinorhizobium meliloti AK83]
 gi|306903354|gb|EFN33943.1| protein of unknown function DUF55 [Sinorhizobium meliloti BL225C]
          Length = 143

 Score =  224 bits (572), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 93/142 (65%), Positives = 111/142 (78%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP++WSW+MQ+D G  G  WTGVRNY ARNNMR M++GDKGFFYHSN+G EI
Sbjct: 1   MAFWLYKSEPAKWSWQMQKDAGEKGTEWTGVRNYLARNNMRAMKIGDKGFFYHSNEGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE  + W+CVDI AV  +P PVSL  IK NP+L+ M L+ S RLS
Sbjct: 61  VGITEVCALSHPDSTAEGDARWDCVDIRAVMDIPRPVSLKEIKENPKLAKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE++EVCRMG L NPP
Sbjct: 121 VQPVTDDEWIEVCRMGGLDNPP 142


>gi|239833015|ref|ZP_04681344.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239825282|gb|EEQ96850.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 144

 Score =  224 bits (572), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 87/140 (62%), Positives = 102/140 (72%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW MQ+ +G  GE W GVRNY ARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWDMQKARGEKGEQWDGVRNYLARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    + D T +    WECVDI AV  MP PV+L  +KANP+L  M L+ S RLS
Sbjct: 61  VGIVEVCALAHHDSTTDD-PRWECVDIRAVRDMPKPVTLKDVKANPKLEKMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT DE++EVCRMG L  
Sbjct: 120 VQPVTEDEWIEVCRMGGLDR 139


>gi|146337461|ref|YP_001202509.1| hypothetical protein BRADO0304 [Bradyrhizobium sp. ORS278]
 gi|146190267|emb|CAL74261.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 137

 Score =  224 bits (571), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 78/138 (56%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M+YWLVKSEPS WSW  Q +KG  GEAWTGVRNY AR N+  M+ G+  F+YHSN+G+ I
Sbjct: 1   MSYWLVKSEPSVWSWDQQVEKGAKGEAWTGVRNYTARQNLVAMKQGELAFYYHSNEGKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A  +   PV+L AIKA P+L+ M L+  SRLS
Sbjct: 61  VGIAEIIKEAYPDPT-DKTEKFVCVDIKAHKAFKTPVTLAAIKAEPKLAEMALVKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG +
Sbjct: 120 VQPVTPEEWKLVCKMGGV 137


>gi|15889904|ref|NP_355585.1| hypothetical protein Atu2648 [Agrobacterium tumefaciens str. C58]
 gi|15157855|gb|AAK88370.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 147

 Score =  224 bits (571), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 95/141 (67%), Positives = 111/141 (78%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
            YWL KSEP +WSW+MQ+ KG  GE WTGVRNYQARNNMR M++GDKGFFYHSN+G ++V
Sbjct: 3   NYWLYKSEPFKWSWEMQKAKGETGEEWTGVRNYQARNNMRAMKIGDKGFFYHSNEGLDVV 62

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI EV   ++PD TAE    W+CVDI AVC MP PVSL  +KANP+L  M L+ S RLSV
Sbjct: 63  GIVEVCALSHPDSTAEGDLKWDCVDIRAVCDMPQPVSLKDVKANPKLEKMSLVTSMRLSV 122

Query: 122 QPVTTDEYLEVCRMGKLSNPP 142
           QPVT +EYLEVCRMG L+NPP
Sbjct: 123 QPVTEEEYLEVCRMGGLANPP 143


>gi|325294017|ref|YP_004279881.1| hypothetical protein AGROH133_08872 [Agrobacterium sp. H13-3]
 gi|325061870|gb|ADY65561.1| hypothetical protein AGROH133_08872 [Agrobacterium sp. H13-3]
          Length = 147

 Score =  224 bits (571), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 96/141 (68%), Positives = 111/141 (78%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
            YWL KSEP +WSW+MQ+ KG  GE WTGVRNYQARNNMR M++GDKGFFYHSN+G ++V
Sbjct: 3   NYWLYKSEPFKWSWEMQKAKGEAGEEWTGVRNYQARNNMRAMKIGDKGFFYHSNEGLDVV 62

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI EV   ++PD TAE    W+CVDI AVC MP PVSL  +KANP+L  M L+ S RLSV
Sbjct: 63  GIVEVCALSHPDSTAEGDLKWDCVDIRAVCDMPKPVSLKDVKANPKLEKMSLVTSMRLSV 122

Query: 122 QPVTTDEYLEVCRMGKLSNPP 142
           QPVT +EYLEVCRMG LSNPP
Sbjct: 123 QPVTEEEYLEVCRMGGLSNPP 143


>gi|87303869|ref|ZP_01086563.1| hypothetical protein WH5701_00090 [Synechococcus sp. WH 5701]
 gi|87281630|gb|EAQ73633.1| hypothetical protein WH5701_00090 [Synechococcus sp. WH 5701]
          Length = 139

 Score =  224 bits (571), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL KSEPS W W  Q  KG  GE W GVRNYQARN MR+M VGD+GFFYHS K + +
Sbjct: 1   MRHWLFKSEPSVWGWSDQVAKGDAGEEWNGVRNYQARNFMREMAVGDRGFFYHSQKEKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EVI   +PD T +    WECVDI A+     PV+L  IKA+PRLS M+L+ +SRLS
Sbjct: 61  VGTVEVIAEAHPDSTTDD-PRWECVDIKALEVARGPVTLEMIKADPRLSEMVLVRNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT +E+  VC M  +S 
Sbjct: 120 VQPVTAEEWRIVCEMAGVSG 139


>gi|304320334|ref|YP_003853977.1| hypothetical protein PB2503_03802 [Parvularcula bermudensis
           HTCC2503]
 gi|303299236|gb|ADM08835.1| hypothetical protein PB2503_03802 [Parvularcula bermudensis
           HTCC2503]
          Length = 140

 Score =  223 bits (570), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 78/137 (56%), Positives = 99/137 (72%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+KSEPS WSW+ Q  KG  GE W GVRN+QA+N M++M+ GD  FFYHS K REI
Sbjct: 1   MAYWLMKSEPSTWSWQDQLAKGEAGEPWDGVRNHQAKNYMQEMKKGDLAFFYHSQKDREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I    PDPTA   S WECV I A  ++  PV+L  IK  P L+ M+L+ +SRLS
Sbjct: 61  VGIVEIIEEAMPDPTAAPDSPWECVTIAARETLDAPVTLAQIKDTPDLAEMVLVKNSRLS 120

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT+D++  +C+MG+
Sbjct: 121 VQPVTSDQWALICKMGQ 137


>gi|153008306|ref|YP_001369521.1| hypothetical protein Oant_0971 [Ochrobactrum anthropi ATCC 49188]
 gi|151560194|gb|ABS13692.1| protein of unknown function DUF55 [Ochrobactrum anthropi ATCC
           49188]
          Length = 144

 Score =  223 bits (569), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 87/139 (62%), Positives = 103/139 (74%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP +WSW+MQ+ +G  GE W GVRNY ARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAYWLFKSEPFKWSWEMQKARGEKGEQWDGVRNYLARNNMRAMKLGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    + D T +    WECVDI AV  MP PV+L  +KANP+L  M L+ S RLS
Sbjct: 61  VGIVEVCALAHHDSTTDD-PRWECVDIRAVRDMPKPVTLKDVKANPKLEKMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT DE++EVCRMG L 
Sbjct: 120 VQPVTEDEWIEVCRMGGLD 138


>gi|84684553|ref|ZP_01012454.1| hypothetical protein 1099457000260_RB2654_13049 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667532|gb|EAQ14001.1| hypothetical protein RB2654_13049 [Rhodobacterales bacterium
           HTCC2654]
          Length = 137

 Score =  222 bits (567), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 72/137 (52%), Positives = 90/137 (65%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP+ W W  Q  KG  GE W GVRNYQARNNMR+M++GD GFFYHS   + +
Sbjct: 1   MRYWLFKSEPNAWGWDDQVAKGEAGEEWDGVRNYQARNNMREMKLGDLGFFYHSVDEKRV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV    +PD T +    WECVDI AV  +  PV+L   K +PRL+ M+L+ ++RLS
Sbjct: 61  VGIVEVCKEIHPDSTTDD-PRWECVDIKAVRPVKKPVTLDMCKNDPRLADMVLVNNTRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT  E+  V  +  
Sbjct: 120 VQPVTEAEWNVVLELAG 136


>gi|294679021|ref|YP_003579636.1| hypothetical protein RCAP_rcc03505 [Rhodobacter capsulatus SB 1003]
 gi|294477841|gb|ADE87229.1| protein of unknown function DUF55 [Rhodobacter capsulatus SB 1003]
          Length = 139

 Score =  222 bits (566), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 79/140 (56%), Positives = 99/140 (70%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA WL KSEP  WSW MQ  KG  GE W GVRNY ARNNMR M++GD+GFFYHSN G+E+
Sbjct: 1   MAKWLFKSEPDVWSWDMQVAKGAEGEEWHGVRNYLARNNMRAMQLGDQGFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD T E    W+CVDI A+  +  PV+L  +KA+PRL+ M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSTTED-PRWDCVDIRALRPLARPVTLATVKADPRLAQMALVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT +E+  VC +G ++ 
Sbjct: 120 VQPVTEEEWKIVCELGGVAP 139


>gi|85713689|ref|ZP_01044679.1| hypothetical protein NB311A_04094 [Nitrobacter sp. Nb-311A]
 gi|85699593|gb|EAQ37460.1| hypothetical protein NB311A_04094 [Nitrobacter sp. Nb-311A]
          Length = 137

 Score =  221 bits (564), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 78/138 (56%), Positives = 99/138 (71%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW+ Q  KG  GE WTGVRN+ AR N+  M+ GD  FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSAWSWEQQVAKGAKGEPWTGVRNFTARQNLAAMKKGDLAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A   +  PV++ A+KA+ RL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DKTGKFVCVDIKANKPLKTPVTIAAVKADERLADMALVKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  +C+MG L
Sbjct: 120 VQPVTPAEWKLICKMGGL 137


>gi|91974952|ref|YP_567611.1| hypothetical protein RPD_0472 [Rhodopseudomonas palustris BisB5]
 gi|91681408|gb|ABE37710.1| protein of unknown function DUF589 [Rhodopseudomonas palustris
           BisB5]
          Length = 137

 Score =  221 bits (564), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 80/138 (57%), Positives = 102/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  M+ GD+ FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           +GI E+I   YPDPT ++S  + CVD+ A   +  PV+L+A+KA PRL+ M L+  SRLS
Sbjct: 61  IGIAEIIREAYPDPT-DESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+  +C+MG L
Sbjct: 120 VQPVTADEWKLICKMGGL 137


>gi|114705605|ref|ZP_01438508.1| hypothetical protein FP2506_14104 [Fulvimarina pelagi HTCC2506]
 gi|114538451|gb|EAU41572.1| hypothetical protein FP2506_14104 [Fulvimarina pelagi HTCC2506]
          Length = 145

 Score =  220 bits (563), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 79/139 (56%), Positives = 102/139 (73%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP +WS++ Q++KG  G+ W GVRNYQARN MR+M+VGD+GFFYHSN+G+E+
Sbjct: 1   MRYWLFKSEPFKWSFEQQKEKGEAGQEWDGVRNYQARNFMREMKVGDRGFFYHSNEGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV+   +PD + + S  WECVDI AV  +P PVSL  +K  PRL  M+L+ +SRLS
Sbjct: 61  VGIVEVVAEAHPD-SKDNSGKWECVDIKAVMDVPNPVSLDQVKDEPRLKDMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPV   E+  VC MG + 
Sbjct: 120 VQPVEEAEFKLVCEMGGVD 138


>gi|86359481|ref|YP_471373.1| hypothetical protein RHE_CH03900 [Rhizobium etli CFN 42]
 gi|86283583|gb|ABC92646.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 143

 Score =  220 bits (563), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 89/142 (62%), Positives = 105/142 (73%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VG+KGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGEKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TA+    W+CVDI AV  MP PV+L  +KAN +L+ M L+ S RLS
Sbjct: 61  VGIVEVAALSHPDSTAKGDPKWDCVDIRAVMDMPKPVTLKDVKANAKLAKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|116254220|ref|YP_770058.1| hypothetical protein RL4491 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|241206700|ref|YP_002977796.1| hypothetical protein Rleg_4016 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|115258868|emb|CAK09976.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|240860590|gb|ACS58257.1| protein of unknown function DUF55 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 143

 Score =  220 bits (562), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 87/142 (61%), Positives = 106/142 (74%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M++GDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGEKGTEWTGVRNYLARNNMRAMQIGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD +A+    W+CVDI AV  +P PV+L  +KA+ +L+ M L+ S RLS
Sbjct: 61  VGIVEVCALSHPDSSAKGDPKWDCVDIRAVMDVPKPVTLKDVKASEKLAKMALVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT +EYLEVCRMG L NPP
Sbjct: 121 VQPVTEEEYLEVCRMGGLDNPP 142


>gi|150398159|ref|YP_001328626.1| hypothetical protein Smed_2962 [Sinorhizobium medicae WSM419]
 gi|150029674|gb|ABR61791.1| protein of unknown function DUF55 [Sinorhizobium medicae WSM419]
          Length = 143

 Score =  220 bits (561), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 91/142 (64%), Positives = 110/142 (77%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP++WSW+MQ+D G  G  WTGVRNY ARNNMR M++GDKGFFYHSN+G E+
Sbjct: 1   MAFWLYKSEPAKWSWQMQKDAGEKGTEWTGVRNYLARNNMRAMKIGDKGFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE  + W+CVDI AV  MP PV+L  IK NPRL++M L+ S RLS
Sbjct: 61  VGITEVCALSHPDTTAEGDARWDCVDIRAVMDMPRPVTLKEIKENPRLATMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE++EVCRMG L   P
Sbjct: 121 VQPVTEDEWVEVCRMGGLDTSP 142


>gi|312116198|ref|YP_004013794.1| hypothetical protein Rvan_3515 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311221327|gb|ADP72695.1| protein of unknown function DUF55 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 141

 Score =  219 bits (560), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 71/141 (50%), Positives = 89/141 (63%), Gaps = 1/141 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL K+EP  +SW  Q   G  GE W+GVRN  A+ NMR M+ GD GFFYHS   + I
Sbjct: 1   MAYWLFKTEPGTFSWDDQLKAGGKGEEWSGVRNALAQKNMRAMKKGDLGFFYHSVNEKRI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+  V+   +PD T + +  W CVD+ AV   P PV+L  IK  P+L+ M L+  SRLS
Sbjct: 61  VGVVRVLNEIHPDST-DPTGRWNCVDVEAVAPFPEPVTLAEIKGEPQLADMALVKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           VQPVT +E+  VCRMG    P
Sbjct: 120 VQPVTAEEWDIVCRMGGYKPP 140


>gi|27375680|ref|NP_767209.1| hypothetical protein blr0569 [Bradyrhizobium japonicum USDA 110]
 gi|27348818|dbj|BAC45834.1| blr0569 [Bradyrhizobium japonicum USDA 110]
          Length = 148

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 79/138 (57%), Positives = 99/138 (71%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEPS WSW  Q  KG  GEAWTGVRNY AR N+  M+ GDK FFYHSN+G+EI
Sbjct: 12  MNYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNYTARQNLVAMKKGDKAFFYHSNEGKEI 71

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++   YPDPT +++  + CVDI A   +  PV++ AIKA  +L+ M L+  SRLS
Sbjct: 72  VGIAEIVKEAYPDPT-DKTEKFVCVDIKADKPLKTPVTMAAIKAEKKLADMALVKYSRLS 130

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG +
Sbjct: 131 VQPVTAEEWKLVCKMGGM 148


>gi|86747443|ref|YP_483939.1| hypothetical protein RPB_0317 [Rhodopseudomonas palustris HaA2]
 gi|86570471|gb|ABD05028.1| Protein of unknown function DUF589 [Rhodopseudomonas palustris
           HaA2]
          Length = 137

 Score =  219 bits (559), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 80/138 (57%), Positives = 99/138 (71%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  M+ GD+ FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMMAMKKGDRAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT ++S  + CVD+ A   +  PV+L A+K   +LS M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DESGKFVCVDLKADKKLKTPVTLAAVKEEKKLSEMALLKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+  VC+MG L
Sbjct: 120 VQPVTADEWKLVCKMGGL 137


>gi|300024954|ref|YP_003757565.1| hypothetical protein Hden_3453 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526775|gb|ADJ25244.1| protein of unknown function DUF55 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 145

 Score =  219 bits (558), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 80/142 (56%), Positives = 104/142 (73%), Gaps = 1/142 (0%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           AYWL+KSEP  +SW     +G  GE+W GVRNYQARNNMR M+VGD GFFYHSN+G+ +V
Sbjct: 3   AYWLLKSEPDAFSWDELVSRGAKGESWDGVRNYQARNNMRAMKVGDLGFFYHSNEGKNVV 62

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI  +I   +P+   +++  WECVD+ AV  +P PV+L AIKANP+L  M+L+ +SRLSV
Sbjct: 63  GICRIIALAHPEAK-DETGKWECVDVAAVAPVPNPVTLEAIKANPKLDGMVLVNNSRLSV 121

Query: 122 QPVTTDEYLEVCRMGKLSNPPL 143
           QPV+ DE+ EVCRMG +    L
Sbjct: 122 QPVSADEWKEVCRMGGVEQRKL 143


>gi|115522097|ref|YP_779008.1| hypothetical protein RPE_0067 [Rhodopseudomonas palustris BisA53]
 gi|115516044|gb|ABJ04028.1| protein of unknown function DUF55 [Rhodopseudomonas palustris
           BisA53]
          Length = 137

 Score =  218 bits (557), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 78/138 (56%), Positives = 99/138 (71%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ NM KM+ GD  F+YHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHTAKLNMMKMKKGDLAFYYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDP  ++S  + CVD+ A   +  PV+L+A+KA P L+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDP-GDESGKFVCVDLKASKPLKTPVTLIAVKAEPALAEMALLKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  +C+MG +
Sbjct: 120 VQPVTAAEWKLICKMGGV 137


>gi|218528774|ref|YP_002419590.1| hypothetical protein Mchl_0742 [Methylobacterium chloromethanicum
           CM4]
 gi|218521077|gb|ACK81662.1| protein of unknown function DUF55 [Methylobacterium
           chloromethanicum CM4]
          Length = 140

 Score =  218 bits (556), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 75/137 (54%), Positives = 93/137 (67%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q + G  G  W GVRN+ A+  M+ M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPSTWSWDQQVEAGEGGTFWNGVRNHLAKKQMQAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VD+ AV  MP PV+L AIKA   L  M L+ +SRLS
Sbjct: 61  VGIVEVIKPYYPDHT-DESGRFGMVDVRAVAPMPRPVTLDAIKATTALKDMALVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT  E+  VC MG 
Sbjct: 120 VQPVTEAEWATVCAMGG 136


>gi|92116180|ref|YP_575909.1| hypothetical protein Nham_0559 [Nitrobacter hamburgensis X14]
 gi|91799074|gb|ABE61449.1| protein of unknown function DUF589 [Nitrobacter hamburgensis X14]
          Length = 137

 Score =  217 bits (555), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 80/138 (57%), Positives = 101/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW+ Q  KG  GEAWTGVRN+ AR N+  M+ GD+ FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSAWSWQQQVAKGAKGEAWTGVRNFTARQNLVAMKKGDQAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A   +  PV++ A+KA+ RL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DKTGRFVCVDIKADKPLKTPVTIAAVKADKRLADMALVKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  VC+MG L
Sbjct: 120 VQPVTPAEWKMVCKMGGL 137


>gi|90421572|ref|YP_529942.1| hypothetical protein RPC_0044 [Rhodopseudomonas palustris BisB18]
 gi|90103586|gb|ABD85623.1| protein of unknown function DUF589 [Rhodopseudomonas palustris
           BisB18]
          Length = 137

 Score =  217 bits (555), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 79/138 (57%), Positives = 102/138 (73%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEPS WSW+ Q  KG  GEAWTGVRN+ A+ +M KM+ GD+ F+YHSN+G++I
Sbjct: 1   MAFWLVKSEPSTWSWEQQVAKGAKGEAWTGVRNHSAKLHMMKMKKGDRAFYYHSNEGKQI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT + S  + CVDI A+  +  PV+L+AIKA   L+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DDSGKFVCVDIKALTPLKTPVTLVAIKAEKSLAEMALLKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT DE+  VC+MG +
Sbjct: 120 VQPVTADEWKIVCKMGGV 137


>gi|316931773|ref|YP_004106755.1| hypothetical protein Rpdx1_0381 [Rhodopseudomonas palustris DX-1]
 gi|315599487|gb|ADU42022.1| protein of unknown function DUF55 [Rhodopseudomonas palustris DX-1]
          Length = 137

 Score =  217 bits (555), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 82/138 (59%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  MR GD+ F+YHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFYYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT + S  + CVDI A   +  PV+L A+KA PRL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DASGKFVCVDIKADKPLKTPVTLAAVKAEPRLAEMALLKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG L
Sbjct: 120 VQPVTAEEWKLVCKMGGL 137


>gi|192288685|ref|YP_001989290.1| hypothetical protein Rpal_0254 [Rhodopseudomonas palustris TIE-1]
 gi|192282434|gb|ACE98814.1| protein of unknown function DUF55 [Rhodopseudomonas palustris
           TIE-1]
          Length = 137

 Score =  217 bits (554), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 83/138 (60%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  MR GD+ FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT + S  + CVDI A   +  PV+L A+KA PRL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DASGKFVCVDIKADKPLKSPVTLAAVKAEPRLAEMALMKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG L
Sbjct: 120 VQPVTAEEWKLVCKMGGL 137


>gi|170748166|ref|YP_001754426.1| hypothetical protein Mrad2831_1748 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654688|gb|ACB23743.1| protein of unknown function DUF55 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 138

 Score =  217 bits (554), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 96/139 (69%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ WSW  Q   G  G  W GVRN+ A+  +  M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPATWSWDQQVAAGEAGTYWNGVRNHLAKKQLMAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI  VI   YPD T +++  +  VD+ AV +MP PV+L AIKA+P L+ M+L+ +SRLS
Sbjct: 61  VGIVAVIRAYYPDHT-DETGRFGMVDVKAVRAMPSPVTLEAIKADPALADMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT  E+  VC +G L 
Sbjct: 120 VQPVTEAEWARVCALGGLG 138


>gi|95928813|ref|ZP_01311559.1| protein of unknown function DUF589 [Desulfuromonas acetoxidans DSM
           684]
 gi|95135158|gb|EAT16811.1| protein of unknown function DUF589 [Desulfuromonas acetoxidans DSM
           684]
          Length = 154

 Score =  217 bits (554), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 60/151 (39%), Positives = 77/151 (50%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNK-GR 58
           M YWL+KSEP  +     Q      E W GVRNYQARN MR  M++GD  FFYHSN    
Sbjct: 1   MNYWLMKSEPEAFGIDDLQQMPEQTEHWDGVRNYQARNMMRDDMKIGDLAFFYHSNCAEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+   YPD TA                  W  VDI  V  +  P++L  +K  
Sbjct: 61  GIVGIMEVVKEGYPDFTAFDPNSKYFDAKSVGDKPRWFMVDIRYVRHLKRPIALKELKEY 120

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRM 135
           P+L  M IL   +RLS+ PV+ + +  +  +
Sbjct: 121 PQLDGMQILRKGNRLSITPVSKEHWDFIVGL 151


>gi|21328629|gb|AAM48635.1| conserved hypothetical protein [uncultured marine proteobacterium]
          Length = 136

 Score =  217 bits (554), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 74/137 (54%), Positives = 93/137 (67%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP+ WSW  QQ KG VGE W GVRNYQARNNMR M++GD+ FFYHS   + I
Sbjct: 1   MAYWLFKSEPATWSWADQQAKGAVGEEWDGVRNYQARNNMRAMQLGDQAFFYHSQSEKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++ D T E    WECVDI A+ S+  PV+L   KA+ RL+ M L+  +RLS
Sbjct: 61  VGIVEVCALSHQDSTTED-PRWECVDIRAIRSLTKPVTLHMCKADHRLADMALVKYTRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPV  +E+  +  + +
Sbjct: 120 VQPVRAEEWGIILELSR 136


>gi|163850169|ref|YP_001638212.1| hypothetical protein Mext_0729 [Methylobacterium extorquens PA1]
 gi|240137302|ref|YP_002961771.1| hypothetical protein MexAM1_META1p0555 [Methylobacterium extorquens
           AM1]
 gi|163661774|gb|ABY29141.1| protein of unknown function DUF55 [Methylobacterium extorquens PA1]
 gi|240007268|gb|ACS38494.1| conserved hypothetical protein (DUF589) [Methylobacterium
           extorquens AM1]
          Length = 140

 Score =  217 bits (554), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 75/137 (54%), Positives = 93/137 (67%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q + G  G  W GVRN+ A+  M+ M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPSTWSWDQQVEAGEGGTFWNGVRNHLAKKQMQAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VD+ AV  MP PV+L AIKA   L  M L+ +SRLS
Sbjct: 61  VGIVEVIKPYYPDHT-DESGRFGMVDVRAVAPMPRPVTLDAIKAATALKDMALVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT  E+  VC MG 
Sbjct: 120 VQPVTEAEWATVCAMGG 136


>gi|209551267|ref|YP_002283184.1| hypothetical protein Rleg2_3695 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537023|gb|ACI56958.1| protein of unknown function DUF55 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 143

 Score =  217 bits (554), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 87/142 (61%), Positives = 103/142 (72%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M++GDKGFFYHSN G EI
Sbjct: 1   MAHWLYKSEPASWSWEQQKAAGEKGTEWTGVRNYLARNNMRAMQLGDKGFFYHSNDGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD TA+    W+CV I AV  MP PV+L  +KA+ +L+ M L+ S RLS
Sbjct: 61  VGIVEVSALSQPDSTAKGDPKWDCVHIRAVMDMPKPVTLKDVKASEKLAKMSLVTSMRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT DE+ EVCRMG L NPP
Sbjct: 121 VQPVTDDEWAEVCRMGGLDNPP 142


>gi|114321684|ref|YP_743367.1| hypothetical protein Mlg_2537 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228078|gb|ABI57877.1| protein of unknown function DUF55 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 158

 Score =  217 bits (553), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 61/156 (39%), Positives = 81/156 (51%), Gaps = 16/156 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+  +  + +    E W GVRNYQARN MR +M+VGD  FFYHSN K  
Sbjct: 1   MNYWLMKSEPDEFGIEDLKQRPDQIEPWDGVRNYQARNMMRDQMKVGDLAFFYHSNTKPP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI E++   YPDPT                   W  VD+     +P  V+L  +K  
Sbjct: 61  GIVGIVEIVREGYPDPTQFDPDDKHYDPKSDPEKPRWYLVDVKFKAILPRKVTLHELKRQ 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLSN 140
           P+L  M L+   +RLSV PV  D +  +  + +   
Sbjct: 121 PQLEGMKLLARGNRLSVMPVEPDHWAHIIALAEQDP 156


>gi|39933330|ref|NP_945606.1| hypothetical protein RPA0253 [Rhodopseudomonas palustris CGA009]
 gi|39652955|emb|CAE25697.1| DUF589 [Rhodopseudomonas palustris CGA009]
          Length = 137

 Score =  216 bits (552), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 82/138 (59%), Positives = 100/138 (72%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  MR GD+ F+YHSN+G+EI
Sbjct: 1   MAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFYYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT + S  + CVDI A   +  PV+L A+KA PRL+ M L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DASGKFVCVDIKADKPLKTPVTLAAVKAEPRLADMALMKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  VC+MG L
Sbjct: 120 VQPVTAEEWKLVCKMGGL 137


>gi|254559407|ref|YP_003066502.1| hypothetical protein METDI0831 [Methylobacterium extorquens DM4]
 gi|254266685|emb|CAX22465.1| conserved hypothethical protein (DUF589) [Methylobacterium
           extorquens DM4]
          Length = 140

 Score =  216 bits (552), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 76/137 (55%), Positives = 93/137 (67%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q + G  G  W GVRN+ A+  M+ M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPSTWSWDQQVEAGEGGTFWNGVRNHLAKKQMQAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VD+ AV  MP PVSL AIKA   L  M L+ +SRLS
Sbjct: 61  VGIVEVIKPYYPDHT-DESGRFGMVDVRAVAPMPRPVSLDAIKAATALKDMALVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT  E+  VC MG 
Sbjct: 120 VQPVTEAEWATVCAMGG 136


>gi|188579970|ref|YP_001923415.1| hypothetical protein Mpop_0702 [Methylobacterium populi BJ001]
 gi|179343468|gb|ACB78880.1| protein of unknown function DUF55 [Methylobacterium populi BJ001]
          Length = 139

 Score =  216 bits (552), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 92/140 (65%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q + G  G  W GVRN+ A+  M+ M+VG++GFFYHSN+G+ +
Sbjct: 1   MAYWLFKSEPSTWSWDQQVEAGEGGTFWNGVRNHLAKKQMQAMQVGERGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VD+ AV  MP PV L AIKA   L  M L+ +SRLS
Sbjct: 61  VGIVEVIKPYYPDHT-DESGRFGMVDLRAVAPMPRPVGLDAIKAEAALKDMALVTNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT  E+  +C MG    
Sbjct: 120 VQPVTEAEWARICAMGGYEG 139


>gi|75674666|ref|YP_317087.1| hypothetical protein Nwi_0468 [Nitrobacter winogradskyi Nb-255]
 gi|74419536|gb|ABA03735.1| Protein of unknown function DUF589 [Nitrobacter winogradskyi
           Nb-255]
          Length = 137

 Score =  216 bits (552), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 78/138 (56%), Positives = 98/138 (71%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW+ Q  KG  GE WTGVRN+ AR N+  M+ GD  FFYHSN+G+EI
Sbjct: 1   MAYWLVKSEPSAWSWEQQVAKGAKGEPWTGVRNFTARQNLNAMKKGDLAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDPT +++  + CVDI A   +  PV++ A+KA+ RL+ + L+  SRLS
Sbjct: 61  VGIAEIIREAYPDPT-DKTGRFVCVDIKASKPLKTPVTIAAVKADRRLADIALVKYSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  VC MG L
Sbjct: 120 VQPVTPAEWKLVCEMGGL 137


>gi|114799058|ref|YP_759218.1| hypothetical protein HNE_0488 [Hyphomonas neptunium ATCC 15444]
 gi|114739232|gb|ABI77357.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 145

 Score =  215 bits (549), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 81/143 (56%), Positives = 101/143 (70%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  WSW+ Q  KG  GE W+GVRNY ARN+MR+M++GD+ FFYHSN G EI
Sbjct: 1   MQYWLMKSEPDAWSWEQQVKKGEAGEIWSGVRNYTARNHMREMKLGDRVFFYHSNIGLEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV   + PDPT + +  W+CV I A+  MP PV+L A K NP+L+ M L+ S RLS
Sbjct: 61  VGVCEVCELSKPDPTTDDA-RWDCVTIRALAPMPKPVTLKAAKENPKLAEMSLVSSFRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPVT  E+ EVCRMG +    L
Sbjct: 120 VQPVTAAEWKEVCRMGGMDPKTL 142


>gi|296533505|ref|ZP_06896080.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Roseomonas cervicalis
           ATCC 49957]
 gi|296266180|gb|EFH12230.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Roseomonas cervicalis
           ATCC 49957]
          Length = 137

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 77/140 (55%), Positives = 95/140 (67%), Gaps = 3/140 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW+ Q + G   E WTGVRN QA  N+R MR+GD+ FFYHSN G+EI
Sbjct: 1   MAYWLVKSEPDAFSWQQQVENG--VEPWTGVRNAQAAKNLRAMRLGDRAFFYHSNVGKEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV    YPDPT E+S  W CVD+ AV  MP PV+L  IK  P L+ + LI  SRLS
Sbjct: 59  VGVVEVAREAYPDPT-EESGRWACVDMRAVGPMPRPVTLAEIKTVPELAGIGLIRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           V PV+ + +  +CRMG  + 
Sbjct: 118 VMPVSDEHWALLCRMGGFAG 137


>gi|78356404|ref|YP_387853.1| hypothetical protein Dde_1357 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218809|gb|ABB38158.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 155

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 59/155 (38%), Positives = 80/155 (51%), Gaps = 15/155 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M YWL+KSEP  +S +   +       W GVRNYQARN MR  MR GDK  FYHS K   
Sbjct: 1   MRYWLMKSEPECFSLEDLVNAPEQTTPWDGVRNYQARNFMRDEMRPGDKVLFYHSGKNPA 60

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+ EV    YPD TA              ++  W  VD+  + +   P+ L  +K  P
Sbjct: 61  IAGLAEVSREAYPDHTAWDPENNHFDPRSTPEAPRWFMVDVKYIRTFSSPLPLAYLKTVP 120

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRMGKLSN 140
            L  M L+   +RLSVQPVT +E+  +  + ++ +
Sbjct: 121 ELQDMALLRKGNRLSVQPVTENEFNVIMTLAEMKS 155


>gi|220921144|ref|YP_002496445.1| hypothetical protein Mnod_1136 [Methylobacterium nodulans ORS 2060]
 gi|219945750|gb|ACL56142.1| protein of unknown function DUF55 [Methylobacterium nodulans ORS
           2060]
          Length = 137

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 71/138 (51%), Positives = 95/138 (68%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEPS WSW  Q   G  G  W GVRN+ A+ +++ M+ G++GFFYHSN+G+ +
Sbjct: 1   MAHWLFKSEPSTWSWDQQVAAGEAGTFWNGVRNHLAKKHLQAMQRGEQGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPD T ++S  +  VDI AV  +P PV+L AIKA PRL  M+L+ ++RLS
Sbjct: 61  VGIVEVIRTYYPDHT-DESGRFGMVDIKAVTGLPRPVTLDAIKAEPRLKDMVLVNNARLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT  E+  +  MG +
Sbjct: 120 VQPVTEAEWAVIRAMGGV 137


>gi|58040086|ref|YP_192050.1| hypothetical protein GOX1653 [Gluconobacter oxydans 621H]
 gi|58002500|gb|AAW61394.1| Hypothetical protein GOX1653 [Gluconobacter oxydans 621H]
          Length = 138

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 73/141 (51%), Positives = 91/141 (64%), Gaps = 3/141 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEP  +SW  Q D G   E WTGVRNYQARNN+  M+ GD   FYHS   + I
Sbjct: 1   MAFWLVKSEPEAFSWAQQLDHG--VEPWTGVRNYQARNNLSAMKNGDLALFYHSVSEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE    W CVD+ A+ +   PVSL  IKA+P L+ M L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTAED-PRWVCVDVKAMGAFAHPVSLADIKADPALAEMALLKQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           V PVT  E+  + ++G  + P
Sbjct: 118 VAPVTETEFRHLTQIGGWTRP 138


>gi|148265469|ref|YP_001232175.1| hypothetical protein Gura_3446 [Geobacter uraniireducens Rf4]
 gi|146398969|gb|ABQ27602.1| protein of unknown function DUF55 [Geobacter uraniireducens Rf4]
          Length = 156

 Score =  214 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 66/155 (42%), Positives = 88/155 (56%), Gaps = 15/155 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL KSEP  +S +  + +  + E W GVRNYQARN +R  ++ GD   FYHSN    
Sbjct: 1   MAYWLFKSEPGSFSIEDLRHRPGMTEHWDGVRNYQARNYLRDAVKPGDLVLFYHSNIPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI EV+   YPD TA                  W  VD+  V +MP PV L  IK N
Sbjct: 61  AVVGIAEVVRGGYPDYTAFNPGSEHFDPKSSPVSPIWYMVDVRYVAAMPRPVPLEQIKGN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
           P L++M L+  SRLS+QPVT +E+  +  MG +++
Sbjct: 121 PLLAAMPLVKRSRLSIQPVTPEEWRTILAMGGMTD 155


>gi|162149206|ref|YP_001603667.1| hypothetical protein GDI_3436 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545054|ref|YP_002277283.1| hypothetical protein Gdia_2937 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787783|emb|CAP57379.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209532731|gb|ACI52668.1| protein of unknown function DUF55 [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 138

 Score =  214 bits (547), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 95/140 (67%), Gaps = 3/140 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW  Q   G   E WTGVR++QA+ N+  M  GD+ FFYHSN G+EI
Sbjct: 1   MAYWLVKSEPDAFSWDQQVANG--VEPWTGVRSHQAKRNLMAMARGDRAFFYHSNIGKEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ E++   YPDPTA +S  W CVD+ AV  MP PV+L AIKA+P L+ + L+  SRLS
Sbjct: 59  VGVVEIVREAYPDPTA-ESGAWVCVDVRAVGPMPHPVTLAAIKADPDLADLALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           V PV+  ++  +CRMG    
Sbjct: 118 VVPVSDTQWGHLCRMGGWGG 137


>gi|148261832|ref|YP_001235959.1| hypothetical protein Acry_2850 [Acidiphilium cryptum JF-5]
 gi|146403513|gb|ABQ32040.1| protein of unknown function DUF55 [Acidiphilium cryptum JF-5]
          Length = 137

 Score =  214 bits (546), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 77/138 (55%), Positives = 95/138 (68%), Gaps = 3/138 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP  +SW  Q   G   E WTGVRN+ ARNN++ MRVGD+ FFYHSN GREI
Sbjct: 1   MNYWLVKSEPDAFSWDQQVANG--VEPWTGVRNHAARNNLKAMRVGDRAFFYHSNIGREI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTA +S  W  VD+ A+  MP PV L AIKA+P L+ + L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTA-ESGDWVAVDMKAIAPMPHPVGLAAIKADPALADLALVRLSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V PV+ + +  +C MG L
Sbjct: 118 VGPVSPEHWAHLCAMGGL 135


>gi|307825867|ref|ZP_07656083.1| protein of unknown function DUF55 [Methylobacter tundripaludum
           SV96]
 gi|307733175|gb|EFO04036.1| protein of unknown function DUF55 [Methylobacter tundripaludum
           SV96]
          Length = 163

 Score =  214 bits (546), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 54/151 (35%), Positives = 78/151 (51%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKG-R 58
           M YWL+KSEP  +      +K    E W GVRNYQARN MR  M++GD+ FFYHSN    
Sbjct: 12  MNYWLMKSEPDTFGINDLYNKPNQTEHWDGVRNYQARNMMRDDMKLGDRVFFYHSNCEMP 71

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI E++   YPD +A                  W  VD+  V ++   ++L  +K  
Sbjct: 72  GIVGIMEIVKEGYPDFSAFDPDDKHFDPKSDHEHPRWMMVDVKYVRTLSRTITLKELKHQ 131

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
             L+ + L+   +RLS+ PV+  E+  +  +
Sbjct: 132 EELAGLALVRRGNRLSIMPVSKGEWEFILSL 162


>gi|326405336|ref|YP_004285418.1| hypothetical protein ACMV_31890 [Acidiphilium multivorum AIU301]
 gi|325052198|dbj|BAJ82536.1| hypothetical protein ACMV_31890 [Acidiphilium multivorum AIU301]
          Length = 137

 Score =  214 bits (545), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 77/138 (55%), Positives = 95/138 (68%), Gaps = 3/138 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP  +SW  Q   G   E WTGVRN+ ARNN++ MRVGD+ FFYHSN GREI
Sbjct: 1   MNYWLVKSEPDAFSWDQQVANG--VEPWTGVRNHAARNNLKAMRVGDRAFFYHSNIGREI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTA +S  W  VD+ A+  MP PV L AIKA+P L+ + L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTA-ESGDWVAVDMKAIAPMPHPVGLAAIKADPALADLALVRLSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V PV+ + +  +C MG L
Sbjct: 118 VGPVSPEHWAHLCAMGGL 135


>gi|144898290|emb|CAM75154.1| protein containing DUF589 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 137

 Score =  214 bits (545), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 73/140 (52%), Positives = 93/140 (66%), Gaps = 3/140 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  WSW  Q   G    AWTGVRNYQA N ++ M +GD+ FFYHS   + I
Sbjct: 1   MAYWLVKSEPGAWSWDDQVRDG--VTAWTGVRNYQASNFLKAMTLGDRCFFYHSVNEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV+   YPDPTA+    W C D+ AVC++P PV+L  IKA+PRL+ + LI  SRLS
Sbjct: 59  VGIVEVVREAYPDPTADD-PRWVCPDLKAVCAVPNPVTLADIKADPRLAELPLIRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           V P+  + +  +C M K++ 
Sbjct: 118 VMPMDDESWALICAMAKVTP 137


>gi|218512513|ref|ZP_03509353.1| hypothetical protein Retl8_01884 [Rhizobium etli 8C-3]
          Length = 137

 Score =  214 bits (545), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 88/136 (64%), Positives = 100/136 (73%)

Query: 7   KSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEV 66
           KSEP+ WSW+ Q+  G  G  WTGVRNY ARNNMR M+VGDKGFFYHSN G EIVGI EV
Sbjct: 1   KSEPASWSWEQQKAAGDKGTEWTGVRNYLARNNMRAMQVGDKGFFYHSNDGLEIVGIVEV 60

Query: 67  ITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTT 126
              ++PD TA+    W+CVDI AV  MP PV+L  IKAN +LS M L+ S RLSVQPVT 
Sbjct: 61  CALSHPDSTAKGDPKWDCVDIRAVMDMPKPVTLKDIKANEKLSKMSLVTSMRLSVQPVTN 120

Query: 127 DEYLEVCRMGKLSNPP 142
           DE+ EVCRMG L NPP
Sbjct: 121 DEWAEVCRMGGLDNPP 136


>gi|170740413|ref|YP_001769068.1| hypothetical protein M446_2173 [Methylobacterium sp. 4-46]
 gi|168194687|gb|ACA16634.1| protein of unknown function DUF55 [Methylobacterium sp. 4-46]
          Length = 137

 Score =  214 bits (545), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 71/138 (51%), Positives = 96/138 (69%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WL KSEPS WSW  Q+  G  G  W GVRN+ A+ +++ MR G++GFFYHSN+G+ +
Sbjct: 1   MPHWLFKSEPSTWSWDQQEAAGEAGTFWNGVRNHLAKKHLQAMRTGEQGFFYHSNEGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EVI   YPD T ++S  +  VD+ AV  +P PV+L AIKA PRL  M+L+ +SRLS
Sbjct: 61  VGLVEVIRPYYPDHT-DESGKFGMVDVRAVARLPRPVTLDAIKAEPRLKDMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPVT +E+  +  MG L
Sbjct: 120 VQPVTEEEWAVIRAMGGL 137


>gi|83313274|ref|YP_423538.1| hypothetical protein amb4175 [Magnetospirillum magneticum AMB-1]
 gi|82948115|dbj|BAE52979.1| Uncharacterized conserved protein [Magnetospirillum magneticum
           AMB-1]
          Length = 137

 Score =  214 bits (545), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 70/139 (50%), Positives = 91/139 (65%), Gaps = 3/139 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEP  WSW  Q   G    AWTGVRNYQA NN++ M++GD+ FFYHS   + I
Sbjct: 1   MAFWLVKSEPGAWSWDDQVRDG--VTAWTGVRNYQACNNLKAMKLGDRAFFYHSVDEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE    W C D+ AV  +  PV+L  IKA+PRL+ + L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTAED-PRWMCPDLKAVAPLARPVTLAEIKADPRLAELPLLRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           V PV    +  +C +G ++
Sbjct: 118 VCPVDEASWRLLCDLGGVT 136


>gi|239905206|ref|YP_002951945.1| hypothetical protein DMR_05680 [Desulfovibrio magneticus RS-1]
 gi|239795070|dbj|BAH74059.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 159

 Score =  213 bits (544), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 62/156 (39%), Positives = 77/156 (49%), Gaps = 15/156 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL+KSEP  +S             W GVRN+QARN +R MR+GD   FYHS     +
Sbjct: 1   MAYWLIKSEPGCFSIDDLAAAPDRTTGWDGVRNFQARNFLRAMRLGDGLLFYHSVTDPGV 60

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ EV    YPD TA                  W+ VD+  V   P PV L A++  P 
Sbjct: 61  VGLAEVAREAYPDATAQDPDSGHFDPRASPDKPLWDMVDVRFVAKFPAPVPLAALRGVPE 120

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVCRMG-KLSNP 141
           L+ M +L   SRLSV PVT  E+  +  MG     P
Sbjct: 121 LAGMEVLRKGSRLSVTPVTDREFAVIRAMGLGQGGP 156


>gi|83643671|ref|YP_432106.1| hypothetical protein HCH_00785 [Hahella chejuensis KCTC 2396]
 gi|83631714|gb|ABC27681.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396]
          Length = 151

 Score =  213 bits (544), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 58/151 (38%), Positives = 75/151 (49%), Gaps = 15/151 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           MAYWL+K+EP  +S     +       W GVRNYQARN MR  M+VGD+ F YHS+    
Sbjct: 1   MAYWLMKTEPDAFSIDDLANSPDGVSGWDGVRNYQARNFMRDDMKVGDQVFIYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI EV    YPDP++               +  W CV +  V  +   V L  +K N
Sbjct: 61  GVAGIAEVCREAYPDPSSFDPESPYYDPKSTEENPRWWCVSVRFVRKLNKVVPLAEMKLN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
           P L  M L+  SRLSV PV   E+  +  M 
Sbjct: 121 PALQDMALVKRSRLSVMPVQPHEWETIMAMA 151


>gi|163797979|ref|ZP_02191921.1| hypothetical protein BAL199_06951 [alpha proteobacterium BAL199]
 gi|159176773|gb|EDP61344.1| hypothetical protein BAL199_06951 [alpha proteobacterium BAL199]
          Length = 139

 Score =  213 bits (544), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 74/140 (52%), Positives = 90/140 (64%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEP  WSW  Q  KG VGE W GVRNYQA NNM+ M VGD+GFFYHS   + I
Sbjct: 1   MAYWLFKSEPGAWSWDDQVAKGDVGEGWNGVRNYQAANNMKAMVVGDRGFFYHSVDEKRI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PDPT ++S  +  V I A+  +  PV+L  +KA PRL    L+  SRLS
Sbjct: 61  VGIVEVIETYHPDPT-DESGRFGMVTIKAIKPVNKPVTLADVKAEPRLEGFALVRQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           V PVT D++  +C M +   
Sbjct: 120 VVPVTDDQWELLCGMAETKG 139


>gi|99032450|pdb|2GBS|A Chain A, Nmr Structure Of Rpa0253 From Rhodopseudomonas Palustris.
           No Structural Genomics Consortium Target Rpr3
          Length = 145

 Score =  213 bits (544), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 99/137 (72%), Gaps = 1/137 (0%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           AYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  MR GD+ F+YHSN+G+EIV
Sbjct: 2   AYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFYYHSNEGKEIV 61

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI E+I   YPDPT + S  + CVDI A   +  PV+L A+KA PRL+ M L+  SRLSV
Sbjct: 62  GIAEIIREAYPDPT-DASGKFVCVDIKADKPLKTPVTLAAVKAEPRLADMALMKYSRLSV 120

Query: 122 QPVTTDEYLEVCRMGKL 138
           QPVT +E+  VC+MG L
Sbjct: 121 QPVTAEEWKLVCKMGGL 137


>gi|294085045|ref|YP_003551805.1| hypothetical protein SAR116_1478 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664620|gb|ADE39721.1| Protein of unknown function DUF589 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 139

 Score =  213 bits (543), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 92/139 (66%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEPS WSW+ Q D+G  GE W GVRNYQA NNM+ M++GD  FFYHS   ++I
Sbjct: 1   MQYWLLKSEPSSWSWQDQLDRGDAGEGWDGVRNYQASNNMKAMQIGDLAFFYHSVNEKQI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+    +PDPT + S  +  V + AV ++  PV+L +IKA+ RL  M L+  +RLS
Sbjct: 61  VGIVEICALYHPDPT-DASGRFGMVTVKAVKNVSKPVTLASIKADERLQDMALVRQARLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           V PVT  ++  +  M + +
Sbjct: 120 VTPVTEPQWRIIMDMAETT 138


>gi|117920920|ref|YP_870112.1| hypothetical protein Shewana3_2477 [Shewanella sp. ANA-3]
 gi|117613252|gb|ABK48706.1| conserved hypothetical protein [Shewanella sp. ANA-3]
          Length = 153

 Score =  212 bits (542), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 64/153 (41%), Positives = 85/153 (55%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWFGIRNYQARNFMRDAMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD +A                  W  VDI  V      + L  IK+ 
Sbjct: 61  GIVGIAEVVTEAYPDNSAFDPESKYFDPKSDPQQPRWLRVDIRFVKQFKEIIPLSLIKSL 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
           P+L+ M L+   SRLS+QPVT +++  V  + +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTQEQWQAVLMLAR 153


>gi|23015468|ref|ZP_00055243.1| COG2947: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 137

 Score =  212 bits (542), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 71/138 (51%), Positives = 91/138 (65%), Gaps = 3/138 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEP  WSW  Q   G    AWTGVRNYQA NN++ M++GDK FFYHS   + I
Sbjct: 1   MAFWLVKSEPGAWSWDDQMRDG--VTAWTGVRNYQACNNLKAMKLGDKAFFYHSVDEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTAE    W C D+ AV  +  P++L  IKA+PRL+ + L+  SRLS
Sbjct: 59  VGVVEVVREAYPDPTAED-PRWMCPDLKAVAPLARPITLAEIKADPRLAELPLLRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V PV  D +  +C +G +
Sbjct: 118 VCPVDADAWRLICDLGGV 135


>gi|126174822|ref|YP_001050971.1| hypothetical protein Sbal_2609 [Shewanella baltica OS155]
 gi|125998027|gb|ABN62102.1| protein of unknown function DUF55 [Shewanella baltica OS155]
          Length = 153

 Score =  212 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 65/151 (43%), Positives = 83/151 (54%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWHGIRNYQARNFMRDAMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  VDI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTNAYPDSTAFDPESKYFDPKSDPTKPRWLRVDIRFVEKFNDIIPLSLIKNL 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           P+L+ M L+   SRLS+QPVT +++  V  +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTAEQWQAVLML 151


>gi|113970622|ref|YP_734415.1| hypothetical protein Shewmr4_2287 [Shewanella sp. MR-4]
 gi|114047853|ref|YP_738403.1| hypothetical protein Shewmr7_2359 [Shewanella sp. MR-7]
 gi|113885306|gb|ABI39358.1| protein of unknown function DUF55 [Shewanella sp. MR-4]
 gi|113889295|gb|ABI43346.1| protein of unknown function DUF55 [Shewanella sp. MR-7]
          Length = 153

 Score =  212 bits (542), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 64/153 (41%), Positives = 85/153 (55%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWFGIRNYQARNFMRDAMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD +A                  W  VDI  V      + L  IK+ 
Sbjct: 61  GIVGIAEVVTNAYPDSSAFDPESKYFDPKSDPQQPRWLRVDIRFVKQFKEIIPLSLIKSL 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
           P+L+ M L+   SRLS+QPVT +++  V  + +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTEEQWQAVLMLAR 153


>gi|304409247|ref|ZP_07390868.1| protein of unknown function DUF55 [Shewanella baltica OS183]
 gi|307303250|ref|ZP_07583005.1| protein of unknown function DUF55 [Shewanella baltica BA175]
 gi|304353068|gb|EFM17465.1| protein of unknown function DUF55 [Shewanella baltica OS183]
 gi|306913610|gb|EFN44032.1| protein of unknown function DUF55 [Shewanella baltica BA175]
          Length = 153

 Score =  212 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 65/151 (43%), Positives = 83/151 (54%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWHGIRNYQARNFMRDEMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  VDI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTNAYPDSTAFDPESKYFDPKSDPTKPRWLRVDIRFVEKFNDIIPLSLIKNL 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           P+L+ M L+   SRLS+QPVT +++  V  +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTAEQWQAVLML 151


>gi|154251794|ref|YP_001412618.1| hypothetical protein Plav_1341 [Parvibaculum lavamentivorans DS-1]
 gi|154155744|gb|ABS62961.1| protein of unknown function DUF55 [Parvibaculum lavamentivorans
           DS-1]
          Length = 141

 Score =  212 bits (541), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 77/142 (54%), Positives = 91/142 (64%), Gaps = 1/142 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWL KSEPS WSW  Q+ KG  GE W GVRNYQA NNM+ M+ GD GFFYHS   + I
Sbjct: 1   MAYWLFKSEPSTWSWDDQKKKGAKGEPWNGVRNYQANNNMKAMKKGDLGFFYHSVDEKSI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI  VI    PDPT ++   +  V I AV  MP PV+L  +K  P L  M+L  +SRLS
Sbjct: 61  VGIVRVIGEHRPDPT-DEKGKFGLVVIEAVEDMPKPVTLDDVKKEPALHDMVLANNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPV  +E+  VC+MG L   P
Sbjct: 120 VQPVRDEEWKLVCKMGGLKKAP 141


>gi|304394320|ref|ZP_07376243.1| thymocyte nuclear protein 1 [Ahrensia sp. R2A130]
 gi|303293760|gb|EFL88137.1| thymocyte nuclear protein 1 [Ahrensia sp. R2A130]
          Length = 145

 Score =  212 bits (540), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 77/143 (53%), Positives = 96/143 (67%), Gaps = 1/143 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP +WSW+ Q+ KG VGE W G+RNYQARN MR M+VGD+ FFYHSN+G E+
Sbjct: 1   MQYWLFKSEPFKWSWEQQKAKGDVGEEWDGIRNYQARNFMRDMKVGDRAFFYHSNEGLEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   + PD T +    W+CV I A+  +P PV+L  +KA   L+ M L+ S RLS
Sbjct: 61  VGIAEVSAESAPDSTIDDE-RWDCVHIRALADVPKPVTLKDVKAMEVLADMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPV   E+  VCRMG +    L
Sbjct: 120 VQPVKRAEWEVVCRMGGIDPDTL 142


>gi|256823686|ref|YP_003147649.1| hypothetical protein Kkor_2472 [Kangiella koreensis DSM 16069]
 gi|256797225|gb|ACV27881.1| protein of unknown function DUF55 [Kangiella koreensis DSM 16069]
          Length = 154

 Score =  212 bits (540), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 58/153 (37%), Positives = 79/153 (51%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP  +  +  +   +  + W GVRNYQARN MR  M+ GDK FFYHSN K  
Sbjct: 1   MNYWLMKSEPDVFGIEHLKALPKKTDHWDGVRNYQARNMMRDEMKKGDKVFFYHSNCKPP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+   Y D TA               +  W  VD+  V  +   + L  +K  
Sbjct: 61  AIVGIMEVVKEGYVDHTAFDPDQKYYDPKSNPDNPRWYMVDVKHVRDLKREIPLDELKQY 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
             L+ M L+   +RLS+ PVT +E+  +  + K
Sbjct: 121 TELADMKLVQKGNRLSIMPVTKEEWDFILSIEK 153


>gi|146292777|ref|YP_001183201.1| hypothetical protein Sputcn32_1677 [Shewanella putrefaciens CN-32]
 gi|145564467|gb|ABP75402.1| protein of unknown function DUF55 [Shewanella putrefaciens CN-32]
          Length = 153

 Score =  211 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 65/151 (43%), Positives = 83/151 (54%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GDK FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWYGIRNYQARNFMRDGMQIGDKVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  +DI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTHAYPDSTAFDLESTYFDPKSDPSKPRWLSIDIRFVEKFDHIIPLSRIKNM 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           P+L+ M L+   SRLS+QPVT +++  V  +
Sbjct: 121 PQLTDMYLVSKGSRLSIQPVTAEQWQTVLML 151


>gi|299133152|ref|ZP_07026347.1| protein of unknown function DUF55 [Afipia sp. 1NLS2]
 gi|298593289|gb|EFI53489.1| protein of unknown function DUF55 [Afipia sp. 1NLS2]
          Length = 137

 Score =  211 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 77/138 (55%), Positives = 97/138 (70%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ NM KM+ GD  FFYHSN+G+EI
Sbjct: 1   MNYWLVKSEPSTWSWDQQVAKGNKGEAWTGVRNHSAKLNMMKMKKGDLAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++   YPDPT + S  + CVDI A   +  PV+L+A+KA  +L+ M L+  SRLS
Sbjct: 61  VGIVEIVREHYPDPT-DASGKFVCVDIAARKPLKTPVTLVAVKAEAKLADMELLRLSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT  ++  VC+MG +
Sbjct: 120 VQAVTPQQWAIVCKMGGV 137


>gi|288959280|ref|YP_003449621.1| hypothetical protein AZL_024390 [Azospirillum sp. B510]
 gi|288911588|dbj|BAI73077.1| hypothetical protein AZL_024390 [Azospirillum sp. B510]
          Length = 139

 Score =  211 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 72/141 (51%), Positives = 93/141 (65%), Gaps = 3/141 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP ++SW      GR    W GVRNYQA NN++ M VGD+ FFYHSN+G EI
Sbjct: 1   MAYWLVKSEPFKYSWDRMVADGR--THWDGVRNYQASNNLKAMEVGDRAFFYHSNEGLEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++   YPDP +++S  +  VD+  V  +  PV+L  IKA+P L SM L+  SRLS
Sbjct: 59  VGIVEIVRTYYPDP-SDESGRFGMVDVAPVTPVRTPVTLKQIKADPLLQSMALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           V PV+ DE+  VC +  +  P
Sbjct: 118 VCPVSDDEWTRVCDLAGVGVP 138


>gi|323137591|ref|ZP_08072668.1| protein of unknown function DUF55 [Methylocystis sp. ATCC 49242]
 gi|322397217|gb|EFX99741.1| protein of unknown function DUF55 [Methylocystis sp. ATCC 49242]
          Length = 139

 Score =  211 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 91/137 (66%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL+KSEPS WSW  Q   G  G  W GVRN+ A+ ++  M+ G++GFFYHSN+ R I
Sbjct: 1   MAHWLLKSEPSTWSWDQQVAAGAKGTFWNGVRNHLAKKHLMVMQKGERGFFYHSNEERAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPD T +++  +  VD+ AV  +  PV+L  IKA PRL+ M+L+ +SRLS
Sbjct: 61  VGIVEIIKTYYPDHT-DETGKFGMVDVKAVKPLKQPVTLGDIKAEPRLADMVLVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT  E+  +  M  
Sbjct: 120 VQPVTDAEWAVIMEMAG 136


>gi|153001165|ref|YP_001366846.1| hypothetical protein Shew185_2648 [Shewanella baltica OS185]
 gi|160875835|ref|YP_001555151.1| hypothetical protein Sbal195_2723 [Shewanella baltica OS195]
 gi|217972914|ref|YP_002357665.1| hypothetical protein Sbal223_1737 [Shewanella baltica OS223]
 gi|151365783|gb|ABS08783.1| protein of unknown function DUF55 [Shewanella baltica OS185]
 gi|160861357|gb|ABX49891.1| protein of unknown function DUF55 [Shewanella baltica OS195]
 gi|217498049|gb|ACK46242.1| protein of unknown function DUF55 [Shewanella baltica OS223]
 gi|315268026|gb|ADT94879.1| protein of unknown function DUF55 [Shewanella baltica OS678]
          Length = 153

 Score =  211 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 65/151 (43%), Positives = 83/151 (54%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN MR  M++GD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQIEAWHGIRNYQARNFMRDEMQIGDQVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  VDI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTNAYPDSTAFDPESKYFDPKSDPTKPRWLRVDIRFVEKFNDIIPLSLIKNL 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           P+L+ M L+   SRLS+QPVT +++  V  +
Sbjct: 121 PQLADMYLVTKGSRLSIQPVTAEQWQAVLML 151


>gi|39997373|ref|NP_953324.1| hypothetical protein GSU2275 [Geobacter sulfurreducens PCA]
 gi|39984264|gb|AAR35651.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298506310|gb|ADI85033.1| protein of unknown function DUF55 [Geobacter sulfurreducens KN400]
          Length = 163

 Score =  211 bits (538), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 59/155 (38%), Positives = 83/155 (53%), Gaps = 15/155 (9%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
            YWL KSEPS +S+     +    E W GVRN+QARN +R  ++ GD   FYHSN     
Sbjct: 6   RYWLFKSEPSCFSFDDLGSRPNGTEHWDGVRNFQARNLLRDEIKPGDGVLFYHSNVPDPA 65

Query: 60  IVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKANP 106
           +VGI  V+   YPD TA               +  W  VD+  V  +  PV+L  +K +P
Sbjct: 66  VVGIARVVREGYPDWTALDPAGEHFDPRAGRNNPIWYMVDVRYVKPLARPVTLAELKMHP 125

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
            ++ M+L+  SRLSVQPVT  ++  + R+G +  P
Sbjct: 126 EVADMVLLQRSRLSVQPVTPAQWEFILRLGGIHEP 160


>gi|322417836|ref|YP_004197059.1| hypothetical protein GM18_0294 [Geobacter sp. M18]
 gi|320124223|gb|ADW11783.1| protein of unknown function DUF55 [Geobacter sp. M18]
          Length = 156

 Score =  210 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 62/154 (40%), Positives = 86/154 (55%), Gaps = 15/154 (9%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGRE 59
            YWL KSEPS +S    + +    E W GVRN+QARN +R +++VGD+  FYHSN     
Sbjct: 3   NYWLFKSEPSSFSLDDLKHRPEATEHWDGVRNFQARNFLRDQVQVGDRVLFYHSNIAEPA 62

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           +VGI EV+   YPD TA                  W  VD+  V  +P PV+L  +K+ P
Sbjct: 63  VVGIAEVVKAGYPDFTAFDPQSKYFDPRSSPDKPTWYMVDVRFVRELPRPVTLAELKSIP 122

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
            LS+M L+  SRLS+QPV  +E+ E+  +  L+ 
Sbjct: 123 ELSAMALLNRSRLSIQPVRREEWEEILALAGLTQ 156


>gi|302039338|ref|YP_003799660.1| hypothetical protein NIDE4066 [Candidatus Nitrospira defluvii]
 gi|300607402|emb|CBK43735.1| conserved protein of unknown function DUF589 [Candidatus Nitrospira
           defluvii]
          Length = 161

 Score =  210 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 59/151 (39%), Positives = 78/151 (51%), Gaps = 15/151 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GREIV 61
           YWL+KSEP  +S        +   +W GVRNYQARN MR M+VGD+  FYHSN     + 
Sbjct: 7   YWLMKSEPEVFSIDDLARSPKGTTSWDGVRNYQARNFMRAMKVGDQVLFYHSNANPPAVA 66

Query: 62  GIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ EV+   YPD T                   W+ VDI  +     P+SL  ++A   L
Sbjct: 67  GVAEVVKTAYPDATQFDKRDTHYDPASNPDEPRWDMVDIRFIRKFVAPLSLDLLRAQAGL 126

Query: 109 SSMILIV-SSRLSVQPVTTDEYLEVCRMGKL 138
             M L+   SRLSVQPV   E+ EV R+ ++
Sbjct: 127 KGMELLRKGSRLSVQPVRAAEWNEVIRLAEV 157


>gi|53802490|ref|YP_112885.1| hypothetical protein MCA0353 [Methylococcus capsulatus str. Bath]
 gi|53756251|gb|AAU90542.1| conserved hypothetical protein [Methylococcus capsulatus str. Bath]
          Length = 152

 Score =  210 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 54/151 (35%), Positives = 76/151 (50%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKG-R 58
           M YWL+K+EP E+       +    E W GVRNYQARN MR  M+VGD   FYHSN    
Sbjct: 1   MRYWLMKTEPGEFGIDDLAARPAQTEPWDGVRNYQARNMMRDEMKVGDGVLFYHSNCDVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI E+    YPD TA                  W  VD+  V  +   ++L  ++  
Sbjct: 61  GVVGIAEIAREAYPDFTAFDPDHKHYDPASKPEAPRWFMVDVRFVRKLRRTIALSELRDR 120

Query: 106 PRLSSMILIVS-SRLSVQPVTTDEYLEVCRM 135
           P L+ + L+   +RLSV PV+ D++  +  +
Sbjct: 121 PELAGLALVRKANRLSVMPVSPDQWNFILSL 151


>gi|298292777|ref|YP_003694716.1| hypothetical protein Snov_2809 [Starkeya novella DSM 506]
 gi|296929288|gb|ADH90097.1| protein of unknown function DUF55 [Starkeya novella DSM 506]
          Length = 139

 Score =  210 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 73/139 (52%), Positives = 91/139 (65%), Gaps = 1/139 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP +WSW  Q   G  G  W GVRN+ A+ N+  M+ GD+GFFYHSN+G+EI
Sbjct: 1   MAHWLYKSEPFKWSWDNQVAAGAKGTHWDGVRNHAAKLNLLAMKKGDRGFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPDP ++ +  +  VDI AV  +  PVSL A+K  PRL+ M LI  SRLS
Sbjct: 61  VGIVEVIKEAYPDP-SDPTGRFFMVDIKAVEPLKQPVSLAAVKEEPRLAEMALIKFSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           VQPVT  E+  V  M   +
Sbjct: 120 VQPVTDAEWAIVLEMAGTT 138


>gi|296116767|ref|ZP_06835374.1| hypothetical protein GXY_13223 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976689|gb|EFG83460.1| hypothetical protein GXY_13223 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 137

 Score =  210 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 76/139 (54%), Positives = 92/139 (66%), Gaps = 3/139 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW  Q       E WTGVRN+QA+ N+  M VGD  FFYHSN GREI
Sbjct: 1   MAYWLVKSEPDAFSWDEQVA--NNVEPWTGVRNHQAKKNLMAMAVGDLAFFYHSNVGREI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ E++   YPDPTA Q   W CVD+ AV  MP PV+L  IKA+P LS + L+  SRLS
Sbjct: 59  VGVVEIVRAAYPDPTAPQGG-WVCVDVRAVGPMPTPVTLARIKADPVLSDLALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           V PV+   +  +CRMG  +
Sbjct: 118 VVPVSDAHWSHLCRMGGWA 136


>gi|24373533|ref|NP_717576.1| hypothetical protein SO_1969 [Shewanella oneidensis MR-1]
 gi|24347845|gb|AAN55020.1|AE015640_3 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 153

 Score =  210 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 65/153 (42%), Positives = 87/153 (56%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S +  + +    E W G+RNYQARN MR  M++GDK FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIEDLKARPNQTEPWFGIRNYQARNYMRDAMQIGDKVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA               +  W  VDI  V      + L  IK+ 
Sbjct: 61  GIVGIAEVVTNAYPDSTAFDPESTYFDPKSDPSNPRWLRVDIRFVEQFKEIIPLSLIKSL 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
           P+L+ M L+   SRLS+QPVT +++  V  + +
Sbjct: 121 PQLADMYLVSKGSRLSIQPVTAEQWQAVLMLSR 153


>gi|303325551|ref|ZP_07355994.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Desulfovibrio sp.
           3_1_syn3]
 gi|302863467|gb|EFL86398.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Desulfovibrio sp.
           3_1_syn3]
          Length = 155

 Score =  210 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 65/155 (41%), Positives = 84/155 (54%), Gaps = 14/155 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL K+EP  +SW+  ++       W GVRNYQARN MR MRVGD GFFYHS +   I
Sbjct: 1   MKYWLFKTEPGCFSWQDLENSPDQTSPWDGVRNYQARNFMRAMRVGDLGFFYHSGQQPGI 60

Query: 61  VGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANPR 107
           VGI E++   YPD TA+                 WE VD+    ++P P+S   + A P 
Sbjct: 61  VGIVEIVRAAYPDATAQDPENQHFDPKATPEKPIWEMVDVRLRRALPHPLSRKELAAWPE 120

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLSNP 141
           LS M L+   SRLSVQPV    +  +C +  +  P
Sbjct: 121 LSGMELMKRGSRLSVQPVDAKAFAFICNLAGIQRP 155


>gi|209883484|ref|YP_002287341.1| protein of unknown function DUF55 [Oligotropha carboxidovorans OM5]
 gi|209871680|gb|ACI91476.1| protein of unknown function DUF55 [Oligotropha carboxidovorans OM5]
          Length = 137

 Score =  210 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 74/138 (53%), Positives = 94/138 (68%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEPS WSW  Q   G+ GE WTGVRN+ A+ NM KM+ GD+ FFYHSN+G+EI
Sbjct: 1   MNYWLVKSEPSVWSWDQQVANGKKGEPWTGVRNHSAKLNMMKMKKGDRAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++   YPDPT + +  + CVDI A   +  PV+L A+K    L+ M L+  SRLS
Sbjct: 61  VGIVEIVREHYPDPT-DATGKFVCVDIIAGKPLKKPVTLTAVKGEAALADMELLRLSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQ VT  ++  VC+MG L
Sbjct: 120 VQSVTPAQWKHVCKMGGL 137


>gi|281337333|gb|EFB12917.1| hypothetical protein PANDA_005058 [Ailuropoda melanoleuca]
          Length = 225

 Score =  210 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 79/167 (47%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
            YWL+KSEP           +S +  + + +    W GVRNYQARN +R M++  + FFY
Sbjct: 55  NYWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEQEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   ++
Sbjct: 115 HSNCKEPGIAGLVKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRYIT 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K + +        L +M L    RLSVQP+T +E+  +  + +
Sbjct: 175 LAELKTHHQAHKTTGGPLKNMALFTRQRLSVQPLTPEEFNFILSLEE 221


>gi|182680121|ref|YP_001834267.1| hypothetical protein Bind_3218 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636004|gb|ACB96778.1| protein of unknown function DUF55 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 144

 Score =  210 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 69/140 (49%), Positives = 96/140 (68%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL+KSEP++WSW  Q    R G  W GVRN+ A+ ++  M+VG++ FFYHSN G+ +
Sbjct: 1   MAHWLIKSEPNKWSWDDQVKAAREGTFWNGVRNHLAKQHLMAMKVGEQVFFYHSNIGKAV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPDP ++ +  +  VD+ A      PV+L AIKA+PRLS MIL+ +SRLS
Sbjct: 61  VGIAEVIKPYYPDP-SDATGKFGMVDVRARQPFAKPVTLEAIKADPRLSDMILVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPVT +E+  +C +G+   
Sbjct: 120 VQPVTDEEWTIICGLGEPGK 139


>gi|226228590|ref|YP_002762696.1| hypothetical protein GAU_3184 [Gemmatimonas aurantiaca T-27]
 gi|226091781|dbj|BAH40226.1| hypothetical protein [Gemmatimonas aurantiaca T-27]
          Length = 164

 Score =  210 bits (535), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 60/152 (39%), Positives = 80/152 (52%), Gaps = 15/152 (9%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGR-E 59
            YWL+KSEP  +S+       +    W  +RN  ARN +R  M+VGD+ F+YHSN     
Sbjct: 11  RYWLIKSEPDVFSFDDLMQAPQRTTCWDSIRNSGARNFLRDGMKVGDRCFYYHSNAEPSA 70

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+ EV+   YPD TA                  W  VD+ AV +    V+L  IKA+P
Sbjct: 71  IAGVCEVVREGYPDHTAFDPSHEYYDEKSDPAMPTWFMVDVKAVAAFKTLVTLPQIKADP 130

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGKL 138
            L+ M L+  SRLSV PVT DE+  VC +G +
Sbjct: 131 ALAEMALLRVSRLSVVPVTADEWAHVCALGGV 162


>gi|120599152|ref|YP_963726.1| hypothetical protein Sputw3181_2348 [Shewanella sp. W3-18-1]
 gi|120559245|gb|ABM25172.1| protein of unknown function DUF55 [Shewanella sp. W3-18-1]
 gi|319426081|gb|ADV54155.1| protein of unknown function DUF55 [Shewanella putrefaciens 200]
          Length = 153

 Score =  210 bits (535), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 64/151 (42%), Positives = 83/151 (54%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S    +      EAW G+RNYQARN +R  M++GDK FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIDDLKACPNQTEAWYGIRNYQARNFIRDGMQIGDKVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV+T  YPD TA                  W  +DI  V      + L  IK  
Sbjct: 61  GIVGIAEVVTHAYPDSTAFDPESTYFDPKSDPSKPRWLSIDIRFVEKFDHIIPLSLIKNM 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           P+L+ M L+   SRLS+QPVT +++  V  +
Sbjct: 121 PQLTDMYLVSKGSRLSIQPVTAEQWQTVLML 151


>gi|332264024|ref|XP_003281048.1| PREDICTED: thymocyte nuclear protein 1-like isoform 1 [Nomascus
           leucogenys]
 gi|332264026|ref|XP_003281049.1| PREDICTED: thymocyte nuclear protein 1-like isoform 2 [Nomascus
           leucogenys]
          Length = 225

 Score =  210 bits (535), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 54/167 (32%), Positives = 82/167 (49%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP           +S +  + + R    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPRQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I GI +++   YPD T                +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGIMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K+  +        L +M+L    RLSVQP+T +E+  V  + +
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSVQPLTQEEFDFVLGLEE 221


>gi|154245056|ref|YP_001416014.1| hypothetical protein Xaut_1108 [Xanthobacter autotrophicus Py2]
 gi|154159141|gb|ABS66357.1| protein of unknown function DUF55 [Xanthobacter autotrophicus Py2]
          Length = 163

 Score =  209 bits (534), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 75/138 (54%), Positives = 94/138 (68%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP +WSW MQ   G  G  W GVRN+ A+  +  M+ GD+GFFYHSN+G+EI
Sbjct: 27  MAHWLYKSEPFKWSWDMQVKAGAKGTHWDGVRNHLAKQQLLAMKKGDRGFFYHSNEGKEI 86

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPDP ++ S  +  VDI AV  +  PV+L A+KA PRL  M LI  SRLS
Sbjct: 87  VGIVEVIKEAYPDP-SDPSGKFFMVDIKAVKPLKTPVTLAAVKAEPRLQEMALIKFSRLS 145

Query: 121 VQPVTTDEYLEVCRMGKL 138
           VQPV+ +E+  VC MG +
Sbjct: 146 VQPVSDEEWDIVCGMGGV 163


>gi|46580821|ref|YP_011629.1| hypothetical protein DVU2416 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601863|ref|YP_966263.1| hypothetical protein Dvul_0815 [Desulfovibrio vulgaris DP4]
 gi|46450241|gb|AAS96889.1| conserved hypothetical protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120562092|gb|ABM27836.1| protein of unknown function DUF55 [Desulfovibrio vulgaris DP4]
 gi|311234525|gb|ADP87379.1| protein of unknown function DUF55 [Desulfovibrio vulgaris RCH1]
          Length = 160

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 62/154 (40%), Positives = 78/154 (50%), Gaps = 14/154 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSE   +S            +W GVRNYQARN MR MR GD GFFYHS K  EI
Sbjct: 1   MNYWLFKSETDCFSVDDLAASPDATSSWDGVRNYQARNFMRTMRKGDLGFFYHSGKNPEI 60

Query: 61  VGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI EV+  ++PD TA               +  W+ VD+  V     P+   A+K    
Sbjct: 61  AGIVEVVRESHPDHTAWDPENDHYDPASTPDAPRWDMVDVRLVQRFVTPLPRAALKGVAG 120

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLSN 140
           L  M L+   SRLSVQPVT +E+  V  + + + 
Sbjct: 121 LEGMELLKKGSRLSVQPVTPEEFAIVRHLAEQAQ 154


>gi|194213007|ref|XP_001505163.2| PREDICTED: similar to thymocyte nuclear protein 1 [Equus caballus]
          Length = 242

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 52/167 (31%), Positives = 82/167 (49%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           +YWL+KSEP           +S +  + + +    W GVRNYQARN +R M++ ++ FFY
Sbjct: 72  SYWLMKSEPESRLAKGVDVKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEEEAFFY 131

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   +S
Sbjct: 132 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIS 191

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K + +        L +M+L    RLS+QPVT +E+  +  + +
Sbjct: 192 LAELKTHHQAHKATGGPLKNMVLFTRQRLSIQPVTQEEFDFILSLEE 238


>gi|294055996|ref|YP_003549654.1| protein of unknown function DUF55 [Coraliomargarita akajimensis DSM
           45221]
 gi|293615329|gb|ADE55484.1| protein of unknown function DUF55 [Coraliomargarita akajimensis DSM
           45221]
          Length = 154

 Score =  209 bits (533), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 61/153 (39%), Positives = 83/153 (54%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP  +S++  + +    E W GVRNYQARN MR  M+VGD+  FYHSN    
Sbjct: 1   MKYWLMKSEPDVFSFEDLKQRPGQTEPWDGVRNYQARNFMRDEMKVGDQILFYHSNTNPP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VG+ EV +  YPDP+A               +  W  VD+     +P  VSL  +KA 
Sbjct: 61  GVVGVAEVASSAYPDPSAFDQQSKYYDAKSDPENPRWILVDVKYRADLPRMVSLEEMKAI 120

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGK 137
           P L+ M +L   +RLS+ PVT  E+  +    K
Sbjct: 121 PELAEMRVLQRGNRLSITPVTEAEFEAIVAAAK 153


>gi|217977110|ref|YP_002361257.1| protein of unknown function DUF55 [Methylocella silvestris BL2]
 gi|217502486|gb|ACK49895.1| protein of unknown function DUF55 [Methylocella silvestris BL2]
          Length = 139

 Score =  209 bits (532), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 72/140 (51%), Positives = 97/140 (69%), Gaps = 1/140 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL+KSEPS WSW  Q + G+ G  W GVRN+ A+ N+  M+VG++ FFYHSN+G+EI
Sbjct: 1   MAHWLLKSEPSSWSWDKQVEAGKKGTFWNGVRNHSAKLNLMAMKVGEEAFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E+I   YPDP ++ S  +  VD+ A   +  PV+L AIKA+PRL  MIL+ +SRLS
Sbjct: 61  VGIVEIIKPYYPDP-SDASGKFGMVDVRAKTPLKRPVTLEAIKADPRLKDMILVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           VQPV+  E+  +C  G L  
Sbjct: 120 VQPVSEAEWNIICAEGGLGR 139


>gi|73954572|ref|XP_546386.2| PREDICTED: similar to thymocyte protein thy28 isoform 1 [Canis
           familiaris]
          Length = 243

 Score =  209 bits (532), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 54/167 (32%), Positives = 81/167 (48%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           +YWL+KSEP           +S +  + + +    W GVRNYQARN +R M++  K FFY
Sbjct: 73  SYWLMKSEPQSRIEKGVDVKFSIEDLKAEPKQTACWDGVRNYQARNFLRAMKLEQKAFFY 132

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   ++
Sbjct: 133 HSNCKEPGIAGLVKIVKEAYPDHTQFEKNNPYYDPSSKEDNPKWSMVDVQFVRLMKRYIT 192

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +KAN +        L +M L    RLSVQP+T +E+  +  + +
Sbjct: 193 LTELKANHQAHKATGGPLKNMALFTHPRLSVQPLTPEEFEFILSLEE 239


>gi|78223566|ref|YP_385313.1| hypothetical protein Gmet_2363 [Geobacter metallireducens GS-15]
 gi|78194821|gb|ABB32588.1| protein of unknown function DUF589 [Geobacter metallireducens
           GS-15]
          Length = 158

 Score =  209 bits (532), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 61/153 (39%), Positives = 84/153 (54%), Gaps = 15/153 (9%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
            +WL KSEPS +S+   + +    E W GVRN+QARN +R  ++ GD   FYHSN     
Sbjct: 6   RFWLFKSEPSCFSFDDLKARPNGTEHWDGVRNFQARNLLRDEIKPGDGVLFYHSNIPEPA 65

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI EV++  YPD TA               +  W  VD+  V  +  PV+L  +K + 
Sbjct: 66  IVGIAEVVSEGYPDWTALDPSAEHFDPRAGGDNPVWYMVDVRYVRPLKRPVTLNEMKIHS 125

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLS 139
            LS M+L+  SRLSVQPVT  E+  + R+G + 
Sbjct: 126 ELSGMVLLKRSRLSVQPVTQHEWEYILRLGGID 158


>gi|154707774|ref|YP_001423923.1| hypothetical protein CBUD_0509 [Coxiella burnetii Dugway 5J108-111]
 gi|161349750|ref|ZP_02097132.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165919395|ref|ZP_02219461.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212219189|ref|YP_002305976.1| hypothetical protein CbuK_1696 [Coxiella burnetii CbuK_Q154]
 gi|154357060|gb|ABS78522.1| hypothetical protein CBUD_0509 [Coxiella burnetii Dugway 5J108-111]
 gi|164601659|gb|EDQ95189.1| conserved hypothetical protein [Coxiella burnetii 'MSU Goat Q177']
 gi|165916911|gb|EDR35515.1| conserved hypothetical protein [Coxiella burnetii RSA 334]
 gi|212013451|gb|ACJ20831.1| hypothetical protein CbuK_1696 [Coxiella burnetii CbuK_Q154]
          Length = 152

 Score =  208 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 57/151 (37%), Positives = 78/151 (51%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKG-R 58
           M YWL+KSEP+ +S      +      W GVRNYQARN MR  M+ GD  FFYHSN    
Sbjct: 1   MNYWLLKSEPTSYSIDDLFREKNKITRWDGVRNYQARNFMRDGMKKGDLAFFYHSNCEKP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ EV+  +YPD TA               +  W  VDI      P  +SL  ++ N
Sbjct: 61  GIVGVVEVVRESYPDLTALDPEDHHYDPKSTPDNPRWLMVDIKFRKKFPQVISLQELRQN 120

Query: 106 PRLSS-MILIVSSRLSVQPVTTDEYLEVCRM 135
           P+L   +IL   +RLS+ PV+   +  + ++
Sbjct: 121 PKLKDLLILRKGNRLSITPVSKAHWDAIMKL 151


>gi|212212171|ref|YP_002303107.1| hypothetical protein CbuG_0543 [Coxiella burnetii CbuG_Q212]
 gi|212010581|gb|ACJ17962.1| hypothetical protein CbuG_0543 [Coxiella burnetii CbuG_Q212]
          Length = 152

 Score =  208 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 57/151 (37%), Positives = 78/151 (51%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKG-R 58
           M YWL+KSEP+ +S      +      W GVRNYQARN MR  M+ GD  FFYHSN    
Sbjct: 1   MNYWLLKSEPTSYSIDDLFREKNKITRWDGVRNYQARNFMRDGMKKGDLAFFYHSNCEKP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ EV+  +YPD TA               +  W  VDI      P  +SL  ++ N
Sbjct: 61  GIVGVVEVVRESYPDLTALDPKDHHYDPKSTPDNPRWLMVDIKFRKKFPQVISLQELRQN 120

Query: 106 PRLSS-MILIVSSRLSVQPVTTDEYLEVCRM 135
           P+L   +IL   +RLS+ PV+   +  + ++
Sbjct: 121 PKLKDLLILRKGNRLSITPVSKAHWDAIMKL 151


>gi|308535153|ref|YP_002137093.2| hypothetical protein Gbem_0266 [Geobacter bemidjiensis Bem]
 gi|308052498|gb|ACH37297.2| protein of unknown function DUF55 [Geobacter bemidjiensis Bem]
          Length = 154

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 61/150 (40%), Positives = 82/150 (54%), Gaps = 15/150 (10%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
            YWL KSEPS +S +  + +    E W GVRNYQARN +R  ++VGD+  FYHSN     
Sbjct: 3   NYWLFKSEPSSFSLEDLKHRPNATEHWDGVRNYQARNFLRDEVQVGDQVLFYHSNIAEPA 62

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           +VGI EV+   YPD TA                  W  VD+  V  +P PV+L  +K  P
Sbjct: 63  VVGIAEVVRAGYPDFTAFDPESNYFDPKSNPEKPAWFMVDVKFVRELPRPVTLSELKTVP 122

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
            LS M L+  SRLS+QPV  +E+  + ++ 
Sbjct: 123 ELSGMALLNRSRLSIQPVRKEEWDLILKLA 152


>gi|118581613|ref|YP_902863.1| hypothetical protein Ppro_3212 [Pelobacter propionicus DSM 2379]
 gi|118504323|gb|ABL00806.1| protein of unknown function DUF55 [Pelobacter propionicus DSM 2379]
          Length = 156

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 63/156 (40%), Positives = 85/156 (54%), Gaps = 15/156 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL K+EP  +S+   +++  + E W GVRN+QARN +R  ++VGD   FYHSN    
Sbjct: 1   MNYWLFKTEPGCFSFDNLKNRPNMTEPWDGVRNFQARNYLRDTVKVGDLVLFYHSNIPQP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+  V+   YPD TA               +  W  VD+  +  M   VSL  IKAN
Sbjct: 61  AIVGLATVVREGYPDTTALDPEGEHFDPKSSPANPIWYMVDVRYLKEMTRQVSLEQIKAN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
           P L +M L+  SRLS+QPVT ++   +  MG  S P
Sbjct: 121 PLLEAMPLVNRSRLSIQPVTPEQGEIILAMGGTSLP 156


>gi|12001950|gb|AAG43118.1|AF059619_1 My005 protein [Homo sapiens]
          Length = 225

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 82/167 (49%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP           +S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K+  +        L +M+L    RLS+QP+T +E+  V  + +
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEE 221


>gi|301763002|ref|XP_002916918.1| PREDICTED: thymocyte nuclear protein 1-like [Ailuropoda
           melanoleuca]
          Length = 229

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 79/167 (47%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
            YWL+KSEP           +S +  + + +    W GVRNYQARN +R M++  + FFY
Sbjct: 59  NYWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEQEAFFY 118

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   ++
Sbjct: 119 HSNCKEPGIAGLVKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRYIT 178

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K + +        L +M L    RLSVQP+T +E+  +  + +
Sbjct: 179 LAELKTHHQAHKTTGGPLKNMALFTRQRLSVQPLTPEEFNFILSLEE 225


>gi|66361456|pdb|1ZCE|A Chain A, X-Ray Crystal Structure Of Protein Atu2648 From
           Agrobacteriu Tumefaciens. Northeast Structural Genomics
           Consortium Targe
          Length = 155

 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 89/141 (63%), Positives = 105/141 (74%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
            YWL KSEP +WSW+ Q+ KG  GE WTGVRNYQARNN R  ++GDKGFFYHSN+G ++V
Sbjct: 3   NYWLYKSEPFKWSWEXQKAKGETGEEWTGVRNYQARNNXRAXKIGDKGFFYHSNEGLDVV 62

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI EV   ++PD TAE    W+CVDI AVC  P PVSL  +KANP+L    L+ S RLSV
Sbjct: 63  GIVEVCALSHPDSTAEGDLKWDCVDIRAVCDXPQPVSLKDVKANPKLEKXSLVTSXRLSV 122

Query: 122 QPVTTDEYLEVCRMGKLSNPP 142
           QPVT +EYLEVCR G L+NPP
Sbjct: 123 QPVTEEEYLEVCRXGGLANPP 143


>gi|55637391|ref|XP_508871.1| PREDICTED: thymocyte nuclear protein 1 isoform 4 [Pan troglodytes]
 gi|332838238|ref|XP_003313468.1| PREDICTED: thymocyte nuclear protein 1 isoform 1 [Pan troglodytes]
          Length = 225

 Score =  207 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 82/167 (49%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP           +S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K+  +        L +M+L    RLS+QP+T +E+  V  + +
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEE 221


>gi|7661804|ref|NP_054893.1| thymocyte nuclear protein 1 isoform 1 [Homo sapiens]
 gi|40806221|ref|NP_954995.1| thymocyte nuclear protein 1 isoform 1 [Homo sapiens]
 gi|83267861|ref|NP_001032382.1| thymocyte nuclear protein 1 isoform 1 [Homo sapiens]
 gi|74734762|sp|Q9P016|THYN1_HUMAN RecName: Full=Thymocyte nuclear protein 1; AltName: Full=Thymocyte
           protein Thy28
 gi|6841510|gb|AAF29108.1|AF161493_1 HSPC144 [Homo sapiens]
 gi|33150614|gb|AAP97185.1|AF087886_1 thymocyte protein Thy28kD [Homo sapiens]
 gi|119588232|gb|EAW67828.1| thymocyte nuclear protein 1, isoform CRA_a [Homo sapiens]
 gi|119588234|gb|EAW67830.1| thymocyte nuclear protein 1, isoform CRA_a [Homo sapiens]
 gi|119588235|gb|EAW67831.1| thymocyte nuclear protein 1, isoform CRA_a [Homo sapiens]
          Length = 225

 Score =  207 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 82/167 (49%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP           +S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K+  +        L +M+L    RLS+QP+T +E+  V  + +
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEE 221


>gi|222056192|ref|YP_002538554.1| protein of unknown function DUF55 [Geobacter sp. FRC-32]
 gi|221565481|gb|ACM21453.1| protein of unknown function DUF55 [Geobacter sp. FRC-32]
          Length = 158

 Score =  207 bits (528), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 65/154 (42%), Positives = 85/154 (55%), Gaps = 15/154 (9%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKG-RE 59
           +YWL KSEP+ +S+   +      E W GVRNYQARN +R  ++VGD+  FYHSN     
Sbjct: 5   SYWLFKSEPTNFSFDDLRTCPNSTEHWDGVRNYQARNYLRDEVQVGDQVLFYHSNIAVPA 64

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI EV+   YPD TA                  W  VD+  V   P PV L  +K NP
Sbjct: 65  IVGIAEVVRAGYPDWTARDPENKHFDPASTAEKPIWYMVDVRFVNPFPRPVKLAELKNNP 124

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
            LS M+L+  SRLS+QPV  +E+ ++ RMG +  
Sbjct: 125 ALSGMVLLSRSRLSIQPVREEEWRQILRMGGVEE 158


>gi|29654756|ref|NP_820448.1| hypothetical protein CBU_1465 [Coxiella burnetii RSA 493]
 gi|161830317|ref|YP_001597306.1| hypothetical protein COXBURSA331_A1642 [Coxiella burnetii RSA 331]
 gi|29542024|gb|AAO90962.1| hypothetical protein CBU_1465 [Coxiella burnetii RSA 493]
 gi|161762184|gb|ABX77826.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
          Length = 152

 Score =  207 bits (528), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 58/151 (38%), Positives = 79/151 (52%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKG-R 58
           M YWL+KSEP+ +S      +      W GVRNYQARN MR  M+ GD  FFYHSN    
Sbjct: 1   MNYWLLKSEPTSYSIDDLFREKNKITRWDGVRNYQARNFMRDGMKKGDLAFFYHSNCEKP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+FEV+  +YPD TA               +  W  VDI      P  +SL  ++ N
Sbjct: 61  GIVGVFEVVRESYPDLTALDPEDHHYDPKSTPDNPRWLMVDIKFRKKFPQVISLQELRQN 120

Query: 106 PRLSS-MILIVSSRLSVQPVTTDEYLEVCRM 135
           P+L   +IL   +RLS+ PV+   +  + ++
Sbjct: 121 PKLKDLLILRKGNRLSITPVSKAHWDAIMKL 151


>gi|158421889|ref|YP_001523181.1| hypothetical protein AZC_0265 [Azorhizobium caulinodans ORS 571]
 gi|158328778|dbj|BAF86263.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 137

 Score =  207 bits (528), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 94/137 (68%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP +WSW  Q   G  G  W GVRN+ A+  ++ M++GD+GFFYHSN+G+EI
Sbjct: 1   MAHWLYKSEPFKWSWDQQVKAGAKGTHWDGVRNHLAKQQLQAMKLGDQGFFYHSNEGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   YPDP ++ +  +  VD+ AV ++  PV+L  IKA PRL +M LI  SRLS
Sbjct: 61  VGIVEVIREFYPDP-SDATGKFGMVDLKAVRALKKPVTLATIKAEPRLENMALIKFSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT +E+  V  + +
Sbjct: 120 VQPVTDEEWDIVLSLAE 136


>gi|62204514|gb|AAH93074.1| Thymocyte nuclear protein 1 [Homo sapiens]
          Length = 225

 Score =  207 bits (528), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 82/167 (49%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP           +S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K+  +        L +M+L    RLS+QP+T +E+  V  + +
Sbjct: 175 LAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEE 221


>gi|119774710|ref|YP_927450.1| hypothetical protein Sama_1573 [Shewanella amazonensis SB2B]
 gi|119767210|gb|ABL99780.1| conserved hypothetical protein [Shewanella amazonensis SB2B]
          Length = 156

 Score =  207 bits (527), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 63/153 (41%), Positives = 87/153 (56%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP E+S +    + +  E W G+RNYQARN MR  M+VGD+ FFYHS+ K  
Sbjct: 1   MNYWLMKSEPDEFSIRDLAARPQQTEGWHGIRNYQARNFMRDAMKVGDRVFFYHSSCKVP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ E+ +  YPD +A               S  W  +DI  V     PV+L AIK++
Sbjct: 61  AIVGVAEIASDVYPDSSAWDPESDYFDPKSSPDSPRWLQLDIRFVKEFTKPVTLTAIKSH 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
           P L+ M+L+   SRLS+QPV    +  + +M  
Sbjct: 121 PGLTDMLLVQKGSRLSIQPVDEIHWQLIHQMAG 153


>gi|291286060|ref|YP_003502876.1| hypothetical protein Dacet_0114 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290883220|gb|ADD66920.1| protein of unknown function DUF55 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 155

 Score =  206 bits (526), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 57/153 (37%), Positives = 77/153 (50%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEP  +S    ++     E W G+RNYQARN MR  M +GD+  FYHSN    
Sbjct: 1   MRYWLMKSEPESFSIDDLKNCKNSTEHWDGIRNYQARNFMRDDMVIGDRVLFYHSNTDEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI EV +  Y D TA               +  W  VDI  V      V+L  +K+ 
Sbjct: 61  GVVGIAEVASEPYADYTAFDSGSKYYDRQSTKENPRWVMVDIRFVEKFDRTVTLKEMKSM 120

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGK 137
             L+ M +L   +RLS+ PV  +E+  +  M K
Sbjct: 121 YNLAGMKLLQRGNRLSIMPVGKNEFETIVSMSK 153


>gi|258546127|ref|ZP_05706361.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cardiobacterium
           hominis ATCC 15826]
 gi|258518552|gb|EEV87411.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Cardiobacterium
           hominis ATCC 15826]
          Length = 158

 Score =  206 bits (526), Expect = 8e-52,   Method: Composition-based stats.
 Identities = 60/152 (39%), Positives = 79/152 (51%), Gaps = 15/152 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M YWL+KSEP  +S    + +    E W GVRN+QARN MR+MR GD+ FFYHSN K   
Sbjct: 1   MNYWLLKSEPGNFSLDDLRARPGQREPWDGVRNFQARNFMRQMRAGDRAFFYHSNAKPSG 60

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ E++    PDPT                   W+ V +  V +    VSL  +K  P
Sbjct: 61  IVGVVEIVGEARPDPTQFDPESRYFDAKASLDAPRWDLVVVQFVRAFSAMVSLAQLKDVP 120

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
            L+ M ++   SRLSV PVT  E+  V  +  
Sbjct: 121 ALAGMEVVRKGSRLSVSPVTPAEWQAVLALAG 152


>gi|256830966|ref|YP_003159694.1| hypothetical protein Dbac_3203 [Desulfomicrobium baculatum DSM
           4028]
 gi|256580142|gb|ACU91278.1| protein of unknown function DUF55 [Desulfomicrobium baculatum DSM
           4028]
          Length = 153

 Score =  206 bits (525), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 59/152 (38%), Positives = 76/152 (50%), Gaps = 15/152 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M YWL+K+EP  +S            +W GVRN+QARN MR  M VGD   FYHS K   
Sbjct: 1   MKYWLMKTEPGCFSIDDLAAAPNQTSSWDGVRNFQARNFMRDDMSVGDLILFYHSVKNPG 60

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           +VGI  V   +YPD TA              +   W  VD+  V   P PV L +++   
Sbjct: 61  VVGIARVARESYPDHTAWNPADRHFDPRSTPEKPLWFMVDVQFVEKFPHPVPLASLRGVK 120

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
            L  M L+   SRLSV PVT +E+  V R+ +
Sbjct: 121 GLEMMELLKKGSRLSVTPVTDEEFKIVTRLAR 152


>gi|253698905|ref|YP_003020094.1| hypothetical protein GM21_0251 [Geobacter sp. M21]
 gi|251773755|gb|ACT16336.1| protein of unknown function DUF55 [Geobacter sp. M21]
          Length = 156

 Score =  205 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 81/150 (54%), Gaps = 15/150 (10%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
            YWL KSEPS +S +  + +    E W GVRNYQARN +R  ++VGD   FYHSN     
Sbjct: 3   NYWLFKSEPSSFSLEDLKHRPGATEHWDGVRNYQARNFLRDEVQVGDLVLFYHSNIAEPA 62

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           +VG+ EV+   YPD TA                  W  VD+  V  +P PV+L  +K  P
Sbjct: 63  VVGVAEVVKAGYPDFTAFDPESNYFDPKSDPQKPVWYMVDVKFVRELPRPVTLSELKTVP 122

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
            LS M L+  SRLS+QPV  +E+  + ++ 
Sbjct: 123 ELSGMALLNRSRLSIQPVRKEEWDLILKLA 152


>gi|110636509|ref|YP_676716.1| hypothetical protein CHU_0082 [Cytophaga hutchinsonii ATCC 33406]
 gi|110279190|gb|ABG57376.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 135

 Score =  205 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 87/137 (63%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP ++S+       +    W GVRNYQARNN+R+M+ GD   FYHSN+G+EI
Sbjct: 1   MNYWLIKSEPFKYSFDQFVADKK--TFWDGVRNYQARNNLREMKKGDLLLFYHSNEGKEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +++   Y DPT + ++ W  VD+  V  +  PV+L  +K + RL++M L+   RLS
Sbjct: 59  VGIAKIVKEAYQDPTTDDAN-WVVVDVAPVKKLKNPVTLEMVKKDKRLANMALVKLMRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPV  +E+  V  +  
Sbjct: 118 VQPVRKEEFDIVLELAG 134


>gi|260099885|pdb|3EOP|A Chain A, Crystal Structure Of The Duf55 Domain Of Human Thymocyte
           Nuclear Protein 1
 gi|260099886|pdb|3EOP|B Chain B, Crystal Structure Of The Duf55 Domain Of Human Thymocyte
           Nuclear Protein 1
          Length = 176

 Score =  205 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 52/164 (31%), Positives = 81/164 (49%), Gaps = 31/164 (18%)

Query: 1   MAYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFF 51
           M++WL+KSEP           +S +  + + +    W GVRNYQARN +R M++G++ FF
Sbjct: 1   MSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFF 60

Query: 52  YHSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPV 97
           YHSN K   I G+ +++   YPD T                +  W  VD+  V  M   +
Sbjct: 61  YHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFI 120

Query: 98  SLMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVC 133
            L  +K+  +        L +M+L    RLS+QP+T +E+  V 
Sbjct: 121 PLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVL 164


>gi|56090477|ref|NP_001007662.1| thymocyte nuclear protein 1 [Rattus norvegicus]
 gi|81885165|sp|Q6P3E0|THYN1_RAT RecName: Full=Thymocyte nuclear protein 1
 gi|39795639|gb|AAH64031.1| Thymocyte nuclear protein 1 [Rattus norvegicus]
 gi|149027880|gb|EDL83340.1| thymocyte nuclear protein 1, isoform CRA_b [Rattus norvegicus]
 gi|149027881|gb|EDL83341.1| thymocyte nuclear protein 1, isoform CRA_b [Rattus norvegicus]
          Length = 226

 Score =  205 bits (524), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 55/170 (32%), Positives = 79/170 (46%), Gaps = 31/170 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
            YWL+KSEP           +S +  Q + +    W GVRNYQA N +R M++ D+ FFY
Sbjct: 56  NYWLMKSEPESRLEKGIDMKFSIEDLQAQPKQTTCWDGVRNYQAWNFLRAMKLEDEAFFY 115

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   IVG+ +++   YPD T                +  W  VD+  V  M   +S
Sbjct: 116 HSNCKQPGIVGLMKIVKEAYPDHTQFEKNDPHYDPSSKEDNPKWSMVDVQFVRMMKRFIS 175

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
           L  +K   +        L SM L    RLSVQP+T +E+  +  + +   
Sbjct: 176 LDELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEFDFILSLEEAEP 225


>gi|148693367|gb|EDL25314.1| thymocyte nuclear protein 1, isoform CRA_c [Mus musculus]
          Length = 249

 Score =  205 bits (523), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 54/170 (31%), Positives = 78/170 (45%), Gaps = 31/170 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
            YWL+KSEP           +S +  + + +    W GVRNYQARN +R M++ D+ FFY
Sbjct: 79  NYWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFY 138

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   IVG+ +++   YPD T                   W  VD+  V  M   + 
Sbjct: 139 HSNCKQPGIVGLMKIVKEAYPDHTQFEKSNPHYDPSSKEDDPKWSMVDVQFVRMMKRFIP 198

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
           L  +K   +        L SM L    RLSVQP+T +E+  +  + +   
Sbjct: 199 LEELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEFDFILSLEETEP 248


>gi|21362343|ref|NP_653126.1| thymocyte nuclear protein 1 [Mus musculus]
 gi|81879701|sp|Q91YJ3|THYN1_MOUSE RecName: Full=Thymocyte nuclear protein 1; AltName: Full=Thymocyte
           protein Thy28; Short=mThy28
 gi|16741578|gb|AAH16594.1| Thymocyte nuclear protein 1 [Mus musculus]
 gi|23978374|dbj|BAC21100.1| thymocyte protein mThy28 [Mus musculus]
          Length = 226

 Score =  205 bits (523), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 54/170 (31%), Positives = 78/170 (45%), Gaps = 31/170 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
            YWL+KSEP           +S +  + + +    W GVRNYQARN +R M++ D+ FFY
Sbjct: 56  NYWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFY 115

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   IVG+ +++   YPD T                   W  VD+  V  M   + 
Sbjct: 116 HSNCKQPGIVGLMKIVKEAYPDHTQFEKSNPHYDPSSKEDDPKWSMVDVQFVRMMKRFIP 175

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
           L  +K   +        L SM L    RLSVQP+T +E+  +  + +   
Sbjct: 176 LEELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEFDFILSLEETEP 225


>gi|148693365|gb|EDL25312.1| thymocyte nuclear protein 1, isoform CRA_a [Mus musculus]
          Length = 261

 Score =  205 bits (523), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 54/170 (31%), Positives = 78/170 (45%), Gaps = 31/170 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
            YWL+KSEP           +S +  + + +    W GVRNYQARN +R M++ D+ FFY
Sbjct: 91  NYWLMKSEPESRLEKGIDMKFSIEDLKAQPKQTACWDGVRNYQARNFLRAMKLEDEAFFY 150

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   IVG+ +++   YPD T                   W  VD+  V  M   + 
Sbjct: 151 HSNCKQPGIVGLMKIVKEAYPDHTQFEKSNPHYDPSSKEDDPKWSMVDVQFVRMMKRFIP 210

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
           L  +K   +        L SM L    RLSVQP+T +E+  +  + +   
Sbjct: 211 LEELKTYHQAHKATGGPLKSMTLFTRQRLSVQPLTQEEFDFILSLEETEP 260


>gi|167569167|ref|ZP_02362041.1| hypothetical protein BoklC_04940 [Burkholderia oklahomensis C6786]
          Length = 153

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 58/148 (39%), Positives = 74/148 (50%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAASDHTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVCSTPYPDPTQFDPQSPYHDPKSTQETPRWVLVDVRFVRKTP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
             L+ M +L   +RLS+ PVT DE+  +
Sbjct: 120 DALADMRVLAKGNRLSITPVTPDEWRFI 147


>gi|220909340|ref|YP_002484651.1| hypothetical protein Cyan7425_3975 [Cyanothece sp. PCC 7425]
 gi|219865951|gb|ACL46290.1| protein of unknown function DUF55 [Cyanothece sp. PCC 7425]
          Length = 154

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 61/151 (40%), Positives = 80/151 (52%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M YWL+KSEP+ +SW   +        W GVRNYQARN MR +MR+GD+ FFYHSN   +
Sbjct: 1   MNYWLMKSEPNVFSWDDLKAAPEQTTCWEGVRNYQARNFMRDQMRLGDRVFFYHSNVKPQ 60

Query: 60  -IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI +V+   YPD  A  S               W  VDI  +     P++L  +K  
Sbjct: 61  IIAGIAQVVREAYPDSFAFDSQSKYFDPKSSPQQPTWFMVDIQYLQDFTPPITLEELKKI 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
             L SM+L+    RLSVQPVT  E+  +  +
Sbjct: 121 QTLESMMLLQKGCRLSVQPVTPAEWQTILNL 151


>gi|109109389|ref|XP_001088767.1| PREDICTED: thymocyte nuclear protein 1 [Macaca mulatta]
          Length = 225

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 81/167 (48%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP           +S +  + + +    W GVRNYQARN +R M++G++ FFY
Sbjct: 55  SHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFY 114

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   + 
Sbjct: 115 HSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWCMVDVQFVRMMKRFIP 174

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K+  +        L +M L    RLS+QP+T +E+  V  + +
Sbjct: 175 LAELKSYHQAHKATGGPLKNMTLFSRQRLSIQPLTQEEFDFVLSLEE 221


>gi|296447227|ref|ZP_06889157.1| protein of unknown function DUF55 [Methylosinus trichosporium OB3b]
 gi|296255286|gb|EFH02383.1| protein of unknown function DUF55 [Methylosinus trichosporium OB3b]
          Length = 136

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 68/137 (49%), Positives = 89/137 (64%), Gaps = 1/137 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WL KSEP+ WSW      G  G  W GVRN+ A+  M  M++G++GFFYHSN  + I
Sbjct: 1   MAHWLFKSEPATWSWDQMVAAGAEGTFWNGVRNHLAKQQMMAMQLGERGFFYHSNAEKAI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   +PD T + +  +  VD+ AV  +  PVSL  IKA+PRLS+MIL+ +SRLS
Sbjct: 61  VGIVEVIRTYHPDHT-DPTGKFGMVDVKAVEPLKTPVSLARIKADPRLSAMILVNNSRLS 119

Query: 121 VQPVTTDEYLEVCRMGK 137
           VQPVT  E+  +  M  
Sbjct: 120 VQPVTEAEWELILSMAG 136


>gi|88812442|ref|ZP_01127691.1| hypothetical protein NB231_13166 [Nitrococcus mobilis Nb-231]
 gi|88790228|gb|EAR21346.1| hypothetical protein NB231_13166 [Nitrococcus mobilis Nb-231]
          Length = 152

 Score =  204 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 53/151 (35%), Positives = 75/151 (49%), Gaps = 16/151 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKG-R 58
           M+YW++KSEPS +       +    + W GVRNYQARN +R +MR GD    YHSN    
Sbjct: 1   MSYWVMKSEPSVYGIDDLAAQPSQTDHWEGVRNYQARNMLRDQMRPGDLALLYHSNCPQP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI E++   YPD TA                  W  VD+     +   + L  +KAN
Sbjct: 61  GVVGIMEIVRAGYPDHTAFDPESKYFDPKSDPDRPRWYMVDVRFKRRLARTIPLTELKAN 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           P L+   LI   +RLS+ PV+ + +  +  M
Sbjct: 121 PALAETPLIRRGNRLSIMPVSAEHWQAILDM 151


>gi|186476968|ref|YP_001858438.1| hypothetical protein Bphy_2217 [Burkholderia phymatum STM815]
 gi|184193427|gb|ACC71392.1| protein of unknown function DUF55 [Burkholderia phymatum STM815]
          Length = 156

 Score =  204 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 55/150 (36%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLANAPQRTLPWTGVRNYQARNFMRDIMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT                   W  VD+     +   + L  ++ +
Sbjct: 61  GIAGIAEVSSTPYPDPTQFDPKSPYYDERSNRETPRWTLVDVVFKKKIA-LIPLAELREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
           P L+ M +L   +RLS+ PVT  E+  + +
Sbjct: 120 PELADMRVLAKGNRLSITPVTEAEWAFITK 149


>gi|167561915|ref|ZP_02354831.1| hypothetical protein BoklE_05080 [Burkholderia oklahomensis EO147]
          Length = 153

 Score =  204 bits (519), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 58/148 (39%), Positives = 74/148 (50%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASINDLAAASDHTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVCSTPYPDPTQFDPQSPYHDPKSTQETPRWVLVDVRFVRKTP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
             L+ M +L   +RLS+ PVT DE+  +
Sbjct: 120 DALADMRVLAKGNRLSITPVTPDEWRFI 147


>gi|160872258|ref|ZP_02062390.1| thymocyte nuclear protein 1 (Thymocyte protein Thy28) (mThy28)
           [Rickettsiella grylli]
 gi|159121057|gb|EDP46395.1| thymocyte nuclear protein 1 (Thymocyte protein Thy28) (mThy28)
           [Rickettsiella grylli]
          Length = 166

 Score =  203 bits (517), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 54/147 (36%), Positives = 79/147 (53%), Gaps = 14/147 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-RE 59
           M YWL+KSEP+ +S      + +  E W GVRNYQARN ++ M+ GD  FFYHS+     
Sbjct: 1   MNYWLMKSEPTCFSIYDLAKRPQQREPWDGVRNYQARNFLKAMKKGDLAFFYHSSCPQPG 60

Query: 60  IVGIFEVITCTYPDPTA------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           IVGI +++   YPD TA                 W  VD+  V      ++L +++  P+
Sbjct: 61  IVGIIKIVKTAYPDKTAAFPLDHSHHPKNTTKPRWYAVDVQLVRIFKSIITLESLRKEPQ 120

Query: 108 LSSM-ILIVSSRLSVQPVTTDEYLEVC 133
           L +M +L   +RLSV P+TT E+  + 
Sbjct: 121 LKTMRLLQKGNRLSVMPLTTLEWQHLM 147


>gi|330951217|gb|EGH51477.1| hypothetical protein PSYCIT7_07434 [Pseudomonas syringae Cit 7]
          Length = 149

 Score =  203 bits (517), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G     W GVRNYQARN +R M  GD  FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGNA--RWDGVRNYQARNFLRAMTEGDAFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K   
Sbjct: 59  IAGIAKIARSAYPDPTALDPESHYHDAKATEEKNPWSAIDVEFVENFKRVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|256424428|ref|YP_003125081.1| hypothetical protein Cpin_5451 [Chitinophaga pinensis DSM 2588]
 gi|256039336|gb|ACU62880.1| protein of unknown function DUF55 [Chitinophaga pinensis DSM 2588]
          Length = 137

 Score =  203 bits (517), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 62/137 (45%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP ++SW      G+    W GVRNYQARNN++ M  GD   FYHSN+G  +
Sbjct: 1   MNYWLVKSEPFKYSWDQFVKDGK--TFWDGVRNYQARNNLKGMEKGDLVLFYHSNEGLAV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V    Y DPT    + W  VD+  V     PV+L  +KA  RL ++ LI   RLS
Sbjct: 59  VGIAKVAKAHYQDPTTPDPN-WVVVDLQPVKPFKTPVTLAQMKAEKRLENLSLIRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V  VT +E+  +  MG+
Sbjct: 118 VCAVTEEEFDTILEMGE 134


>gi|330900024|gb|EGH31443.1| hypothetical protein PSYJA_21697 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 149

 Score =  202 bits (516), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGNA--RWDGVRNYQARNFLRAMAKGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGKIARSAYPDPTALDPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|76809962|ref|YP_332595.1| hypothetical protein BURPS1710b_1184 [Burkholderia pseudomallei
           1710b]
 gi|76579415|gb|ABA48890.1| conserved hypothetical protein [Burkholderia pseudomallei 1710b]
          Length = 170

 Score =  202 bits (516), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 18  MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 77

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 78  GIAGLARVSSTPYPDPTQFDSHSPYHDPKSTREAPRWVLVDVRFVRKSP-LVPLAALREH 136

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 137 EALANMRVLAKGNRLSITPVTPNEWRFITQ 166


>gi|161524015|ref|YP_001579027.1| hypothetical protein Bmul_0836 [Burkholderia multivorans ATCC
           17616]
 gi|160341444|gb|ABX14530.1| protein of unknown function DUF55 [Burkholderia multivorans ATCC
           17616]
          Length = 194

 Score =  202 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 42  MQFWLMKSEPDEASIDDLAHAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 101

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  VSL A++ +
Sbjct: 102 GIAGLAEVASTPYPDPTQFDPKSPYYDPKSSPESPRWLLVDVRFVKKTP-LVSLAALREH 160

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 161 DELADMRVLARGNRLSITPVTRAEWKFITE 190


>gi|167823154|ref|ZP_02454625.1| hypothetical protein Bpseu9_05723 [Burkholderia pseudomallei 9]
 gi|167893253|ref|ZP_02480655.1| hypothetical protein Bpse7_05775 [Burkholderia pseudomallei 7894]
 gi|167909950|ref|ZP_02497041.1| hypothetical protein Bpse112_05621 [Burkholderia pseudomallei 112]
 gi|226194431|ref|ZP_03790029.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|254190829|ref|ZP_04897336.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|254261399|ref|ZP_04952453.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
 gi|157938504|gb|EDO94174.1| conserved hypothetical protein [Burkholderia pseudomallei Pasteur
           52237]
 gi|225933516|gb|EEH29505.1| conserved hypothetical protein [Burkholderia pseudomallei Pakistan
           9]
 gi|254220088|gb|EET09472.1| conserved hypothetical protein [Burkholderia pseudomallei 1710a]
          Length = 153

 Score =  202 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSHSPYHDPKSTREAPRWVLVDVRFVRKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEWRFITQ 149


>gi|312132184|ref|YP_003999524.1| hypothetical protein Lbys_3523 [Leadbetterella byssophila DSM
           17132]
 gi|311908730|gb|ADQ19171.1| protein of unknown function DUF55 [Leadbetterella byssophila DSM
           17132]
          Length = 136

 Score =  202 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 69/136 (50%), Positives = 86/136 (63%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP ++SW     KG  G+ W GVRNY ARNN++ M+ GD  FFYHSN+G EI
Sbjct: 1   MNYWLVKSEPFKFSWDTFVSKG--GDMWDGVRNYAARNNLKAMKEGDLVFFYHSNEGLEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ +V    YPDPTA+    W  VD+  V  +  PVSL  IKA+P L  M ++  SRLS
Sbjct: 59  VGLAKVTKEHYPDPTADD-PKWVVVDLVPVKKLNKPVSLAQIKADPVLQQMAIVRLSRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V PVT  E+  V  + 
Sbjct: 118 VSPVTPTEFDRVMDLA 133


>gi|332666965|ref|YP_004449753.1| hypothetical protein Halhy_5054 [Haliscomenobacter hydrossis DSM
           1100]
 gi|332335779|gb|AEE52880.1| Uncharacterized protein family UPF0310 [Haliscomenobacter hydrossis
           DSM 1100]
          Length = 134

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 65/137 (47%), Positives = 90/137 (65%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WLVKSEP  +S+   + +GR    W GVRNY ARNN+R M+ GD+  FYHSN G E+
Sbjct: 1   MNFWLVKSEPDAYSYDKLEAEGRG--MWDGVRNYAARNNLRAMKEGDQVLFYHSNIGMEV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V    YPDPTA +S  W  V++  V  +  P++L  IKA P L+++ LI  SRLS
Sbjct: 59  VGICQVAKEHYPDPTA-ESGDWSVVEVIPVRRIKRPITLKEIKATPELANIALIKQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V P+T +E+ ++ +M K
Sbjct: 118 VMPLTAEEFEKILKMSK 134


>gi|302186800|ref|ZP_07263473.1| hypothetical protein Psyrps6_10645 [Pseudomonas syringae pv.
           syringae 642]
          Length = 149

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGNA--RWDGVRNYQARNFLRAMTEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGKIARSAYPDPTALDPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|193222249|emb|CAL60905.2| conserved hypothetical protein [Herminiimonas arsenicoxydans]
          Length = 154

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 73/150 (48%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S            AWTGVRNYQARN MR  M+ GD   FYHS+    
Sbjct: 1   MRYWLMKSEPGEVSIDDALAAPNQTVAWTGVRNYQARNFMRDAMQPGDGVLFYHSSCAEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPD T                   W  VD+  +      +SL  ++  
Sbjct: 61  GIAGLAEVASTPYPDETQFDPASHYFDPKATRETPRWMLVDVR-IRKKTRLLSLAELRTR 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
           P L+ M +L   SRLS+ PVT  E+  +C+
Sbjct: 120 PELADMVVLQKGSRLSITPVTAQEWQFICK 149


>gi|260835998|ref|XP_002612994.1| hypothetical protein BRAFLDRAFT_120829 [Branchiostoma floridae]
 gi|229298376|gb|EEN69003.1| hypothetical protein BRAFLDRAFT_120829 [Branchiostoma floridae]
          Length = 243

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 64/174 (36%), Positives = 82/174 (47%), Gaps = 35/174 (20%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGE---------AWTGVRNYQARNNMR-KMRVGDKGFF 51
           ++WL+KSEP     K    K  + E          W GVRNYQARN MR +MRVG K FF
Sbjct: 31  SHWLMKSEPESRIEKGIDVKFGITELKAEPNQTACWDGVRNYQARNFMRDQMRVGHKAFF 90

Query: 52  YHSN-KGREIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPV 97
           YHSN K   I GI E++  +YPD T                +  W  VD+  V  +   +
Sbjct: 91  YHSNCKEPGIAGIVEIVKESYPDHTQFDSKDPHYDSSSKKDNPKWFMVDVKFVRMLKRFI 150

Query: 98  SLMAIKANP--------RLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL 143
            L  +KA           L +M L   +RLSVQPVT +E+  V  +     PPL
Sbjct: 151 PLSELKALHLEHKSTGGALQNMALFTRARLSVQPVTKEEFDFVVSLEG---PPL 201


>gi|209965641|ref|YP_002298556.1| hypothetical protein RC1_2357 [Rhodospirillum centenum SW]
 gi|209959107|gb|ACI99743.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 137

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 66/139 (47%), Positives = 91/139 (65%), Gaps = 3/139 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MA+WLVKSEP ++SW      GR    W GVRN+QA NN++ MRVGD+ FFYHSN+G EI
Sbjct: 1   MAHWLVKSEPFKYSWDRFVADGR--THWDGVRNHQAANNLKAMRVGDRAFFYHSNEGLEI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDP ++ S  +  VD+  V  +  PV+L  +K +P LS M L+  SRLS
Sbjct: 59  VGVAEVVREYYPDP-SDGSGRFGMVDLAPVLPVRVPVTLKQMKEDPLLSQMQLVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           V  VT +++  VC +  ++
Sbjct: 118 VSAVTPEQWDRVCALAGIT 136


>gi|152996918|ref|YP_001341753.1| hypothetical protein Mmwyl1_2907 [Marinomonas sp. MWYL1]
 gi|150837842|gb|ABR71818.1| protein of unknown function DUF55 [Marinomonas sp. MWYL1]
          Length = 152

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 55/146 (37%), Positives = 74/146 (50%), Gaps = 17/146 (11%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGR-EI 60
            YWL+KSEP  +S    +        W GVRNYQARN M++M  GD  FFYHS+     I
Sbjct: 3   NYWLMKSEPDAFSIDDLKRL--KHSPWDGVRNYQARNFMKEMNEGDLVFFYHSSCSPAGI 60

Query: 61  VGIFEVITCTYPDPT-------------AEQSSCWECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ +V    YPD T               ++  W  VD+  V   P  ++L  +K NP 
Sbjct: 61  VGVAKVCKSAYPDHTSWDASSPYFDAKSTPENPRWYMVDVEFVEKWPSILTLAELKQNPE 120

Query: 108 LSSMIL-IVSSRLSVQPVTTDEYLEV 132
           L+ M+L    SRLSV P+T  E+  +
Sbjct: 121 LTEMLLTKKGSRLSVMPITQSEWEYI 146


>gi|262277843|ref|ZP_06055636.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224946|gb|EEY75405.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 138

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 87/137 (63%), Gaps = 1/137 (0%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
            YWLVKSEP+ WS + Q+  G  G  W GVRNYQA NN++ M+ GD  FFYHSN G+EIV
Sbjct: 3   NYWLVKSEPNVWSIEQQKKSGSKGTIWDGVRNYQAANNLKAMKKGDLCFFYHSNIGKEIV 62

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           G+ EVI   + DPT ++   +  V +     +  PV+L  IK N  LS++ LI  SRLSV
Sbjct: 63  GVVEVIKEYFIDPTDKEK-RFVAVQLKFKQKLKFPVTLENIKQNKELSNLALIKQSRLSV 121

Query: 122 QPVTTDEYLEVCRMGKL 138
            P+ +  +  +C++GK+
Sbjct: 122 MPIDSKSWKIICKLGKI 138


>gi|53718615|ref|YP_107601.1| hypothetical protein BPSL0973 [Burkholderia pseudomallei K96243]
 gi|67639837|ref|ZP_00438668.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|121601022|ref|YP_993639.1| hypothetical protein BMASAVP1_A2330 [Burkholderia mallei SAVP1]
 gi|124385947|ref|YP_001028900.1| hypothetical protein BMA10229_A2956 [Burkholderia mallei NCTC
           10229]
 gi|126451040|ref|YP_001081186.1| hypothetical protein BMA10247_1642 [Burkholderia mallei NCTC 10247]
 gi|167004005|ref|ZP_02269782.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
 gi|167718536|ref|ZP_02401772.1| hypothetical protein BpseD_05907 [Burkholderia pseudomallei DM98]
 gi|167814699|ref|ZP_02446379.1| hypothetical protein Bpse9_06127 [Burkholderia pseudomallei 91]
 gi|167901711|ref|ZP_02488916.1| hypothetical protein BpseN_05490 [Burkholderia pseudomallei NCTC
           13177]
 gi|217420265|ref|ZP_03451771.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|254178650|ref|ZP_04885305.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|254199360|ref|ZP_04905726.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|254205674|ref|ZP_04912026.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|254357833|ref|ZP_04974106.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|52209029|emb|CAH34969.1| conserved hypothetical protein [Burkholderia pseudomallei K96243]
 gi|121229832|gb|ABM52350.1| conserved hypothetical protein [Burkholderia mallei SAVP1]
 gi|124293967|gb|ABN03236.1| conserved hypothetical protein [Burkholderia mallei NCTC 10229]
 gi|126243910|gb|ABO07003.1| conserved hypothetical protein [Burkholderia mallei NCTC 10247]
 gi|147748956|gb|EDK56030.1| conserved hypothetical protein [Burkholderia mallei FMH]
 gi|147753117|gb|EDK60182.1| conserved hypothetical protein [Burkholderia mallei JHU]
 gi|148026960|gb|EDK84981.1| conserved hypothetical protein [Burkholderia mallei 2002721280]
 gi|160699689|gb|EDP89659.1| conserved hypothetical protein [Burkholderia mallei ATCC 10399]
 gi|217397569|gb|EEC37585.1| conserved hypothetical protein [Burkholderia pseudomallei 576]
 gi|238520445|gb|EEP83905.1| conserved hypothetical protein [Burkholderia mallei GB8 horse 4]
 gi|243060563|gb|EES42749.1| conserved hypothetical protein [Burkholderia mallei PRL-20]
          Length = 153

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWVLVDVRFVRKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEWRFITQ 149


>gi|330813351|ref|YP_004357590.1| protein of unknown function DUF55 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486446|gb|AEA80851.1| protein of unknown function DUF55 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 137

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 62/138 (44%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP+ WS   Q+  G  G AW GVRNYQA NN+++M  GD  FFYHSN G+EI
Sbjct: 1   MKYWLMKSEPNVWSIDQQKKVGVKGTAWDGVRNYQAANNLKQMSKGDLCFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   + D T      +  V +     +  PV+L  IK    L  + L+  SRLS
Sbjct: 61  VGIVEVIKTAFIDVTDPDK-RFVAVQVKFKQKLNQPVTLENIKKTKELQDLSLVKQSRLS 119

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V  +    +  +C+MGKL
Sbjct: 120 VTSIDPKSWKILCKMGKL 137


>gi|189425794|ref|YP_001952971.1| hypothetical protein Glov_2738 [Geobacter lovleyi SZ]
 gi|189422053|gb|ACD96451.1| protein of unknown function DUF55 [Geobacter lovleyi SZ]
          Length = 154

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 55/154 (35%), Positives = 85/154 (55%), Gaps = 15/154 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M YWL KSEP  +S++  Q +    E W GVRN+QARN +R  ++ GD+  FYHS+    
Sbjct: 1   MRYWLFKSEPGCFSFQDLQARPNATEQWDGVRNFQARNFLRDEIKPGDRVLFYHSSIPEP 60

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            ++G+  V+   YPD TA                  W  VD+ A  ++P  V L  I+ +
Sbjct: 61  AVIGLCSVVREGYPDHTALDPAADHFDPKATPDKPIWYMVDVRADQALPSEVPLAVIREH 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLS 139
           P L+ M L+  SRLS+QP+T +++  + ++G L+
Sbjct: 121 PLLTGMPLVNRSRLSIQPLTKEQFETILQLGGLA 154


>gi|167580147|ref|ZP_02373021.1| hypothetical protein BthaT_18480 [Burkholderia thailandensis TXDOH]
 gi|167618253|ref|ZP_02386884.1| hypothetical protein BthaB_18241 [Burkholderia thailandensis Bt4]
 gi|257139939|ref|ZP_05588201.1| hypothetical protein BthaA_12175 [Burkholderia thailandensis E264]
          Length = 153

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ +V +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAQVSSTPYPDPTQFDPQSPYHDPKSTRESPRWVLVDVRFVRKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT DE+  + +
Sbjct: 120 DALADMRVLAKGNRLSITPVTPDEWRFITQ 149


>gi|330938766|gb|EGH42300.1| hypothetical protein PSYPI_07710 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 149

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G     W GVRNYQARN +R M  GD  FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQGLGNA--RWDGVRNYQARNFLRAMTEGDAFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGKIARSAYPDPTALNPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|220935932|ref|YP_002514831.1| protein of unknown function DUF55 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997242|gb|ACL73844.1| protein of unknown function DUF55 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 152

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 56/153 (36%), Positives = 74/153 (48%), Gaps = 18/153 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKG-R 58
           MAYWL+KSEP  +     +      E W GVRNYQARN MR  M+ GD+ FFYHSN    
Sbjct: 1   MAYWLMKSEPDVFGIDDLKR--VKVEPWDGVRNYQARNMMRDEMKQGDEVFFYHSNCEVP 58

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+  V    YPD TA               +  W  VD+         + L  +K  
Sbjct: 59  GIVGLMTVAREGYPDDTAFNPEAKYYDPKSDPDNPRWYRVDVRFKRKFKETIPLSDLKTY 118

Query: 106 PRLSSMILIV-SSRLSVQPVTTDEYLEVCRMGK 137
           P L+ M L+   +RLS+ PV+  E+  +  + K
Sbjct: 119 PELADMALVRKGNRLSIMPVSPQEWDFIMGLVK 151


>gi|167737566|ref|ZP_02410340.1| hypothetical protein Bpse14_05845 [Burkholderia pseudomallei 14]
 gi|254298248|ref|ZP_04965700.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
 gi|157808221|gb|EDO85391.1| conserved hypothetical protein [Burkholderia pseudomallei 406e]
          Length = 153

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSHSPYHDPKSTREAPRWMLVDVRFVRKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEWRFITQ 149


>gi|83720482|ref|YP_441387.1| hypothetical protein BTH_I0831 [Burkholderia thailandensis E264]
 gi|83654307|gb|ABC38370.1| Family of unknown function (DUF589) superfamily [Burkholderia
           thailandensis E264]
          Length = 170

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 18  MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 77

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ +V +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 78  GIAGLAQVSSTPYPDPTQFDPQSPYHDPKSTRESPRWVLVDVRFVRKSP-LVPLAALREH 136

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT DE+  + +
Sbjct: 137 DALADMRVLAKGNRLSITPVTPDEWRFITQ 166


>gi|254181429|ref|ZP_04888026.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
 gi|184211967|gb|EDU09010.1| conserved hypothetical protein [Burkholderia pseudomallei 1655]
          Length = 153

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V      V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWVLVDVRFVRK-SLLVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEWRFITQ 149


>gi|152981413|ref|YP_001352318.1| hypothetical protein mma_0628 [Janthinobacterium sp. Marseille]
 gi|151281490|gb|ABR89900.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille]
          Length = 152

 Score =  202 bits (514), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 61/150 (40%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNK-GR 58
           M YWL+KSEPSE S        +   AWTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPSEVSIDDAWSAPKRTVAWTGVRNYQARNFMRDAMQLGDGVLFYHSSCAEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ EV +  YPD T  +                W  VD+  +      +SL  ++  
Sbjct: 61  GIVGLAEVASTAYPDHTQFEPDSHYYDPKATQETPRWVMVDVR-IRKKTRLLSLAEMRTM 119

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCR 134
           P LS M+L+   SRLS+ PVT DE+  +C 
Sbjct: 120 PELSGMVLLQRGSRLSITPVTADEWDFICA 149


>gi|134281102|ref|ZP_01767811.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
 gi|134247408|gb|EBA47493.1| conserved hypothetical protein [Burkholderia pseudomallei 305]
          Length = 153

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWVLVDVRFVRKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEWRFITQ 149


>gi|77918916|ref|YP_356731.1| hypothetical protein Pcar_1312 [Pelobacter carbinolicus DSM 2380]
 gi|77544999|gb|ABA88561.1| uncharacterized conserved protein [Pelobacter carbinolicus DSM
           2380]
          Length = 165

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 58/157 (36%), Positives = 82/157 (52%), Gaps = 16/157 (10%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
            YWL+KSEP  +S    +D       W GVRNYQARN +R  ++ GD   FYHSN +   
Sbjct: 6   RYWLMKSEPGCFSIDDLKDCPDGISPWDGVRNYQARNLLRDEIKAGDGVLFYHSNIREPA 65

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+  V+   YPD TA                  W  VD+  V  +  P++   ++ +P
Sbjct: 66  IVGVARVVRAGYPDHTARDPQSEHFDPRSTDAAPIWYMVDVQYVAHLVRPLTRDDLRQHP 125

Query: 107 RLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGKLSNPP 142
           RL  M +L   +RLSVQPV+ +++ +V R G +S  P
Sbjct: 126 RLMDMAVLKRGNRLSVQPVSEEQWRDVLRFGGMSELP 162


>gi|149280361|ref|ZP_01886482.1| hypothetical protein PBAL39_12608 [Pedobacter sp. BAL39]
 gi|149228910|gb|EDM34308.1| hypothetical protein PBAL39_12608 [Pedobacter sp. BAL39]
          Length = 135

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 86/136 (63%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WLVKSEP ++SW    + GR    W GVRNYQARNN++ M+ GD   FYHSN+G+ +
Sbjct: 1   MNHWLVKSEPFKYSWDKFNEDGR--TFWDGVRNYQARNNLKAMKEGDLVLFYHSNEGKHV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT + ++ W  VD+  V ++  PV+L  IKA   L  + LI   RLS
Sbjct: 59  VGIAKVVKEFYQDPTTDDTN-WVVVDLSPVEALKTPVTLEQIKAEESLKDISLIRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+  +E+ ++  MG
Sbjct: 118 VMPLKAEEFDKILEMG 133


>gi|327482771|gb|AEA86081.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 149

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 61/150 (40%), Positives = 81/150 (54%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           M YWL+KSEP E+S +  +  G     W GVRNYQARN +R+M+ GD  FFYHS+     
Sbjct: 1   MPYWLMKSEPDEFSIQDLKKLGHG--RWDGVRNYQARNFLRQMQEGDHFFFYHSSCAEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+  VI   YPDPTA                + W  VD+  V +   P++L  +KANP
Sbjct: 59  IAGVGRVIRSAYPDPTALDPESPYHDGKASSEANPWSAVDVEFVEAFSAPLALARLKANP 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L  + L+   SRLSV PV+  E+  +  M
Sbjct: 119 ALRELALVKKGSRLSVMPVSDTEWQAILAM 148


>gi|167917988|ref|ZP_02505079.1| hypothetical protein BpseBC_05493 [Burkholderia pseudomallei
           BCC215]
          Length = 153

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWMLVDVRFVRKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEWRFITQ 149


>gi|126441012|ref|YP_001058075.1| hypothetical protein BURPS668_1025 [Burkholderia pseudomallei 668]
 gi|254196383|ref|ZP_04902807.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
 gi|126220505|gb|ABN84011.1| conserved hypothetical protein [Burkholderia pseudomallei 668]
 gi|169653126|gb|EDS85819.1| conserved hypothetical protein [Burkholderia pseudomallei S13]
          Length = 153

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSHSPYHDPKSTREAPRWMLVDVRFVRKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEWRFITQ 149


>gi|254500353|ref|ZP_05112504.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
 gi|222436424|gb|EEE43103.1| conserved hypothetical protein [Labrenzia alexandrii DFL-11]
          Length = 141

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 82/141 (58%), Positives = 100/141 (70%), Gaps = 1/141 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP +WSW+ Q+ KG  GE W G+RNYQARNNMR M +GDK FFYHSN G+E+
Sbjct: 1   MQYWLIKSEPDKWSWEQQKAKGDAGEQWDGIRNYQARNNMRAMEIGDKAFFYHSNIGKEV 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV +  +PD T +    WECVD  AVC MP PV+L  +KA  RL  M L+ S RLS
Sbjct: 61  VGVVEVCSDIHPDTTIDD-PRWECVDFKAVCDMPKPVTLAQVKAESRLEKMSLVTSMRLS 119

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           VQPVT +E+  VC MG +S P
Sbjct: 120 VQPVTEEEWKIVCEMGGMSKP 140


>gi|237811293|ref|YP_002895744.1| hypothetical protein GBP346_A1020 [Burkholderia pseudomallei
           MSHR346]
 gi|237503033|gb|ACQ95351.1| conserved hypothetical protein [Burkholderia pseudomallei MSHR346]
          Length = 153

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V      V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWVLVDVRFVRK-SSLVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEWRFITQ 149


>gi|330977242|gb|EGH77198.1| hypothetical protein PSYAP_11025 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 149

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G     W GVRNYQARN +R M  GD  FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGNA--RWDGVRNYQARNFLRAMAEGDAFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA             E+ + W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGKIARSAYPDPTALDPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILTL 148


>gi|209521441|ref|ZP_03270150.1| protein of unknown function DUF55 [Burkholderia sp. H160]
 gi|209498127|gb|EDZ98273.1| protein of unknown function DUF55 [Burkholderia sp. H160]
          Length = 152

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLANAPHRTLPWTGVRNYQARNFMRDVMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT                   W  VD+     +P  +SL A++ +
Sbjct: 61  GIAGIAEVSSTAYPDPTQFDKKSPYYDAKSSPETPRWLLVDVVFKKKIP-LISLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L  M +L   +RLS+ PVT  E+  + +
Sbjct: 120 AELEDMRVLAKGNRLSITPVTEAEWRFITK 149


>gi|121997970|ref|YP_001002757.1| hypothetical protein Hhal_1180 [Halorhodospira halophila SL1]
 gi|121589375|gb|ABM61955.1| protein of unknown function DUF55 [Halorhodospira halophila SL1]
          Length = 154

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 54/153 (35%), Positives = 77/153 (50%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           M  W++KSEP  +         +  + W GVRNYQ RN +R  MR GD  FFYHSN +  
Sbjct: 1   MNRWVMKSEPDVFGIDDLAAAPQGTDRWDGVRNYQVRNMIRDHMRPGDAAFFYHSNTRPP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            +VG+ EV++  YPDPTA                  W CVD+     +P  V+L  ++  
Sbjct: 61  GVVGVMEVVSGPYPDPTAFDPDDLHYDPKSTPEAPRWYCVDVRFRERLPRQVTLQELREC 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
           P L    LI   +RLS+ PVT  ++  + R+ +
Sbjct: 121 PDLEGFPLIRRGNRLSIVPVTEAQWAVIRRLAE 153


>gi|212704335|ref|ZP_03312463.1| hypothetical protein DESPIG_02390 [Desulfovibrio piger ATCC 29098]
 gi|212672297|gb|EEB32780.1| hypothetical protein DESPIG_02390 [Desulfovibrio piger ATCC 29098]
          Length = 153

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 80/150 (53%), Gaps = 15/150 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL KSEP  +SW+  +       +W GVRNYQARN M+ M+ GD GFFYHS     I
Sbjct: 1   MNYWLFKSEPGCYSWQDLEAAPGQTTSWDGVRNYQARNFMKAMKKGDLGFFYHSGADPSI 60

Query: 61  VGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANPR 107
           VG+ EV+   YPD TA+                 WE VD+    ++P  +S   + A+  
Sbjct: 61  VGVVEVVREAYPDHTAQDPENNHFDPRATPEKPIWEMVDVRLHKALPA-LSRKELSAHAA 119

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCRMG 136
           L+ M L+   SRLSVQPV+ + +  +  + 
Sbjct: 120 LAGMELMRRGSRLSVQPVSAEAFEYIMHLA 149


>gi|126452025|ref|YP_001065312.1| hypothetical protein BURPS1106A_1032 [Burkholderia pseudomallei
           1106a]
 gi|167844718|ref|ZP_02470226.1| hypothetical protein BpseB_05463 [Burkholderia pseudomallei B7210]
 gi|242317666|ref|ZP_04816682.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
 gi|126225667|gb|ABN89207.1| conserved hypothetical protein [Burkholderia pseudomallei 1106a]
 gi|126953063|gb|ABO28367.1| protein 3SC1 [Burkholderia pseudomallei]
 gi|242140905|gb|EES27307.1| conserved hypothetical protein [Burkholderia pseudomallei 1106b]
          Length = 153

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S             WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLAAAPDQTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+  V +  YPDPT   S               W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLARVSSTPYPDPTQFDSRSPYHDPKSTREAPRWMLVDVRFVRKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L   +RLS+ PVT +E+  + +
Sbjct: 120 EALANMRVLAKGNRLSITPVTPNEWRFITQ 149


>gi|218888067|ref|YP_002437388.1| hypothetical protein DvMF_2983 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218759021|gb|ACL09920.1| protein of unknown function DUF55 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 155

 Score =  200 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 14/149 (9%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
            +WL K+EP  +S            +W GVRNYQARN MR+MR+GD G FYHS     + 
Sbjct: 3   RHWLFKTEPGCFSIAHLAALPGATSSWDGVRNYQARNFMREMRLGDLGLFYHSVTNPSVA 62

Query: 62  GIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+ E++   YPD TA                  W  VD+  V +   PV L  ++  P L
Sbjct: 63  GVVEIVREAYPDHTAWDPEDRHFDPASTPDKPRWFMVDVRLVRTFAQPVPLALLRTLPEL 122

Query: 109 SSMILIV-SSRLSVQPVTTDEYLEVCRMG 136
           + M L+   SRLSVQPV+  EY  V R+ 
Sbjct: 123 ADMELLRKGSRLSVQPVSPQEYATVLRLA 151


>gi|254251674|ref|ZP_04944992.1| hypothetical protein BDAG_00866 [Burkholderia dolosa AUO158]
 gi|124894283|gb|EAY68163.1| hypothetical protein BDAG_00866 [Burkholderia dolosa AUO158]
          Length = 153

 Score =  200 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLANAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVASTPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVRFVKKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEWRFITE 149


>gi|300772032|ref|ZP_07081902.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Sphingobacterium
           spiritivorum ATCC 33861]
 gi|300760335|gb|EFK57161.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Sphingobacterium
           spiritivorum ATCC 33861]
          Length = 137

 Score =  200 bits (511), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 59/136 (43%), Positives = 84/136 (61%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M Y+LVKSEP ++SW+     G+    W GVRNYQARNN++ M+ GD   FYHSN+G+E+
Sbjct: 1   MNYFLVKSEPFKYSWEQFNKDGQ--TFWDGVRNYQARNNIKAMKEGDLVLFYHSNEGKEV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT E    W  VD+  V +   PV+L  IK++  L  + L+   RLS
Sbjct: 59  VGIAKVVKEFYHDPTTEDE-RWVVVDLAPVETFKNPVTLEQIKSDTLLQDVALVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+  +E+  +  +G
Sbjct: 118 VMPLKPEEFDRIVELG 133


>gi|114326937|ref|YP_744094.1| hypothetical protein GbCGDNIH1_0273 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114315111|gb|ABI61171.1| hypothetical protein GbCGDNIH1_0273 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 153

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 73/143 (51%), Positives = 90/143 (62%), Gaps = 9/143 (6%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           AYWLVKSEP  +SW  Q   G   E WTGVRN+ A+ N+  MRVGD  FFYHSN GREIV
Sbjct: 3   AYWLVKSEPDAFSWDQQVAHG--VEPWTGVRNHAAKRNLATMRVGDLAFFYHSNIGREIV 60

Query: 62  GIFEVITCTYPDPTA-------EQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILI 114
           G+ +V+   YPDPT        + S+ W CVD+ AV  MP PV+L  IKA P L+ + L+
Sbjct: 61  GVVQVVREAYPDPTVEADELSRDGSNPWLCVDMRAVGKMPSPVTLAMIKAEPGLADLALV 120

Query: 115 VSSRLSVQPVTTDEYLEVCRMGK 137
             SRLSV  V+   +  +CRMG 
Sbjct: 121 RQSRLSVSSVSPQHWAILCRMGG 143


>gi|126327514|ref|XP_001374343.1| PREDICTED: similar to Thymocyte nuclear protein 1 [Monodelphis
           domestica]
          Length = 231

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 74/165 (44%), Gaps = 31/165 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
            YWL+KSEP           +  +  + + R    W GVRNYQARN +R M++G+K FFY
Sbjct: 61  RYWLMKSEPESRLEKGIDVKFGIEDLKAQPRQTACWDGVRNYQARNFLRTMKLGEKAFFY 120

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  +      + 
Sbjct: 121 HSNCKEPGIAGLVKIVKEAYPDHTQFEKDSPHYDPSSKKDNPKWSMVDVQFIRMTKRFIP 180

Query: 99  LMAIKANP--------RLSSMILIVSSRLSVQPVTTDEYLEVCRM 135
           L  +K            L +M L    RLSVQPVT  E+  V  +
Sbjct: 181 LAELKGYYHAHKDIGGPLQNMALFTRQRLSVQPVTQGEFDFVLSL 225


>gi|317484552|ref|ZP_07943460.1| hypothetical protein HMPREF0179_00811 [Bilophila wadsworthia 3_1_6]
 gi|316924213|gb|EFV45391.1| hypothetical protein HMPREF0179_00811 [Bilophila wadsworthia 3_1_6]
          Length = 166

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 59/151 (39%), Positives = 78/151 (51%), Gaps = 15/151 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGRE 59
           M +WL KSEP  +S+   ++      +W GVRNYQARN MR  M+ GD GFFYHS K  E
Sbjct: 1   MRHWLFKSEPDCYSFTDLENAPGQTTSWDGVRNYQARNFMRDDMKKGDLGFFYHSGKNPE 60

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI E++   +PD TA+                 W  VD+  V     PV    ++  P
Sbjct: 61  IAGIVEIVREGHPDLTAQDPEAGHFDPKATPGDPRWYMVDVKLVRRFEPPVPRSLLRFVP 120

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRMG 136
            L+ M L+   SRLSVQPV  + Y  + R+ 
Sbjct: 121 ELAGMELMKTGSRLSVQPVEAEAYAAIVRLA 151


>gi|312795345|ref|YP_004028267.1| hypothetical protein RBRH_03143 [Burkholderia rhizoxinica HKI 454]
 gi|312167120|emb|CBW74123.1| Hypothetical protein RBRH_03143 [Burkholderia rhizoxinica HKI 454]
          Length = 169

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 53/148 (35%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YW++KSEP E S             WTGVRNYQARN MR  M+ GD   FYHS+    
Sbjct: 15  MHYWVMKSEPDEASIDDLAASPTRTLPWTGVRNYQARNFMRDGMQPGDGVLFYHSSCAEP 74

Query: 59  EIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                +  W  VD+  V  +   + L  ++ +
Sbjct: 75  GIAGLAEVASGPYPDPTQFDAASPYYDPKSRRDAPRWLLVDVRFVKKL-RLIPLSELRTH 133

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
             L+ M +L   +RLS+ PVT D++  +
Sbjct: 134 AALADMQVLARGNRLSITPVTPDQWRYI 161


>gi|296162285|ref|ZP_06845079.1| protein of unknown function DUF55 [Burkholderia sp. Ch1-1]
 gi|295887439|gb|EFG67263.1| protein of unknown function DUF55 [Burkholderia sp. Ch1-1]
          Length = 152

 Score =  200 bits (510), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR +M+VGD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANAPHRTLPWTGVRNYQARNFMRDQMQVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT                S  W  VD+     +P  + L A++ +
Sbjct: 61  GIAGIAEVSSTAYPDPTQFDRKSPYYDAKSSQESPRWVLVDVVFRKKIP-LIPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L  M +L   +RLS+ PVT  E+  + +
Sbjct: 120 DELKDMRVLAKGNRLSITPVTEAEWRFITK 149


>gi|291410641|ref|XP_002721602.1| PREDICTED: thymocyte nuclear protein 1 [Oryctolagus cuniculus]
          Length = 222

 Score =  200 bits (509), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 49/167 (29%), Positives = 78/167 (46%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP           +  +  + + +    W GVRNYQARN +R M++ ++ FFY
Sbjct: 52  SHWLMKSEPESRLEKGVDVKFGIEDLKAQPKQTACWDGVRNYQARNFLRSMKLEEEAFFY 111

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   YPD T                +  W  VD+  V  M   + 
Sbjct: 112 HSNCKQPGIAGLMKIVKEAYPDHTQFEKNSPHYDPSSKEDNPKWSMVDVQFVRMMKRFIP 171

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K   +        L +M L    RLSVQP+T +E+  +  + +
Sbjct: 172 LAELKTYHQAHKATGGPLKNMALFTRQRLSVQPLTQEEFDFILSLEE 218


>gi|167835797|ref|ZP_02462680.1| hypothetical protein Bpse38_04850 [Burkholderia thailandensis
           MSMB43]
          Length = 153

 Score =  200 bits (509), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 58/148 (39%), Positives = 77/148 (52%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP+E S             WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPNEASIDDLAAAPDQTLPWTGVRNYQARNFMRDMMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ +V +  YPDPT                S  W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAQVSSTPYPDPTQFDSQSPYHDPKSTRESPRWVLVDVRFVRKSP-LVPLAALRGH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
             L++M +L   +RLS+ PVT DE+  +
Sbjct: 120 DALANMRVLAKGNRLSITPVTPDEWRFI 147


>gi|227536061|ref|ZP_03966110.1| protein of hypothetical function DUF55 [Sphingobacterium
           spiritivorum ATCC 33300]
 gi|227243958|gb|EEI93973.1| protein of hypothetical function DUF55 [Sphingobacterium
           spiritivorum ATCC 33300]
          Length = 137

 Score =  199 bits (508), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 84/139 (60%), Gaps = 3/139 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M Y+LVKSEP ++SW+     G+    W GVRNYQARNN++ M+ GD   FYHSN+G+E+
Sbjct: 1   MNYFLVKSEPFKYSWEQFNKDGQ--TFWDGVRNYQARNNIKAMKEGDLVLFYHSNEGKEV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT E    W  VD+  V +   PV+L  IK++  L  + L+   RLS
Sbjct: 59  VGIAKVVKEFYQDPTTEDE-RWVVVDLAPVETFKNPVTLEQIKSDTLLQDVALVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLS 139
           V P+  +E+  +  +G   
Sbjct: 118 VMPLKPEEFDRIVELGNQD 136


>gi|30249841|ref|NP_841911.1| hypothetical protein NE1889 [Nitrosomonas europaea ATCC 19718]
 gi|30180878|emb|CAD85800.1| conserved hypothetical protein [Nitrosomonas europaea ATCC 19718]
          Length = 153

 Score =  199 bits (508), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 54/148 (36%), Positives = 73/148 (49%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNK-GR 58
           M YWL+KSEPSE S      +      W GVRNYQARN MR +M+ GD  FFYHS+    
Sbjct: 1   MRYWLMKSEPSEVSIDDLAARPGQTVPWDGVRNYQARNFMRNQMQPGDLVFFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV    YPD T                +  W  V++  +      +SL  +++ 
Sbjct: 61  GIAGVVEVSRLAYPDETQFDSASKYFDPKSTRENPRWFNVEVRFLRKT-RLLSLRELRSY 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
           P L+ M IL   +RLS+ PV   E+  +
Sbjct: 120 PELAGMRILQKGNRLSITPVDPSEWKFI 147


>gi|325522892|gb|EGD01350.1| hypothetical protein B1M_27014 [Burkholderia sp. TJI49]
          Length = 153

 Score =  199 bits (508), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLASAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPESPYYDPKSSQESPRWLLVDVRFVKKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEWRFITE 149


>gi|187922993|ref|YP_001894635.1| hypothetical protein Bphyt_0992 [Burkholderia phytofirmans PsJN]
 gi|187714187|gb|ACD15411.1| protein of unknown function DUF55 [Burkholderia phytofirmans PsJN]
          Length = 152

 Score =  199 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M+VGD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANAPHRTLPWTGVRNYQARNFMRDMMQVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT                   W  VD+     +P  + L A++ +
Sbjct: 61  GIAGIAEVSSTAYPDPTQFDKKSPYYDAKSSQETPRWVLVDVVFKKKIP-LIPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  + +
Sbjct: 120 DELADMRVLAKGNRLSITPVTEAEWRFITK 149


>gi|83594902|ref|YP_428654.1| hypothetical protein Rru_A3573 [Rhodospirillum rubrum ATCC 11170]
 gi|83577816|gb|ABC24367.1| Protein of unknown function DUF589 [Rhodospirillum rubrum ATCC
           11170]
          Length = 135

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 71/138 (51%), Positives = 92/138 (66%), Gaps = 3/138 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEPS WSW+ Q DKG   E W GVRN+QA N+M+ MR+GD+ FFYHS   + I
Sbjct: 1   MAYWLVKSEPSTWSWQNQLDKG--IEHWDGVRNHQASNHMKAMRLGDQAFFYHSVNEKRI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV+   YPDPT + +  +  VD  A+ ++P PV+L  IKA+PRLS + L+  SRLS
Sbjct: 59  VGIVEVVKEYYPDPT-DPAHRFGMVDFKALHTLPTPVTLAMIKADPRLSHLGLVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKL 138
           V  V    +  +  +G L
Sbjct: 118 VSSVDEASWGLIRGLGGL 135


>gi|295675794|ref|YP_003604318.1| protein of unknown function DUF55 [Burkholderia sp. CCGE1002]
 gi|295435637|gb|ADG14807.1| protein of unknown function DUF55 [Burkholderia sp. CCGE1002]
          Length = 152

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M+VGD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDDLANAPHRTLPWTGVRNYQARNFMRDVMQVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPDPT                   W  VD+     +P  +SL A++ +
Sbjct: 61  GIAGIAEVSSTAYPDPTQFDKKSPYYDAKSSPETPRWMLVDVVFKKKIP-LISLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L +M +L   +RLS+ PVT  E+  + +
Sbjct: 120 AELQNMRVLAKGNRLSITPVTDAEWRFITK 149


>gi|307102702|gb|EFN50971.1| hypothetical protein CHLNCDRAFT_28531 [Chlorella variabilis]
          Length = 156

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 56/151 (37%), Positives = 75/151 (49%), Gaps = 19/151 (12%)

Query: 6   VKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIVGIF 64
           +KSEP  +S      K    E W GVR++QA+  M+ MRVGD+ FFYHSN K   IVGI 
Sbjct: 1   MKSEPDVFSLDDLAAKPAQTEHWDGVRSHQAKKVMQSMRVGDRAFFYHSNAKPPGIVGIV 60

Query: 65  EVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN-----P 106
           EV+   YPD T                S  W  VD+  V  +   + L  +K++      
Sbjct: 61  EVVREAYPDHTQFDRASQYYDAGSKAESPRWFMVDVRLVRRLARQIPLEELKSHGASASA 120

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
            L+ M LI   RLSVQPVT  ++  V  + +
Sbjct: 121 PLADMALIKHGRLSVQPVTPAQWDFVLALEE 151


>gi|107023396|ref|YP_621723.1| hypothetical protein Bcen_1847 [Burkholderia cenocepacia AU 1054]
 gi|116690478|ref|YP_836101.1| hypothetical protein Bcen2424_2458 [Burkholderia cenocepacia
           HI2424]
 gi|170733799|ref|YP_001765746.1| hypothetical protein Bcenmc03_2463 [Burkholderia cenocepacia MC0-3]
 gi|206561006|ref|YP_002231771.1| hypothetical protein BCAL2668 [Burkholderia cenocepacia J2315]
 gi|254247480|ref|ZP_04940801.1| hypothetical protein BCPG_02278 [Burkholderia cenocepacia PC184]
 gi|105893585|gb|ABF76750.1| protein of unknown function DUF589 [Burkholderia cenocepacia AU
           1054]
 gi|116648567|gb|ABK09208.1| protein of unknown function DUF55 [Burkholderia cenocepacia HI2424]
 gi|124872256|gb|EAY63972.1| hypothetical protein BCPG_02278 [Burkholderia cenocepacia PC184]
 gi|169817041|gb|ACA91624.1| protein of unknown function DUF55 [Burkholderia cenocepacia MC0-3]
 gi|198037048|emb|CAR52969.1| conserved hypothetical protein [Burkholderia cenocepacia J2315]
          Length = 153

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLANAPQRSLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVRFVKKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEWRFITE 149


>gi|330965563|gb|EGH65823.1| hypothetical protein PSYAC_13076 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 149

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G+    W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGK--SRWDGVRNYQARNFLRAMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +++   YPDPTA                + W  +DI  V      + L  +K   
Sbjct: 59  IAGIGKIVKTAYPDPTALDPDSHYHDAKATTEKNPWSAIDIGFVDIFKNVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|330957121|gb|EGH57381.1| hypothetical protein PMA4326_00940 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 149

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    +  G+    W GVRNYQARN +R M VGD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLKKLGKA--RWDGVRNYQARNFLRAMAVGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKATTEKNPWSAIDVEFVDIFKNVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWSAILAL 148


>gi|170724188|ref|YP_001751876.1| hypothetical protein PputW619_5031 [Pseudomonas putida W619]
 gi|169762191|gb|ACA75507.1| protein of unknown function DUF55 [Pseudomonas putida W619]
          Length = 150

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 61/153 (39%), Positives = 81/153 (52%), Gaps = 19/153 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKG-R 58
           MAYWL+KSEP E S +     GR+GEA W GVRNYQARN +R M VGD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSIEGL---GRLGEARWDGVRNYQARNFLRAMNVGDEFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  +    YPDPTA                + W  VD+  V +    + L  +K  
Sbjct: 58  GIAGIARITAAAYPDPTALDAQSHYYDAKATAEKNPWSAVDVAHVRTFRQVLGLGLLKQQ 117

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
             L  + L+   +RLSV PVT +++  +  + K
Sbjct: 118 SALEELPLVHKGTRLSVMPVTEEQWAAIIALSK 150


>gi|329114246|ref|ZP_08243008.1| Hypothetical protein APO_1032 [Acetobacter pomorum DM001]
 gi|326696322|gb|EGE48001.1| Hypothetical protein APO_1032 [Acetobacter pomorum DM001]
          Length = 139

 Score =  199 bits (507), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/141 (51%), Positives = 90/141 (63%), Gaps = 3/141 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW  Q   G   E WTGVRN+QA+ N+  M+ GD+ FFYHSN  R I
Sbjct: 1   MAYWLVKSEPDAFSWDEQVANG--VEPWTGVRNHQAKKNLAAMKAGDRAFFYHSNVQRAI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTA ++  W CVD+ A+  MP PV+L  IKA P L  + L+  SRLS
Sbjct: 59  VGVVEVVREGYPDPTA-ETDKWVCVDVKAIAPMPNPVTLAQIKAEPTLEDLALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           V PV+   +  +C MG    P
Sbjct: 118 VCPVSAAHWQILCEMGGWQEP 138


>gi|66043584|ref|YP_233425.1| hypothetical protein Psyr_0315 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63254291|gb|AAY35387.1| Protein of unknown function DUF589 [Pseudomonas syringae pv.
           syringae B728a]
          Length = 149

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G+    W GVRNYQARN +R M  GDK FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGKA--RWDGVRNYQARNFLRTMAEGDKFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +V    YPDPTA             E+ + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKVARSAYPDPTALDPQSHYHDAKATEEKNPWSAIDVEFVDIFKHVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|308050506|ref|YP_003914072.1| hypothetical protein Fbal_2796 [Ferrimonas balearica DSM 9799]
 gi|307632696|gb|ADN76998.1| protein of unknown function DUF55 [Ferrimonas balearica DSM 9799]
          Length = 155

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 62/153 (40%), Positives = 83/153 (54%), Gaps = 18/153 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S    + +G     W GVRNYQARN MR  +++GDK F YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFSIDTLKAQG--TSCWEGVRNYQARNLMRDEVKLGDKVFIYHSSCKHV 58

Query: 59  EIVGIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI  V    YPD              +  ++  W  VD+     +P  VSL AIKAN
Sbjct: 59  GVAGIATVTREAYPDHHQFNPESPYFDPKSDPENPRWIMVDVAYQQHLP-LVSLKAIKAN 117

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKL 138
           P L+ M+L+  SRLS+QPVT  E+  +  M  +
Sbjct: 118 PALAEMVLVNRSRLSIQPVTEAEWHNILAMAGV 150


>gi|170692013|ref|ZP_02883177.1| protein of unknown function DUF55 [Burkholderia graminis C4D1M]
 gi|170143297|gb|EDT11461.1| protein of unknown function DUF55 [Burkholderia graminis C4D1M]
          Length = 152

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 56/148 (37%), Positives = 74/148 (50%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANAAHRTLPWTGVRNYQARNFMRDGMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT   S               W  VD+     +P  + L A++ +
Sbjct: 61  GIAGLAEVASTAYPDPTQFDSKSPYYDPKSSQETPRWLLVDVVFKKKIP-LIPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
             L  M +L   +RLS+ PVT  E+  +
Sbjct: 120 EELKDMRVLARGNRLSITPVTEAEWRFI 147


>gi|312891707|ref|ZP_07751216.1| protein of unknown function DUF55 [Mucilaginibacter paludis DSM
           18603]
 gi|311295790|gb|EFQ72950.1| protein of unknown function DUF55 [Mucilaginibacter paludis DSM
           18603]
          Length = 134

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 60/136 (44%), Positives = 90/136 (66%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M +WLVKSEP ++SW+     GR    W GVRNYQARNN+R+M+ GD   +YHSN+G+ +
Sbjct: 1   MQHWLVKSEPVKYSWEKFNQDGR--TFWDGVRNYQARNNLREMKEGDLVLYYHSNEGKAV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT +  + W  VD+  V ++  PV+L  IKA+P+L+++ L+   RLS
Sbjct: 59  VGIAKVVKAFYQDPTTDDKN-WVVVDLVPVETIKNPVTLEQIKADPQLANISLVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+  +E+  +  +G
Sbjct: 118 VMPLKAEEFDRILELG 133


>gi|189351224|ref|YP_001946852.1| hypothetical protein BMULJ_02422 [Burkholderia multivorans ATCC
           17616]
 gi|221211534|ref|ZP_03584513.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
 gi|189335246|dbj|BAG44316.1| conserved hypothetical protein [Burkholderia multivorans ATCC
           17616]
 gi|221168895|gb|EEE01363.1| conserved hypothetical protein [Burkholderia multivorans CGD1]
          Length = 153

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLAHAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  VSL A++ +
Sbjct: 61  GIAGLAEVASTPYPDPTQFDPKSPYYDPKSSPESPRWLLVDVRFVKKTP-LVSLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEWKFITE 149


>gi|88797323|ref|ZP_01112913.1| hypothetical protein MED297_20857 [Reinekea sp. MED297]
 gi|88780192|gb|EAR11377.1| hypothetical protein MED297_20857 [Reinekea sp. MED297]
          Length = 160

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 65/149 (43%), Positives = 83/149 (55%), Gaps = 14/149 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-RE 59
           MA WL+K+EP E+S     ++G  GE W G+RNYQARN +R+M+VGD    YHS      
Sbjct: 1   MAVWLLKTEPGEFSIDDLAERGSDGEPWNGIRNYQARNFLREMQVGDLVLIYHSACATPG 60

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVG+ EVI   YPDP A               +  W  +D+  +     P+SL AIKA P
Sbjct: 61  IVGLAEVIRDAYPDPDALNPESRYFDPKSHADNIRWSLIDVRFLQKYSAPLSLKAIKAEP 120

Query: 107 RLSSMILIVSSRLSVQPVTTDEYLEVCRM 135
            L  M L+ SSRLSV PVT  EY  +C +
Sbjct: 121 SLGEMKLVNSSRLSVSPVTEAEYQTLCSL 149


>gi|326800929|ref|YP_004318748.1| hypothetical protein Sph21_3540 [Sphingobacterium sp. 21]
 gi|326551693|gb|ADZ80078.1| Uncharacterized protein family UPF0310 [Sphingobacterium sp. 21]
          Length = 134

 Score =  199 bits (506), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 57/136 (41%), Positives = 84/136 (61%), Gaps = 3/136 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M Y+LVKSEP ++SW+      +    W GVRNYQARNN++ M+ GD   FYHSN+G+E+
Sbjct: 1   MNYFLVKSEPFKYSWQQFLKDKQ--TFWDGVRNYQARNNLKAMKKGDLVLFYHSNEGKEV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +V+   Y DPT      W  VD+  + ++  PV+L  IKA+ +L  + L+   RLS
Sbjct: 59  VGIAKVVKEAYQDPTTSDE-RWVVVDLAPLQTLKKPVTLETIKADEQLQDIALVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+  +E+  +  +G
Sbjct: 118 VMPLAPEEFDRIVALG 133


>gi|115352558|ref|YP_774397.1| hypothetical protein Bamb_2507 [Burkholderia ambifaria AMMD]
 gi|170697643|ref|ZP_02888731.1| protein of unknown function DUF55 [Burkholderia ambifaria IOP40-10]
 gi|172061417|ref|YP_001809069.1| hypothetical protein BamMC406_2375 [Burkholderia ambifaria MC40-6]
 gi|115282546|gb|ABI88063.1| protein of unknown function DUF55 [Burkholderia ambifaria AMMD]
 gi|170137391|gb|EDT05631.1| protein of unknown function DUF55 [Burkholderia ambifaria IOP40-10]
 gi|171993934|gb|ACB64853.1| protein of unknown function DUF55 [Burkholderia ambifaria MC40-6]
          Length = 153

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLAHAPQHSLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVRFVKKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEWRFITE 149


>gi|254784720|ref|YP_003072148.1| hypothetical protein TERTU_0500 [Teredinibacter turnerae T7901]
 gi|237686001|gb|ACR13265.1| conserved hypothetical protein [Teredinibacter turnerae T7901]
          Length = 155

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 60/151 (39%), Positives = 80/151 (52%), Gaps = 17/151 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGR- 58
           M+YWL KSEP+E+         +    W G+RNYQARN +R  + VGD+  FYHS+    
Sbjct: 3   MSYWLFKSEPNEYGIDHLAKDKKA--RWDGIRNYQARNILRDDVSVGDQVLFYHSSCKPT 60

Query: 59  EIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVG+ EV+   YPDP                 +  W CVDI        P++L A+K  
Sbjct: 61  AIVGLAEVVAEGYPDPAQFNADSPYFDAKSKIDAPRWVCVDIAFQAKFKNPLTLAALKKM 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMG 136
           P LS M+L+  SRLS+QPVT  E+  + R G
Sbjct: 121 PELSEMVLLQQSRLSIQPVTKAEFEFILRTG 151


>gi|289674535|ref|ZP_06495425.1| hypothetical protein PsyrpsF_14822 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 149

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G     W GVRNYQARN +R M  GD  FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGSA--RWDGVRNYQARNFLRAMAEGDAFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++     PDPTA             E+ + W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGKIARSACPDPTALDPESHYHDAKATEEKNPWSAIDVEFVETFKRVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|240975908|ref|XP_002402204.1| thymocyte nuclear protein, putative [Ixodes scapularis]
 gi|215491123|gb|EEC00764.1| thymocyte nuclear protein, putative [Ixodes scapularis]
          Length = 157

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 54/155 (34%), Positives = 73/155 (47%), Gaps = 25/155 (16%)

Query: 12  EWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGREIVGIFEVITC 69
           ++S             W GVRNYQARN MR  M+ G + FFYHSN K   IVGI EV+  
Sbjct: 2   KFSIDDLIACPESTSCWDGVRNYQARNYMRDGMKKGHQCFFYHSNCKVPGIVGIVEVVRE 61

Query: 70  TYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKANPR--------- 107
           +YPD T                +  W  VD+  V  +  PV+L  +K             
Sbjct: 62  SYPDHTQFDKKSGHYDKTSTRENPRWCMVDVKFVRKLTRPVTLPELKKLHEQHAASSEKG 121

Query: 108 -LSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNP 141
            L++M L+  SRLSVQPVT +E+  +  +   + P
Sbjct: 122 PLANMALLTRSRLSVQPVTEEEWNFILSLEGANGP 156


>gi|237798003|ref|ZP_04586464.1| hypothetical protein POR16_04079 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331020854|gb|EGI00911.1| hypothetical protein POR16_04079 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 149

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G+    W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGKA--RWDGVRNYQARNFLRAMAAGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA             E+ + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIARVAYPDPTALDPDSHYHDAKATEEKNPWSAIDVEFVDIFKKVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|221199316|ref|ZP_03572360.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
 gi|221205782|ref|ZP_03578797.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221174620|gb|EEE07052.1| conserved hypothetical protein [Burkholderia multivorans CGD2]
 gi|221180601|gb|EEE13004.1| conserved hypothetical protein [Burkholderia multivorans CGD2M]
          Length = 153

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLAHAPQRTLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVASTPYPDPTQFDPKSPYYDPKSSPESPRWLLVDVRFVKKTP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEWKFITE 149


>gi|330501292|ref|YP_004378161.1| hypothetical protein MDS_0378 [Pseudomonas mendocina NK-01]
 gi|328915578|gb|AEB56409.1| hypothetical protein MDS_0378 [Pseudomonas mendocina NK-01]
          Length = 149

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-RE 59
           M YWL+KSEP E S    Q  G+    W GVRNYQARN MR M+ GD  FFYHS+     
Sbjct: 1   MPYWLMKSEPDELSILDLQRLGK--TRWDGVRNYQARNFMRAMKPGDLFFFYHSSCPQPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +    YPDPTA                + W  +D+  V +    + L  +K NP
Sbjct: 59  IAGIARIAGEVYPDPTALDPQSHYHDPKASAEKNPWSALDVEFVEAFGEVLPLQHLKNNP 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L+ + L+   SRLSV PVT  E+  +  M
Sbjct: 119 LLADLALVQRGSRLSVMPVTEAEWTAILAM 148


>gi|331009494|gb|EGH89550.1| hypothetical protein PSYTB_07351 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 149

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q++G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQNRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPASHYHDAKATADKNPWSAIDVEFVDVFKSVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|134296640|ref|YP_001120375.1| hypothetical protein Bcep1808_2542 [Burkholderia vietnamiensis G4]
 gi|134139797|gb|ABO55540.1| protein of unknown function DUF55 [Burkholderia vietnamiensis G4]
          Length = 153

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 73/150 (48%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S        +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLAHAPQRSLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V      V L A++ +
Sbjct: 61  GIAGLAEVASAPYPDPTQFDPKSPYYDPKSTHETPRWLLVDVRFVKK-SALVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEWRFITE 149


>gi|330971828|gb|EGH71894.1| hypothetical protein PSYAR_15172 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 149

 Score =  198 bits (504), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G+    W GVRNYQARN +R M  GDK FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGKA--RWDGVRNYQARNFLRTMAEGDKFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +V    YPDPTA             E+ + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKVAKSAYPDPTALDPQSHYHDAKAPEEKNPWSAIDVEFVDIFKHVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|28872341|ref|NP_794960.1| hypothetical protein PSPTO_5229 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971852|ref|ZP_03399954.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301383389|ref|ZP_07231807.1| hypothetical protein PsyrptM_12161 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302134950|ref|ZP_07260940.1| hypothetical protein PsyrptN_26397 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28855596|gb|AAO58655.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213923398|gb|EEB56991.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|331016123|gb|EGH96179.1| hypothetical protein PLA106_08965 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 149

 Score =  197 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G+    W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGKA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +++   YPDPTA                + W  +DI  V      + L  +K   
Sbjct: 59  IAGIGKIVKTAYPDPTALDPDSHYHDAKATTEKNPWSALDIGFVDIFKNVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|78067258|ref|YP_370027.1| hypothetical protein Bcep18194_A5789 [Burkholderia sp. 383]
 gi|77968003|gb|ABB09383.1| protein of unknown function DUF589 [Burkholderia sp. 383]
          Length = 153

 Score =  197 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLANAPQRSLPWTGVRNYQARNFMRDTMKIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+C V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVCYVKKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEWRFITE 149


>gi|257481859|ref|ZP_05635900.1| hypothetical protein PsyrptA_01243 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 149

 Score =  197 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q++G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQNRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKATADKNPWSAIDVEFVDVFKSVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|320322152|gb|EFW78248.1| hypothetical protein PsgB076_25224 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320331806|gb|EFW87744.1| hypothetical protein PsgRace4_02055 [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 149

 Score =  197 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q +G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKATADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|294011472|ref|YP_003544932.1| hypothetical protein SJA_C1-14860 [Sphingobium japonicum UT26S]
 gi|292674802|dbj|BAI96320.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 135

 Score =  197 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 58/137 (42%), Positives = 81/137 (59%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  +S+    +KGR    W GVRN+ A+ +MR MR GD   FYHSN G E 
Sbjct: 1   MNYWLMKSEPDAFSYDDLVEKGRA--EWDGVRNHAAQGHMRAMRKGDLSIFYHSNIGVEA 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI E++    PD T +++  W  V +        PV+L  +KA+P+L+ M +I  SRLS
Sbjct: 59  VGIMEIVGEAAPDST-DETGKWIAVHVAPKEKFEKPVTLKTMKADPKLADMAMIRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V P+T  E+  +  + K
Sbjct: 118 VSPLTAAEFRHIVDLSK 134


>gi|289625067|ref|ZP_06458021.1| hypothetical protein PsyrpaN_08017 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|298485171|ref|ZP_07003265.1| hypothetical protein PSA3335_0583 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160283|gb|EFI01310.1| hypothetical protein PSA3335_0583 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330870345|gb|EGH05054.1| hypothetical protein PSYAE_24448 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 149

 Score =  197 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q +G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVRNYQARNFLRSMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKASADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|284037113|ref|YP_003387043.1| hypothetical protein Slin_2222 [Spirosoma linguale DSM 74]
 gi|283816406|gb|ADB38244.1| protein of unknown function DUF55 [Spirosoma linguale DSM 74]
          Length = 147

 Score =  197 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 61/140 (43%), Positives = 83/140 (59%), Gaps = 2/140 (1%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP  + W    ++GR    W GVRNYQARNN++ M +GD   FYHS     +
Sbjct: 1   MNYWLVKSEPDTYGWHHFIEQGRAT--WDGVRNYQARNNLKGMLIGDLVLFYHSVTSPAV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+  V+   + DPT  +   W  V++  V +   PV+L  IKA P L+S+ LI  SRLS
Sbjct: 59  VGLATVVRSHFQDPTVPEDPRWVAVELEPVMAFEKPVTLAHIKAEPMLASISLIKQSRLS 118

Query: 121 VQPVTTDEYLEVCRMGKLSN 140
           V PV  DE+  + +MG+ + 
Sbjct: 119 VMPVRADEFELILKMGQATR 138


>gi|307728905|ref|YP_003906129.1| hypothetical protein BC1003_0854 [Burkholderia sp. CCGE1003]
 gi|307583440|gb|ADN56838.1| protein of unknown function DUF55 [Burkholderia sp. CCGE1003]
          Length = 152

 Score =  197 bits (503), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 74/148 (50%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M+VGD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANARHRTLPWTGVRNYQARNFMRDAMQVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT   S               W  VD+     +P  + L A++ +
Sbjct: 61  GIAGLAEVASTAYPDPTQFDSKSPYYDPKSSQETPRWLLVDVVFKKKIP-LIPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
             L  M +L   +RLS+ PVT  E+  +
Sbjct: 120 EELKDMRVLARGNRLSITPVTEAEWRFI 147


>gi|330818010|ref|YP_004361715.1| hypothetical protein bgla_1g31520 [Burkholderia gladioli BSR3]
 gi|327370403|gb|AEA61759.1| hypothetical protein bgla_1g31520 [Burkholderia gladioli BSR3]
          Length = 153

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  MR+GD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLAAAPKHTLPWTGVRNYQARNFMRDTMRIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  + L A++ +
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPASPYHDPKSKREEPRWSLVDVRFVKKTP-LIPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELAEMRVLARGNRLSITPVTRAEWKFITE 149


>gi|330886082|gb|EGH19983.1| hypothetical protein PSYMO_00195 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330987956|gb|EGH86059.1| hypothetical protein PLA107_23235 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 149

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 77/150 (51%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q +G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKASADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|258541995|ref|YP_003187428.1| hypothetical protein APA01_09010 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633073|dbj|BAH99048.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636130|dbj|BAI02099.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639185|dbj|BAI05147.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642239|dbj|BAI08194.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645294|dbj|BAI11242.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648349|dbj|BAI14290.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651402|dbj|BAI17336.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654393|dbj|BAI20320.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 139

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 72/141 (51%), Positives = 92/141 (65%), Gaps = 3/141 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  +SW  Q   G   E WTGVRN+QA+ N+  M+ GD+ FFYHSN  R I
Sbjct: 1   MAYWLVKSEPDAFSWDEQVANG--VEPWTGVRNHQAKKNLAAMKAGDRAFFYHSNVQRAI 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ EV+   YPDPTA ++  W CVD+ A+  MP PV+L  IKA P L  + L+  SRLS
Sbjct: 59  VGVVEVVREGYPDPTA-ETDKWVCVDVKAIAPMPTPVTLAQIKAEPTLEDLALVRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGKLSNP 141
           V PV+ + +  +C MG+   P
Sbjct: 118 VCPVSAEHWQILCDMGEWQEP 138


>gi|146305360|ref|YP_001185825.1| hypothetical protein Pmen_0319 [Pseudomonas mendocina ymp]
 gi|145573561|gb|ABP83093.1| protein of unknown function DUF55 [Pseudomonas mendocina ymp]
          Length = 149

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-RE 59
           M YWL+KSEP E S    Q  G+    W GVRNYQARN +R MR GD+ FFYHS+     
Sbjct: 1   MPYWLMKSEPDELSIHDLQRLGKA--RWDGVRNYQARNFLRAMRPGDQFFFYHSSCPQPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +   TYPDPTA                + W  +D+  V +    + L  +K NP
Sbjct: 59  IAGIGRIAGETYPDPTALDPHSHYHDPKASAEKNPWSALDVEFVEAFAEVLPLQQLKNNP 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L+ + L+   SRLSV PV+  E+  +  M
Sbjct: 119 LLADLALVQRGSRLSVMPVSEAEWAAILAM 148


>gi|171321005|ref|ZP_02909993.1| protein of unknown function DUF55 [Burkholderia ambifaria MEX-5]
 gi|171093725|gb|EDT38868.1| protein of unknown function DUF55 [Burkholderia ambifaria MEX-5]
          Length = 153

 Score =  197 bits (502), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S        +    WTGVRNYQARN MR  M+VGD   FYHS+    
Sbjct: 1   MQYWLMKSEPDEASIDDLVHAPQHSLPWTGVRNYQARNFMRDTMKVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V   P  V L A++ +
Sbjct: 61  GIAGLAEVSSAPYPDPTQFDPKSPYYDPKSTQEAPRWLLVDVRFVKKSP-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLARGNRLSITPVTRAEWRFITE 149


>gi|238028363|ref|YP_002912594.1| hypothetical protein bglu_1g28240 [Burkholderia glumae BGR1]
 gi|237877557|gb|ACR29890.1| Hypothetical protein bglu_1g28240 [Burkholderia glumae BGR1]
          Length = 153

 Score =  197 bits (502), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 74/150 (49%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M +WL+KSEP E S        +    WTGVRNYQARN MR  MRVGD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLAAAPQRTLPWTGVRNYQARNFMRDTMRVGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                +  W  VD+  V      V L A++ +
Sbjct: 61  GIAGLAEVASTPYPDPTQFDADSPYYDPKSKQDAPRWVLVDVRFVKKTA-LVPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DALAEMRVLAKGNRLSITPVTRAEWRFITE 149


>gi|291615139|ref|YP_003525296.1| hypothetical protein Slit_2684 [Sideroxydans lithotrophicus ES-1]
 gi|291585251|gb|ADE12909.1| protein of unknown function DUF55 [Sideroxydans lithotrophicus
           ES-1]
          Length = 167

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 57/148 (38%), Positives = 74/148 (50%), Gaps = 17/148 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEPS+ S            AW GVRNYQARN MR +M+VGD   FYHSN K  
Sbjct: 14  MRYWLMKSEPSDCSIDDLAKLPNQTVAWYGVRNYQARNFMRDQMQVGDGVLFYHSNCKEP 73

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI EV +  YPD T                   W  VD+  V  +   +S+  +K +
Sbjct: 74  GIAGIAEVSSTAYPDTTQFDKKSKYFDPKATPEQPRWMNVDVKLVRKIA-LISIEELKRH 132

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
           P L +M  L   +RLS+ P+   E+  +
Sbjct: 133 PELENMRTLQRGNRLSITPLDPAEWRFI 160


>gi|78049083|ref|YP_365258.1| hypothetical protein XCV3527 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78037513|emb|CAJ25258.1| conserved hypothetical protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 181

 Score =  197 bits (501), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 58/152 (38%), Positives = 72/152 (47%), Gaps = 20/152 (13%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
            YWL+KSEP  +S    +  G   E W GVRNYQARN MR  M+VGD  FFYHSN K   
Sbjct: 29  RYWLMKSEPDTFSIDDLERVG--TEPWNGVRNYQARNFMRDGMQVGDGVFFYHSNCKVPG 86

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI +V +  YPD T                   W  VD+     +   +SL  IK   
Sbjct: 87  IVGIAKVASAAYPDDTQFDPSSDYHDPKSTREDPRWMLVDVAFERKLARTISLDEIKQQA 146

Query: 107 RL--SSMILI-VSSRLSVQPVTTDEYLEVCRM 135
                   LI   +RLS+ PVT  ++  +  M
Sbjct: 147 DALGEGFALIARGNRLSILPVTAAQWKLLLAM 178


>gi|37521234|ref|NP_924611.1| hypothetical protein glr1665 [Gloeobacter violaceus PCC 7421]
 gi|35212230|dbj|BAC89606.1| glr1665 [Gloeobacter violaceus PCC 7421]
          Length = 175

 Score =  197 bits (501), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 60/155 (38%), Positives = 78/155 (50%), Gaps = 17/155 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGR-E 59
           MA WL KSEP  +S    +  G     W+GVRNYQARN M  MRVGD GFFYHSN     
Sbjct: 1   MARWLFKSEPGAYSIADLKADGTTD--WSGVRNYQARNFMLAMRVGDLGFFYHSNANPTG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           + GI EV+   YPD TA                  W+ VD+         V+L  ++A  
Sbjct: 59  VAGIVEVVREAYPDHTALDPASPYFDAKATAAKPIWQMVDVAFGAQFAEVVTLERLRATA 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLSN 140
            L  M L+   SRLSV PV+  E+  + ++ +L +
Sbjct: 119 GLEQMPLLRRGSRLSVLPVSPGEWEIILKVARLPS 153


>gi|302064082|ref|ZP_07255623.1| hypothetical protein PsyrptK_29210 [Pseudomonas syringae pv. tomato
           K40]
          Length = 149

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 57/150 (38%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G+    W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGKA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +++   YPDPTA                + W  +DI  V      + L  +K   
Sbjct: 59  IAGIGKIVKTAYPDPTALDPDSHYHDAKATTEKNPWSALDIGFVDIFKNVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEKLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|312963760|ref|ZP_07778231.1| protein of unknown function DUF589 [Pseudomonas fluorescens WH6]
 gi|311281795|gb|EFQ60405.1| protein of unknown function DUF589 [Pseudomonas fluorescens WH6]
          Length = 149

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 80/150 (53%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E S +  +  G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDELSIQGLEKLGEA--RWDGVRNYQARNFLRAMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +++   YPDPTA                + W  +D+  V + P  +SL  +K   
Sbjct: 59  IAGIGKIVKTAYPDPTALEPEGHYFDAKATSDKNPWSAIDVSHVQTFPKVLSLGYLKQQT 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L+ + L+   SRLSV PVT +++  V  +
Sbjct: 119 ALAELPLVQKGSRLSVMPVTAEQWAAVLAL 148


>gi|94986954|ref|YP_594887.1| hypothetical protein LI0511 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731203|emb|CAJ54565.1| conserved hypothetical protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 160

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 57/151 (37%), Positives = 77/151 (50%), Gaps = 15/151 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGRE 59
           M YWL KS+   +S    Q       +W GVRNYQARN MR  MR+GD GFFYHS K  E
Sbjct: 1   MQYWLFKSDTDCYSINDLQSAPNQTTSWDGVRNYQARNFMRDEMRIGDLGFFYHSGKLPE 60

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +V+  +YPD TA              ++  W  VD+  V      +    ++   
Sbjct: 61  IAGIVKVVKESYPDHTAQDPENDHYDPSATPENPRWYMVDVQLVKVFHPTIPRNLLRLQH 120

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRMG 136
            LS M L+   SRLS+QPV+ + +  + R+ 
Sbjct: 121 DLSGMELLKAGSRLSIQPVSQEHFNNIIRLA 151


>gi|119896926|ref|YP_932139.1| hypothetical protein azo0635 [Azoarcus sp. BH72]
 gi|119669339|emb|CAL93252.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 159

 Score =  196 bits (500), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 55/150 (36%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKG-R 58
           M YWL+KSEP + S      +      W GVRNYQARN MR +M+VGD  FFYHS+    
Sbjct: 1   MRYWLMKSEPDDCSIDDLARRPGSTVPWYGVRNYQARNLMRDQMQVGDAVFFYHSSCPQP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  V +  YPD T                   W  VD+  V   P  V L  ++++
Sbjct: 61  GIAGIARVSSPAYPDATQFDPASPYHDPKSTPEAPRWLNVDVQFVRKTP-LVPLAELRSH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L++M +L  ++RLS+ PV   E+  + R
Sbjct: 120 TELANMRVLARANRLSITPVDPAEWRFITR 149


>gi|323525113|ref|YP_004227266.1| hypothetical protein BC1001_0752 [Burkholderia sp. CCGE1001]
 gi|323382115|gb|ADX54206.1| protein of unknown function DUF55 [Burkholderia sp. CCGE1001]
          Length = 152

 Score =  196 bits (500), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 75/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S     +       WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MRYWLMKSEPDEASIDHLANAPHRTLPWTGVRNYQARNLMRDVMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT   S               W  VD+     +P  + L A++ +
Sbjct: 61  GIAGLAEVASTAYPDPTQFDSKSPYYDPKSSQETPRWLLVDVVFKKKIP-LIPLAALREH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L  M +L   +RLS+ PVT  E+  + +
Sbjct: 120 EELKDMRVLARGNRLSITPVTEAEWRFITK 149


>gi|241663798|ref|YP_002982158.1| hypothetical protein Rpic12D_2212 [Ralstonia pickettii 12D]
 gi|240865825|gb|ACS63486.1| protein of unknown function DUF55 [Ralstonia pickettii 12D]
          Length = 178

 Score =  196 bits (499), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 57/147 (38%), Positives = 77/147 (52%), Gaps = 19/147 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKG-RE 59
            YWL+KSEP E S     DKG     WTGVRNYQARN MR  MR+GD   FYHS+     
Sbjct: 26  QYWLMKSEPDEASIDTLHDKG--TLPWTGVRNYQARNFMRDRMRIGDGVLFYHSSCPQPG 83

Query: 60  IVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+ EV + +YPDPT                +  W  VD+  V      + L  ++A+ 
Sbjct: 84  IAGLAEVCSTSYPDPTQFDAKSHYHDPASKPEAPRWMLVDVKFVRKCA-LIDLPTLRAHE 142

Query: 107 RLSSM-ILIVSSRLSVQPVTTDEYLEV 132
           +L+ M +L   +RLS+ PVT  ++  +
Sbjct: 143 QLADMTVLQRGNRLSITPVTAAQWRYI 169


>gi|294867714|ref|XP_002765200.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239865195|gb|EEQ97917.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 209

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 63/163 (38%), Positives = 82/163 (50%), Gaps = 25/163 (15%)

Query: 3   YWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           ++L KSEP           +S             W GVRNYQARN MR+M+VGDKGFFYH
Sbjct: 37  FYLFKSEPESRIEKGVDMKFSIDDLAASPNGTAEWDGVRNYQARNLMREMKVGDKGFFYH 96

Query: 54  SN-KGREIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSL 99
           SN K   IVGI EV+  +YPD T                   W+ VDI  +  +   +SL
Sbjct: 97  SNCKPPGIVGIVEVVRESYPDDTQFDPKNPHFDPRSGKEEPKWDMVDIKFIRKLSRKISL 156

Query: 100 MAIKA--NPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
             +KA  +  LSSM L  ++RLSVQ VT  E+  +  +  +S 
Sbjct: 157 DELKAYRDKELSSMGLFTTARLSVQRVTPAEWDFILSLEGVSE 199


>gi|325274680|ref|ZP_08140728.1| hypothetical protein G1E_15683 [Pseudomonas sp. TJI-51]
 gi|324100187|gb|EGB97985.1| hypothetical protein G1E_15683 [Pseudomonas sp. TJI-51]
          Length = 149

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 63/151 (41%), Positives = 84/151 (55%), Gaps = 19/151 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKG-R 58
           MAYWL+KSEP E S +     GR+GEA W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSIE---ALGRLGEARWDGVRNYQARNFLRAMSEGDRFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI E+I   YPDPTA                + W  VD+  V ++P  + L  +K  
Sbjct: 58  GIAGIGEIIRAAYPDPTALDPQSPYHDAKATAEKNPWSAVDVAHVQTLPRVLELGQLKQQ 117

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
             L+ + L+   SRLSV PVT +++  +  +
Sbjct: 118 AGLAELPLVQKGSRLSVMPVTAEQWAVIVAL 148


>gi|330874061|gb|EGH08210.1| hypothetical protein PSYMP_05804 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 149

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 78/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q  G+    W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQRLGK--SRWDGVRNYQARNFLRAMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI +++   YPDPTA                + W  +DI  V      + L  +K   
Sbjct: 59  IAGIGKIVKNAYPDPTALDPDSHYHDAKATTEKNPWSAIDIGFVDIFKNVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  V  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAVLAL 148


>gi|119468284|ref|ZP_01611410.1| hypothetical protein ATW7_15371 [Alteromonadales bacterium TW-7]
 gi|119448277|gb|EAW29541.1| hypothetical protein ATW7_15371 [Alteromonadales bacterium TW-7]
          Length = 152

 Score =  196 bits (499), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 55/152 (36%), Positives = 77/152 (50%), Gaps = 15/152 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S    +        W GVRNYQARN +R  ++ GD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDAFSIDDLKHAPNQTTLWEGVRNYQARNFLRDDVKEGDLVMIYHSSCKNV 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI ++ +  YPDPT                S  W  VD+     +   VSL +IKAN
Sbjct: 61  GVAGIAKITSAAYPDPTQFDLNSDYYDPKATSDSPRWVVVDVTYHQHLNKLVSLKSIKAN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             ++ + L  + RLSV PVT  ++ E+ +M K
Sbjct: 121 DSITELALKKAGRLSVMPVTEHDWNEIIKMAK 152


>gi|71735027|ref|YP_272604.1| hypothetical protein PSPPH_0300 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555580|gb|AAZ34791.1| conserved hypothetical protein [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 149

 Score =  195 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 55/150 (36%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q +G     W GV NYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVHNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKATADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQWAAILAL 148


>gi|308094601|ref|ZP_05890473.2| thymocyte nuclear protein 1 [Vibrio parahaemolyticus AN-5034]
 gi|308095237|ref|ZP_05904321.2| thymocyte nuclear protein 1 (Thymocyte protein Thy28) [Vibrio
           parahaemolyticus Peru-466]
 gi|308125860|ref|ZP_05777747.2| thymocyte nuclear protein 1 [Vibrio parahaemolyticus K5030]
 gi|308126318|ref|ZP_05909237.2| thymocyte nuclear protein 1 [Vibrio parahaemolyticus AQ4037]
 gi|308087187|gb|EFO36882.1| thymocyte nuclear protein 1 (Thymocyte protein Thy28) [Vibrio
           parahaemolyticus Peru-466]
 gi|308092767|gb|EFO42462.1| thymocyte nuclear protein 1 [Vibrio parahaemolyticus AN-5034]
 gi|308110599|gb|EFO48139.1| thymocyte nuclear protein 1 [Vibrio parahaemolyticus AQ4037]
 gi|308111042|gb|EFO48582.1| thymocyte nuclear protein 1 [Vibrio parahaemolyticus K5030]
          Length = 181

 Score =  195 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 56/156 (35%), Positives = 78/156 (50%), Gaps = 18/156 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S      + +    W GVRNYQARN MR +++VGD    YHS+ K  
Sbjct: 26  MAYWLFKTEPDTFSIDTL--RTQKVSCWEGVRNYQARNMMRDQVKVGDFVLIYHSSCKNV 83

Query: 59  EIVGIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YPD              +   +  W  VDI  V      + L  +KA 
Sbjct: 84  GVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDIEFVRKTARVIPLSVMKAM 143

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLSN 140
           P L +M L+   +RLS+ PVT DE+  +    KL +
Sbjct: 144 PELENMPLVKRGNRLSIMPVTEDEWEAILGKEKLPS 179


>gi|109896368|ref|YP_659623.1| hypothetical protein Patl_0037 [Pseudoalteromonas atlantica T6c]
 gi|109698649|gb|ABG38569.1| protein of unknown function DUF55 [Pseudoalteromonas atlantica T6c]
          Length = 157

 Score =  195 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 54/153 (35%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL K+EP  +S      K    E W G+RNYQARN +R +++ GDK F YHS+ K  
Sbjct: 5   MQYWLFKTEPDAFSIDDLAAKPEQTEHWDGIRNYQARNFLRDQVKQGDKVFIYHSSCKDV 64

Query: 59  EIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV+   YPD T                +  W  VD+  V   P  +SL  IK+ 
Sbjct: 65  GIAGLAEVVKEAYPDHTQFDPESHYYDPKSSPDNPRWVMVDVRFVEKFPAILSLKKIKSM 124

Query: 106 PRLSSMILIVSS-RLSVQPVTTDEYLEVCRMGK 137
           P ++ + LI    RLS+ PV   E+  +    +
Sbjct: 125 PEINEIGLIKKGYRLSIMPVNEHEFSALLAASR 157


>gi|302608306|emb|CBW44759.1| conserved hypothetical protein [Marinobacter hydrocarbonoclasticus]
          Length = 152

 Score =  195 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 79/150 (52%), Gaps = 15/150 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGR-E 59
           MA WLVK+EPSE        +      W GVRNYQARN + KM+VGD  F YHS+  R  
Sbjct: 1   MAKWLVKTEPSECGIDDFARQPEGVIPWDGVRNYQARNFLAKMQVGDLVFIYHSSCKRIG 60

Query: 60  IVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  V+   YPDP+               ++  W+ VD+     +P  +SL  +KA P
Sbjct: 61  IAGIVRVVKSAYPDPSQFNPESPYYDPKSTAENPRWQAVDLQFERKLPALISLDTLKAMP 120

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            LS + L+   SRLSV PV+  E+ ++  +
Sbjct: 121 ELSELPLVRRGSRLSVMPVSDAEWQQILHL 150


>gi|24216517|ref|NP_713998.1| hypothetical protein LA_3818 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45656332|ref|YP_000418.1| hypothetical protein LIC10433 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|24197826|gb|AAN51016.1|AE011536_11 conserved hypothetical protein [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45599566|gb|AAS69055.1| conserved hypothetical protein [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 156

 Score =  195 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 53/154 (34%), Positives = 72/154 (46%), Gaps = 16/154 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNKGR- 58
           M YWL K+EP  +S     +       W GVRNYQARN +R  ++ GD   FYHS     
Sbjct: 1   MNYWLFKTEPDVFSIDDLYNSPSKTAPWEGVRNYQARNYLRDLVQKGDLVLFYHSRANPL 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            +VGI EV+   YPD  A                  W  VDI        PV+   +K +
Sbjct: 61  SVVGIAEVVKPGYPDHFAFDPSHKYFDPKSKVESPTWFMVDIKFKKKFSIPVTTEEMKKH 120

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKL 138
             L +MIL+   SRLS+QPV+  E+  +  +  +
Sbjct: 121 KPLKNMILLKKGSRLSIQPVSATEFQFILGLAGV 154


>gi|187937171|ref|NP_001120782.1| thymocyte nuclear protein 1 [Xenopus (Silurana) tropicalis]
 gi|187469832|gb|AAI67126.1| thyn1 protein [Xenopus (Silurana) tropicalis]
          Length = 224

 Score =  195 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 49/163 (30%), Positives = 74/163 (45%), Gaps = 31/163 (19%)

Query: 4   WLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHS 54
           WL+KSEP           +  +    +      W GVRNYQARN MR M++G + FFYHS
Sbjct: 56  WLMKSEPETRIEKGLDMKFGIEDLMAQPSQTACWDGVRNYQARNFMRAMKIGQQAFFYHS 115

Query: 55  N-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLM 100
           N K   I GI +++  +Y D T                +  W  VD+  V  +   + L 
Sbjct: 116 NCKEPGIAGIVQIVKESYVDHTQFDPKNPHYDASSSQDNPKWSMVDVQFVRKLKRYIPLA 175

Query: 101 AIKANP--------RLSSMILIVSSRLSVQPVTTDEYLEVCRM 135
            +K            L ++ L   +RLSVQP+T +E+  + ++
Sbjct: 176 ELKKLHLNDKSSGGPLRNIALFTRARLSVQPLTQEEFDFILKL 218


>gi|71083019|ref|YP_265738.1| hypothetical protein SAR11_0313 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062132|gb|AAZ21135.1| Uncharacterized conserved protein [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 137

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 75/136 (55%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  WS   Q+  G  G  W GVRNYQA  N+R M+ GD  FFYHSN G+EI
Sbjct: 1   MNYWLMKSEPDVWSIDQQKKAGAKGAPWDGVRNYQAAKNLRAMKKGDLCFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG  EVI   + D T +    +  V +     +   V+L  IK    LS + LI  SRLS
Sbjct: 61  VGTVEVIKEAFLDKTDKD-GRFVAVQVKFKEKLRKSVTLEEIKKTKSLSHLSLIRQSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+ +  +  + +M 
Sbjct: 120 VMPIDSKSWKILNKMS 135


>gi|188990315|ref|YP_001902325.1| hypothetical protein xccb100_0920 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167732075|emb|CAP50267.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris]
          Length = 156

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 57/152 (37%), Positives = 73/152 (48%), Gaps = 20/152 (13%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
            YWL+KSEP  +S    +  G   E W GVRNYQARN MR  M+VGD  FFYHSN K   
Sbjct: 6   RYWLMKSEPDTFSIDDLERVG--TEPWNGVRNYQARNFMRDGMQVGDGVFFYHSNCKVPG 63

Query: 60  IVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI +V +  YPD T                   W  VD+     +   ++L  IK + 
Sbjct: 64  IVGIAKVASTAYPDETQFDRTSDYHDPKAKREDPRWMLVDVAFERKLKRTIALDEIKQHA 123

Query: 107 RL--SSMILI-VSSRLSVQPVTTDEYLEVCRM 135
                   LI   +RLS+ PVT  ++  +  M
Sbjct: 124 DALGEGFPLIARGNRLSILPVTAAQWKLLLAM 155


>gi|91762556|ref|ZP_01264521.1| hypothetical protein PU1002_04786 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718358|gb|EAS85008.1| hypothetical protein PU1002_04786 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 137

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 76/136 (55%), Gaps = 1/136 (0%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  WS   Q+  G  G  W GVRNYQA  N+R M+ GD  FFYHSN G+EI
Sbjct: 1   MNYWLMKSEPDVWSIDQQKKAGAKGAPWDGVRNYQAAKNLRAMKKGDLCFFYHSNIGKEI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EVI   + D T +    +  V +     +   V+L  +K    LS + LI  SRLS
Sbjct: 61  VGIVEVIKEAFLDKTDKD-GRFVAVQVKFKEKLKKSVTLEEVKKTKSLSHLSLIRQSRLS 119

Query: 121 VQPVTTDEYLEVCRMG 136
           V P+ +  +  + +M 
Sbjct: 120 VMPIDSKSWKILNKMS 135


>gi|327283898|ref|XP_003226677.1| PREDICTED: thymocyte nuclear protein 1-like isoform 1 [Anolis
           carolinensis]
 gi|327283900|ref|XP_003226678.1| PREDICTED: thymocyte nuclear protein 1-like isoform 2 [Anolis
           carolinensis]
          Length = 229

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 51/167 (30%), Positives = 75/167 (44%), Gaps = 31/167 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP           +  +  + +      W GVRNYQARN ++ M+VG + FFY
Sbjct: 60  SHWLMKSEPESRFEKGVDVKFGIEDLKAQPNQTACWDGVRNYQARNFLKDMKVGQEAFFY 119

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVS 98
           HSN K   I GI +++   YPD T                   W  VD+  V      + 
Sbjct: 120 HSNCKEPGIAGIVKIVQEAYPDHTQFDKKDPHYDASSTKEKPKWFMVDVQFVRMTKRFIP 179

Query: 99  LMAIKANPR--------LSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
           L  +K   +        L +M L    RLSVQP+T +E+  V  + +
Sbjct: 180 LAELKVQHQAHKTSGGPLKAMSLFTRQRLSVQPLTDEEFEFVLSLEE 226


>gi|70733257|ref|YP_263030.1| hypothetical protein PFL_5972 [Pseudomonas fluorescens Pf-5]
 gi|68347556|gb|AAY95162.1| Family of unknown function (DUF589) superfamily [Pseudomonas
           fluorescens Pf-5]
          Length = 149

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E S +  Q  G+    W GVRNYQARN +R M VGD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDELSIQGLQQLGQA--RWDGVRNYQARNFLRAMAVGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQSSC-------------WECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +I   YPDPTA +                W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGRIIKAAYPDPTALEPDSVYFDPKSSAEKNAWSAIDVAHVETFNKVLRLDYLKQQA 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L+ M L+   SRLSV PVT +++  V  +
Sbjct: 119 ALAEMPLVHKGSRLSVMPVTAEQWAAVLAL 148


>gi|313501183|gb|ADR62549.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 149

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-RE 59
           MAYWL+KSEP E S +     G     W GVRNYQARN +R M VGD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDELSIEALARLGEA--RWDGVRNYQARNFLRAMSVGDEFFFYHSSCPQPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +    YPDPTA                + W  VD+  V + P  + L  +K   
Sbjct: 59  IAGIARITRAAYPDPTALDPESHYHDTKATTDKNPWSAVDVAHVQTFPRVLELGRLKQQA 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 GLVELPLVQKGSRLSVMPVTPEQWAVIVAL 148


>gi|294867718|ref|XP_002765202.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239865197|gb|EEQ97919.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 209

 Score =  195 bits (497), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 62/163 (38%), Positives = 81/163 (49%), Gaps = 25/163 (15%)

Query: 3   YWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           ++L KSEP           +S             W GVRNYQARN MR+M++GDKGFFYH
Sbjct: 37  FYLFKSEPESRIEKGVDMKFSIDDLAASPNGTAEWDGVRNYQARNLMREMKIGDKGFFYH 96

Query: 54  SN-KGREIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSL 99
           SN K   IVGI EV+  +YPD T                   W+ VDI  +  +   +SL
Sbjct: 97  SNCKPPGIVGIVEVVRESYPDDTQFDPKNPHFDPRSGKEEPKWDMVDIKFIRKLSRKISL 156

Query: 100 MAIKA--NPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSN 140
             +KA  +  LSSM L  ++RLSVQ VT  E+  +  +   S 
Sbjct: 157 DELKAYRDKELSSMGLFTTARLSVQRVTPAEWDFILSLEGASE 199


>gi|167585757|ref|ZP_02378145.1| hypothetical protein BuboB_10503 [Burkholderia ubonensis Bu]
          Length = 153

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 55/150 (36%), Positives = 73/150 (48%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GR 58
           M +WL+KSEP E S     +  +    WTGVRNYQARN MR  M++GD   FYHS+    
Sbjct: 1   MQFWLMKSEPDEASIDDLANAPQRTLPWTGVRNYQARNFMRDMMQIGDGVLFYHSSCPEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV +  YPDPT                   W  VD+  V      V L A++  
Sbjct: 61  GIAGLAEVSSTPYPDPTQFDPKSPYYDPKSTQETPRWLLVDVRFVKK-AALVPLAALREY 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCR 134
             L+ M +L   +RLS+ PVT  E+  +  
Sbjct: 120 DELADMRVLAKGNRLSITPVTRAEWRFITE 149


>gi|91227522|ref|ZP_01261859.1| hypothetical protein V12G01_09742 [Vibrio alginolyticus 12G01]
 gi|91188546|gb|EAS74838.1| hypothetical protein V12G01_09742 [Vibrio alginolyticus 12G01]
          Length = 156

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 54/156 (34%), Positives = 78/156 (50%), Gaps = 18/156 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S      + +    W GVRNYQARN MR +++VGD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFSIDTL--RTQKVSCWEGVRNYQARNMMRDQVKVGDLVLIYHSSCKHV 58

Query: 59  EIVGIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YPD              +   +  W  VD+  V      + L  +KA 
Sbjct: 59  GVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDVEFVRKTARVIPLSVMKAM 118

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLSN 140
           P L +M L+   +RLS+ PVT +E+  +    KL +
Sbjct: 119 PELENMPLVKRGNRLSIMPVTEEEWDAILGKEKLPS 154


>gi|261855312|ref|YP_003262595.1| hypothetical protein Hneap_0697 [Halothiobacillus neapolitanus c2]
 gi|261835781|gb|ACX95548.1| protein of unknown function DUF55 [Halothiobacillus neapolitanus
           c2]
          Length = 155

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 53/150 (35%), Positives = 76/150 (50%), Gaps = 18/150 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M +WL+K EP  +S    +   +  E W G+RNYQARN MR  M++GD  FFYHSN K  
Sbjct: 1   MNHWLMKCEPDVFSIDDLEK--QKVEGWYGIRNYQARNMMRDAMKIGDLVFFYHSNVKVP 58

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EVI+  YPDPT                +  W  VD+  V      ++L  +K +
Sbjct: 59  GIVGIMEVISAPYPDPTQFDPKHRYFDPKSTPENPRWVQVDVQYVRHTKRNITLQELKED 118

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCR 134
             L  + L+   +RLS+ P++   +  +  
Sbjct: 119 ETLEDLPLVRRGNRLSIMPISAQSWTRILA 148


>gi|284108707|ref|ZP_06386434.1| protein containing DUF55 [Candidatus Poribacteria sp. WGA-A3]
 gi|283829875|gb|EFC34165.1| protein containing DUF55 [Candidatus Poribacteria sp. WGA-A3]
          Length = 161

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 61/158 (38%), Positives = 85/158 (53%), Gaps = 17/158 (10%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGREIV 61
           YWL+KSEPS +S        +    W GVRNYQARN +R M VGD  FFYHSN     IV
Sbjct: 4   YWLLKSEPSTFSIADLARSPKRTTCWEGVRNYQARNFLRAMAVGDLAFFYHSNADPPAIV 63

Query: 62  GIFEVITCTYP-------------DPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           GI E++   YP             D +++Q+  W  VD+     +  P+SL ++++   L
Sbjct: 64  GIVEIVKAAYPDYFAWRPGSRYFDDKSSKQNPRWVMVDVRLKEILRAPLSLESLRSVRGL 123

Query: 109 SSMILIV-SSRLSVQPVTTDEYLEVCRM--GKLSNPPL 143
             M L+   SRLSVQPV  +E+  + ++   K  +PPL
Sbjct: 124 ERMELLRKGSRLSVQPVRENEWKIIVQLSQAKPVSPPL 161


>gi|26991881|ref|NP_747306.1| hypothetical protein PP_5205 [Pseudomonas putida KT2440]
 gi|24987002|gb|AAN70770.1|AE016721_3 conserved hypothetical protein [Pseudomonas putida KT2440]
          Length = 149

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 58/150 (38%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-RE 59
           MAYWL+KSEP E S +     G     W GVRNYQARN +R M VGD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDELSIEALARLGEA--RWDGVRNYQARNFLRAMSVGDEFFFYHSSCPQPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  +    YPDPTA                + W  VD+  V + P  + L  +K   
Sbjct: 59  IAGIARITRAAYPDPTALDPESHYHDAKATTDKNPWSAVDVAHVQTFPRVLELGRLKQQA 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L  + L+   SRLSV PVT +++  +  +
Sbjct: 119 GLVELPLVQKGSRLSVMPVTPEQWAVIVAL 148


>gi|229367658|gb|ACQ58809.1| Thymocyte nuclear protein 1 [Anoplopoma fimbria]
          Length = 220

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 49/165 (29%), Positives = 72/165 (43%), Gaps = 31/165 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           ++WL+KSEP           +  +  +      + W GVRNYQARN MR+M+ G   FFY
Sbjct: 50  SHWLMKSEPESRFESGIDGKFGIEDLKALPDQTDCWDGVRNYQARNFMRQMKDGQLAFFY 109

Query: 53  HSN-KGREIVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVS 98
           HS+ K   I GI +++   Y D T                +  W  VD+     +     
Sbjct: 110 HSDCKEPGIAGIMKIVKEAYVDHTQFDKKDIHFDANSEPDNPKWSMVDVQYQRMLKRFFP 169

Query: 99  LMAIKANP--------RLSSMILIVSSRLSVQPVTTDEYLEVCRM 135
           L  +K            L  M L  S+RLSVQP+T +E+  +  +
Sbjct: 170 LSELKKYHLQHRAKGGPLKDMALFTSARLSVQPLTPEEFDFILSL 214


>gi|41055054|ref|NP_956951.1| thymocyte nuclear protein 1 [Danio rerio]
 gi|82187203|sp|Q6PFL8|THYN1_DANRE RecName: Full=Thymocyte nuclear protein 1
 gi|34784105|gb|AAH57500.1| Thymocyte nuclear protein 1 [Danio rerio]
          Length = 231

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 50/165 (30%), Positives = 72/165 (43%), Gaps = 31/165 (18%)

Query: 2   AYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFY 52
           + WL+KSEP           +  +  +        W GVRNYQARN MR+M+VG + FFY
Sbjct: 61  SRWLMKSEPESRIENGVDVKFGIEDLKALPNQTGCWDGVRNYQARNFMREMKVGQQAFFY 120

Query: 53  HSN-KGREIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVS 98
           HSN K   I G+ +++   Y D T                +  W  VD+     +   + 
Sbjct: 121 HSNCKEPGIAGLMKIVKEAYVDHTQFDKKDVHYDPSSKADNPKWHMVDVQFERMVKRFIP 180

Query: 99  LMAIKANP--------RLSSMILIVSSRLSVQPVTTDEYLEVCRM 135
           L  +K            L  M L   +RLSVQP+T +E+  V  +
Sbjct: 181 LAELKKYHLEHRVKGGPLKDMALFTRARLSVQPLTAEEFEFVLSL 225


>gi|330812492|ref|YP_004356954.1| hypothetical protein PSEBR_a5437 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327380600|gb|AEA71950.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 149

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E S +  +  G+    W GVRNYQARN +R M VGD  FFYHS+     
Sbjct: 1   MAYWLMKSEPDELSIQGLEKLGQA--RWDGVRNYQARNFLRTMAVGDAFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  ++   YPDPTA                + W  +D+  V + P  + L  +K   
Sbjct: 59  IAGIGRIVRAAYPDPTALEPDSHYFDPKAGPDKNPWTAIDVAHVETFPHVLKLDYLKQQT 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L+ M L+   SRLSV PVT +++  V  +
Sbjct: 119 ALAEMPLVQKGSRLSVMPVTAEQWAAVIAL 148


>gi|91774482|ref|YP_544238.1| hypothetical protein Mfla_0126 [Methylobacillus flagellatus KT]
 gi|91708469|gb|ABE48397.1| protein of unknown function DUF589 [Methylobacillus flagellatus KT]
          Length = 152

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 56/151 (37%), Positives = 75/151 (49%), Gaps = 17/151 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNK-GR 58
           M YWL+KSEPS+ S             W GVRNYQARN MR +M+VGD   FYHSN    
Sbjct: 1   MRYWLMKSEPSDVSIDDLASFPNQTVDWYGVRNYQARNFMRDQMKVGDGVLFYHSNCAEP 60

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI EV    YPD                 ++  W  VD+  V      +SL  ++A 
Sbjct: 61  GIVGIAEVSKQAYPDRFQFIEGHKYYDPKATPENPRWFNVDVKLVRKT-RLLSLKELRAT 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRM 135
           P L ++ IL   +RLS+ PV   ++  + ++
Sbjct: 120 PELQNLRILQRGNRLSITPVDPRDWEFIMKL 150


>gi|307295576|ref|ZP_07575412.1| protein of unknown function DUF55 [Sphingobium chlorophenolicum
           L-1]
 gi|306878615|gb|EFN09835.1| protein of unknown function DUF55 [Sphingobium chlorophenolicum
           L-1]
          Length = 135

 Score =  194 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 55/137 (40%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWL+KSEP  +S+    +KG+    W GVRN+ A+ +M+ MR GD   FYHSN G E 
Sbjct: 1   MNYWLMKSEPDVFSYDDLVEKGKA--EWDGVRNHAAQLHMKAMRKGDLSIFYHSNIGVEA 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI +++    PD T + +  W  V +        PV+L  +KA+P L++M +I  SRLS
Sbjct: 59  VGIMQIVEEAAPDST-DDTGKWIAVHVGPKEKFEKPVTLKTMKADPALANMAMIRQSRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V P+T  E+  +  + K
Sbjct: 118 VSPLTEAEFKHIVALSK 134


>gi|332531865|ref|ZP_08407750.1| hypothetical protein PH505_aa01720 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038841|gb|EGI75283.1| hypothetical protein PH505_aa01720 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 152

 Score =  194 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 54/152 (35%), Positives = 77/152 (50%), Gaps = 15/152 (9%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S    ++  +    W GVRNYQARN MR  ++VGD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDAFSLDDLKNAPKQTTLWEGVRNYQARNFMRDGVKVGDSVMIYHSSCKHV 60

Query: 59  EIVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI EV    YPDPT                   W  V++     +   +SL  IKAN
Sbjct: 61  GVAGIAEVTKEAYPDPTQFNLSSDYYDAKATSDKPRWVVVEVTYQSHLKKLISLKDIKAN 120

Query: 106 PRLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             ++ + L    RLS+ PVT +++ E+ +M +
Sbjct: 121 DNITEIALKKGGRLSIMPVTKNDWDEIIKMAQ 152


>gi|332304428|ref|YP_004432279.1| hypothetical protein Glaag_0042 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332171757|gb|AEE21011.1| protein of unknown function DUF55 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 153

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 51/153 (33%), Positives = 74/153 (48%), Gaps = 16/153 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL K+EP  +S      +    E W G+RNYQARN +R +++ GDK F YHS+ K  
Sbjct: 1   MQYWLFKTEPDAFSIDDLAARPNQTEHWDGIRNYQARNFLRDQVKQGDKVFIYHSSCKEV 60

Query: 59  EIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKAN 105
            I G+ EV+   YPD T                +  W  VD+  +   P  ++L  IK  
Sbjct: 61  GIAGLAEVVKEAYPDHTQFDPESHYYDPKSSPENPRWVMVDVKFIEKFPDVLALKKIKTM 120

Query: 106 PRLSSMILIVSS-RLSVQPVTTDEYLEVCRMGK 137
           P +S + L+    RLS+ PV   E+  +    +
Sbjct: 121 PEISEVGLVKKGHRLSIMPVNEQEFSALLAASR 153


>gi|255531167|ref|YP_003091539.1| hypothetical protein Phep_1261 [Pedobacter heparinus DSM 2366]
 gi|255344151|gb|ACU03477.1| protein of unknown function DUF55 [Pedobacter heparinus DSM 2366]
          Length = 139

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 59/135 (43%), Positives = 85/135 (62%), Gaps = 3/135 (2%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
            +WLVKSEP ++SW+     GR    W GVRNYQARNN+++M+ GD   FYHSN+G+ +V
Sbjct: 5   QHWLVKSEPFKYSWEKFNKDGR--TFWDGVRNYQARNNLKEMKEGDLVLFYHSNEGKNVV 62

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI +V+   Y DPT + ++ W  VD+  V ++  PVSL  IKA   L  + L+   RLSV
Sbjct: 63  GIAKVVKEFYQDPTTDDAN-WVVVDLAPVEALKNPVSLEQIKAEESLKDISLVRQGRLSV 121

Query: 122 QPVTTDEYLEVCRMG 136
            P+  +E+ ++  M 
Sbjct: 122 MPLKAEEFDKILEMS 136


>gi|46048964|ref|NP_989618.1| thymocyte nuclear protein 1 [Gallus gallus]
 gi|82107220|sp|Q90679|THYN1_CHICK RecName: Full=Thymocyte nuclear protein 1; AltName: Full=Thymocyte
           protein Thy28; Short=cThy28
 gi|995778|gb|AAA75591.1|AAA75591 cThy28kD [Gallus gallus]
          Length = 242

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 78/166 (46%), Gaps = 31/166 (18%)

Query: 3   YWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +WL+KSEP           +S +  + +      W GVRNYQARN +R M++G + FFYH
Sbjct: 73  HWLLKSEPESRLEKGVDVKFSIEDLKAQPNQTTFWEGVRNYQARNFLRAMKLGQQAFFYH 132

Query: 54  SN-KGREIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSL 99
           SN K   IVGI +++   YPD T                +  W  VD+  V      + L
Sbjct: 133 SNCKEPGIVGIVKIVKEAYPDHTQFDQKDPHYDSSSRKENPKWSMVDVQFVRMTKRFIPL 192

Query: 100 MAIKANP--------RLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             IK +          L +M+L    RLS+QP+T +E+  V  + +
Sbjct: 193 SEIKTHHLAHKADGGPLKNMMLFSRQRLSIQPLTQEEFDFVLSLEE 238


>gi|325927882|ref|ZP_08189106.1| hypothetical protein XPE_3146 [Xanthomonas perforans 91-118]
 gi|325541722|gb|EGD13240.1| hypothetical protein XPE_3146 [Xanthomonas perforans 91-118]
          Length = 158

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 58/152 (38%), Positives = 72/152 (47%), Gaps = 20/152 (13%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
            YWL+KSEP  +S    +  G   E W GVRNYQARN MR  M+VGD  FFYHSN K   
Sbjct: 6   RYWLMKSEPDTFSIDDLERVG--TEPWNGVRNYQARNFMRDGMQVGDGVFFYHSNCKVPG 63

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI +V +  YPD T                   W  VD+     +   +SL  IK   
Sbjct: 64  IVGIAKVASAAYPDDTQFDPSSDYHDPKSTREDPRWMLVDVAFERKLARTISLDEIKQEA 123

Query: 107 RL--SSMILI-VSSRLSVQPVTTDEYLEVCRM 135
                   LI   +RLS+ PVT  ++  +  M
Sbjct: 124 DALGEGFALIARGNRLSILPVTAAQWKLLLAM 155


>gi|313679782|ref|YP_004057521.1| hypothetical protein Ocepr_0891 [Oceanithermus profundus DSM 14977]
 gi|313152497|gb|ADR36348.1| protein of unknown function DUF55 [Oceanithermus profundus DSM
           14977]
          Length = 153

 Score =  194 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 52/152 (34%), Positives = 72/152 (47%), Gaps = 17/152 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           M YWL+KSEP  +S    +  GR  E W GVRNYQARN +R+M+ GD  FFYHSN K   
Sbjct: 1   MRYWLMKSEPEAYSIDDLERDGR--EIWDGVRNYQARNYLREMKEGDLAFFYHSNAKPPG 58

Query: 60  IVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSLMAIKANP 106
           +VG+  ++     DPT                +  W+ V++  V   P  V L  ++   
Sbjct: 59  VVGLMRIVKSGVVDPTQFDPESCYYDPKSTPENPRWQTVEVEFVEKFPRMVPLAELRERF 118

Query: 107 RLSSMILIVSS-RLSVQPVTTDEYLEVCRMGK 137
               + L+    RLSV PV       +  + K
Sbjct: 119 TAEELPLLKRGFRLSVMPVDAAVAENLLELAK 150


>gi|152986473|ref|YP_001351288.1| hypothetical protein PSPA7_5972 [Pseudomonas aeruginosa PA7]
 gi|150961631|gb|ABR83656.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 152

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 59/151 (39%), Positives = 76/151 (50%), Gaps = 17/151 (11%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-REI 60
           AYWL+KSEP E S    +  G     W GVRNYQARN MR M  GD  FFYHS+     I
Sbjct: 3   AYWLMKSEPDELSILDLKRLG--TARWDGVRNYQARNFMRSMNPGDLFFFYHSSCPQPGI 60

Query: 61  VGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI  +    YPDPTA                + W   D+  V +    V L  +KA   
Sbjct: 61  AGIARIEGEAYPDPTALDPASPYHDPKASAEKNPWSARDVSFVEAFAEVVPLARLKAQEA 120

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
           L+++ L+   SRLSV PV+ +E+  +  +GK
Sbjct: 121 LANLALVQKGSRLSVMPVSAEEWQAILPLGK 151


>gi|77461661|ref|YP_351168.1| hypothetical protein Pfl01_5440 [Pseudomonas fluorescens Pf0-1]
 gi|77385664|gb|ABA77177.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 149

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 60/150 (40%), Positives = 80/150 (53%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E S K  +  G+    W GVRNYQARN +R M VGD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDELSIKGLEKLGKA--RWDGVRNYQARNFLRAMAVGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++I   YPDPTA                + W  +D+  V +    + L  +K   
Sbjct: 59  IAGIGKIIEAAYPDPTALEPQSHYYDPKATPDKNPWSAIDVAHVETFSRVLKLDYLKQQT 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            L+ M L+   SRLSV PVT +++  V  +
Sbjct: 119 ALAEMPLVQKGSRLSVMPVTAEQWAAVLGL 148


>gi|330872728|gb|EGH06877.1| hypothetical protein Pgy4_03377 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 149

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 56/150 (37%), Positives = 76/150 (50%), Gaps = 17/150 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GRE 59
           MAYWL+KSEP E+S    Q +G     W GVRNYQARN +R M  GD+ FFYHS+     
Sbjct: 1   MAYWLMKSEPDEFSISDLQKRGNA--RWDGVRNYQARNFLRTMAEGDEFFFYHSSCPEPG 58

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI ++    YPDPTA                + W  +D+  V      + L  +K   
Sbjct: 59  IAGIGKIAKAAYPDPTALDPDSHYHDAKATADKNPWSAIDVEFVDIFKSVLGLGYLKQQS 118

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
           +L  + L+   SRLSV PVT ++   +  +
Sbjct: 119 QLEQLPLVQKGSRLSVMPVTAEQGAAILAL 148


>gi|171059350|ref|YP_001791699.1| hypothetical protein Lcho_2669 [Leptothrix cholodnii SP-6]
 gi|170776795|gb|ACB34934.1| protein of unknown function DUF55 [Leptothrix cholodnii SP-6]
          Length = 157

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 53/150 (35%), Positives = 70/150 (46%), Gaps = 17/150 (11%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKG-RE 59
            YWL+KSEP E S             WTGVRNYQARN MR  M+VGD   FYHS+     
Sbjct: 5   QYWLMKSEPEECSIDTLAQSVSQCLPWTGVRNYQARNFMRDAMQVGDGVLFYHSSCPQPG 64

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           + G+ EV +  Y D T                   W  VD+  V      + L  ++A P
Sbjct: 65  VAGLAEVASAAYLDATQFDPASPYFDARSQREAPRWLHVDVRFVRKT-RLLGLAEMRAQP 123

Query: 107 RLSSMILIV-SSRLSVQPVTTDEYLEVCRM 135
            L+ M L+   +RLS+ PVT  E+  +  +
Sbjct: 124 GLAGMTLLRPGNRLSITPVTPAEWQLILEL 153


>gi|254468075|ref|ZP_05081481.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [beta
           proteobacterium KB13]
 gi|207086885|gb|EDZ64168.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [beta
           proteobacterium KB13]
          Length = 151

 Score =  194 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 58/148 (39%), Positives = 82/148 (55%), Gaps = 19/148 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           M YWL+KSEPS++S    +  G +   W G+RNYQARN MR  M++GD  FFYHSN K  
Sbjct: 1   MKYWLMKSEPSDYSIDDLERDGSID--WYGIRNYQARNFMRDDMQIGDLAFFYHSNCKEP 58

Query: 59  EIVGIFEVITCTYPD-------------PTAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI +V    YPD              +   +  W  VD+  V  +P  VSL  ++ +
Sbjct: 59  GIVGIMKVSKLAYPDKLQFIEGHKYHDPKSDPNNPRWVNVDVAFVKKIP-LVSLNELRQH 117

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEV 132
            +L ++ IL   +RLS+ P+T DE+  +
Sbjct: 118 QQLETLKILQRGNRLSITPLTEDEWNYI 145


>gi|120556052|ref|YP_960403.1| hypothetical protein Maqu_3142 [Marinobacter aquaeolei VT8]
 gi|120325901|gb|ABM20216.1| protein of unknown function DUF55 [Marinobacter aquaeolei VT8]
          Length = 152

 Score =  194 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 55/150 (36%), Positives = 77/150 (51%), Gaps = 15/150 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGR-E 59
           MA WLVK+EPSE        +      W GVRNYQARN + +M+ GD  F YHS+  R  
Sbjct: 1   MAKWLVKTEPSECGIDDFARQPEGVIPWDGVRNYQARNFLAQMQEGDLVFIYHSSCKRIG 60

Query: 60  IVGIFEVITCTYPDPTAE-------------QSSCWECVDICAVCSMPCPVSLMAIKANP 106
           I GI  V+   YPDP+               +   W+ VD+     +P  + L ++KA P
Sbjct: 61  IAGIVRVVKSAYPDPSQFNPESPYYDPKSTAEKPRWQAVDLQFERKLPALIPLDSLKAMP 120

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCRM 135
            LS + L+   SRLSV PV+  E+ ++  +
Sbjct: 121 ELSELALVRRGSRLSVMPVSDAEWQQILHL 150


>gi|167036253|ref|YP_001671484.1| hypothetical protein PputGB1_5266 [Pseudomonas putida GB-1]
 gi|166862741|gb|ABZ01149.1| protein of unknown function DUF55 [Pseudomonas putida GB-1]
          Length = 153

 Score =  194 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 61/154 (39%), Positives = 84/154 (54%), Gaps = 19/154 (12%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEA-WTGVRNYQARNNMRKMRVGDKGFFYHSNKG-R 58
           MAYWL+KSEP E S +     GR+GEA W GVRNYQARN +R M  GD+ FFYHS+    
Sbjct: 1   MAYWLMKSEPDELSIE---ALGRLGEARWDGVRNYQARNFLRAMSEGDEFFFYHSSCPQP 57

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            I GI  +    YPDPTA                + W  VD+  V ++P  + L  +K  
Sbjct: 58  GIAGIARITRAAYPDPTALDPQSHYYDAKATADKNPWSAVDVAHVQTLPRVLELGWLKQQ 117

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKL 138
             L+ + L+   SRLSV PVT +++  +  + ++
Sbjct: 118 AGLAELPLVQKGSRLSVMPVTPEQWAVIVALRQM 151


>gi|325104591|ref|YP_004274245.1| protein of unknown function DUF55 [Pedobacter saltans DSM 12145]
 gi|324973439|gb|ADY52423.1| protein of unknown function DUF55 [Pedobacter saltans DSM 12145]
          Length = 135

 Score =  194 bits (494), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 83/137 (60%), Gaps = 3/137 (2%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           M YWLVKSEP ++SW+     GR    W GVRNYQARNN++ M+  D   FYHSN+G+ +
Sbjct: 1   MNYWLVKSEPFKYSWEQFNKDGR--TFWDGVRNYQARNNLKAMKEEDLVMFYHSNEGKCV 58

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VG+ +V+   Y DPT + S+ W  VDI  V ++  PVSL  IK +  L  + L+   RLS
Sbjct: 59  VGVAKVVKEFYQDPTTDDSN-WVVVDISPVETLKNPVSLEQIKKDEYLQDIALVRQGRLS 117

Query: 121 VQPVTTDEYLEVCRMGK 137
           V P+   E+  +  + +
Sbjct: 118 VMPLKKHEFDRILELSE 134


>gi|220905579|ref|YP_002480891.1| hypothetical protein Ddes_2318 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869878|gb|ACL50213.1| protein of unknown function DUF55 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 158

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 59/153 (38%), Positives = 78/153 (50%), Gaps = 15/153 (9%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNKGREIV 61
           YWL+KSEP  +S      +     +W GVRN+QARN +R +M VGD   FYHS      V
Sbjct: 5   YWLLKSEPGCYSIDDLAAEPDQVTSWGGVRNFQARNFLRDQMAVGDMAIFYHSVTAPSAV 64

Query: 62  GIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           G+  V+   YPDPTA              +   W  VDI  V     PV L A++  P L
Sbjct: 65  GVARVVRTGYPDPTAWEPEDEHFDPRSTPEKPLWFAVDIRFVKKFANPVPLKAMRMVPAL 124

Query: 109 SSMILIV-SSRLSVQPVTTDEYLEVCRMGKLSN 140
             M L+   SRLSV PV+ +E+  +C+MG   +
Sbjct: 125 FGMELLRKGSRLSVMPVSKEEFAVICKMGDAED 157


>gi|91788787|ref|YP_549739.1| hypothetical protein Bpro_2927 [Polaromonas sp. JS666]
 gi|91698012|gb|ABE44841.1| protein of unknown function DUF589 [Polaromonas sp. JS666]
          Length = 154

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 54/155 (34%), Positives = 75/155 (48%), Gaps = 17/155 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSNK-GR 58
           M YWL+KSEP E S        +    W GVRNYQARN MR  MRVGD   FYHS+    
Sbjct: 1   MNYWLMKSEPEECSVDDALAAPKATVPWVGVRNYQARNFMRDAMRVGDGVLFYHSSCAEP 60

Query: 59  EIVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKAN 105
            IVGI +V +  YPDPT                   W  VD+  +      ++L  ++A+
Sbjct: 61  GIVGIAQVASTPYPDPTQFDPKSPYYDAKSKPEEPRWLLVDVQVLRKTRN-LALPELRAH 119

Query: 106 PRLSSM-ILIVSSRLSVQPVTTDEYLEVCRMGKLS 139
             L  + +L   +RLS+ PV    +  +C++  + 
Sbjct: 120 EDLQGLVVLRKGNRLSITPVEPKHWRVICKLLGIP 154


>gi|153835105|ref|ZP_01987772.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Vibrio
           harveyi HY01]
 gi|148868455|gb|EDL67563.1| ubiquinol-Cytochrome c reductase, iron-sulfur subunit [Vibrio
           harveyi HY01]
          Length = 206

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 53/156 (33%), Positives = 78/156 (50%), Gaps = 18/156 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S      + +    W GVRNYQARN MR ++++GD    YHS+ K  
Sbjct: 51  MAYWLFKTEPDTFSIDTL--RTQKVSCWEGVRNYQARNMMRDQVKLGDLVLIYHSSCKNV 108

Query: 59  EIVGIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V    YPD              +  ++  W  VDI  V      + L  +KA 
Sbjct: 109 GVAGIAKVTREAYPDHFQFDLESDYYDPKSDPENPRWIMVDIEFVRKTVRLIPLSVMKAM 168

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLSN 140
           P L +M L+   +RLS+ PV+ +E+  +    KL +
Sbjct: 169 PELENMPLVKRGNRLSIMPVSEEEWQAILGKEKLPS 204


>gi|73540357|ref|YP_294877.1| hypothetical protein Reut_A0651 [Ralstonia eutropha JMP134]
 gi|72117770|gb|AAZ60033.1| Protein of unknown function DUF589 [Ralstonia eutropha JMP134]
          Length = 167

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 56/147 (38%), Positives = 73/147 (49%), Gaps = 19/147 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GRE 59
            YWL+KSEP E S       G     WTGVRNYQARN MR  MR+GD   FYHS+     
Sbjct: 18  QYWLMKSEPDEASIDTLAKDG--TLPWTGVRNYQARNFMRDVMRIGDGVLFYHSSCPEPG 75

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           I G+ EV +  YPDPT                   W+ VD+  V      + L  ++A+ 
Sbjct: 76  IAGLAEVCSQPYPDPTQFDPKSHYYDAASKPDEPRWQLVDVKYVRK-SALIPLSELRAHE 134

Query: 107 RLSSM-ILIVSSRLSVQPVTTDEYLEV 132
            L+ M +L   +RLS+ PVT  E+  +
Sbjct: 135 ELADMVVLRRGNRLSITPVTAAEWRFI 161


>gi|326933330|ref|XP_003212759.1| PREDICTED: thymocyte nuclear protein 1-like [Meleagris gallopavo]
 gi|20302922|gb|AAM18926.1| cThy28 [Gallus gallus]
          Length = 242

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 53/166 (31%), Positives = 78/166 (46%), Gaps = 31/166 (18%)

Query: 3   YWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYH 53
           +WL+KSEP           +S +  + +      W GVRNYQARN +R M++G + FFYH
Sbjct: 73  HWLLKSEPESRLEKGVDVKFSIEDLKAQPNQTTFWEGVRNYQARNFLRAMKLGQQAFFYH 132

Query: 54  SN-KGREIVGIFEVITCTYPDPTAEQ-------------SSCWECVDICAVCSMPCPVSL 99
           SN K   IVGI +++   YPD T                +  W  VD+  V      + L
Sbjct: 133 SNCKEPGIVGIVKIVKEAYPDHTQFDQKDPHYDSSSRKENPKWSMVDVQFVRMTKRFIPL 192

Query: 100 MAIKANP--------RLSSMILIVSSRLSVQPVTTDEYLEVCRMGK 137
             IK +          L +M+L    RLS+QP+T +E+  V  + +
Sbjct: 193 SEIKTHHLAHKADGGPLKNMMLFSRQRLSIQPLTQEEFDFVLSLEE 238


>gi|149376027|ref|ZP_01893793.1| hypothetical protein MDG893_03575 [Marinobacter algicola DG893]
 gi|149359664|gb|EDM48122.1| hypothetical protein MDG893_03575 [Marinobacter algicola DG893]
          Length = 151

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 56/149 (37%), Positives = 76/149 (51%), Gaps = 15/149 (10%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSN-KGRE 59
           MA WLVK+EPSE S    ++       W GVRNYQARN +++M  GD  F YHS+ K   
Sbjct: 1   MAKWLVKTEPSECSIDDFENAQVQTIPWDGVRNYQARNFLQEMAEGDDVFVYHSSCKHIG 60

Query: 60  IVGIFEVITCTYPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP 106
           + GI  V+T  YPDPT               +   W+ VD+     +P  + L  IK+ P
Sbjct: 61  VAGIVRVVTSAYPDPTQFRADSPYYDPKSTPEKPRWQAVDMAFEKKLPRLIPLDEIKSLP 120

Query: 107 RLSSMILI-VSSRLSVQPVTTDEYLEVCR 134
            L  + LI   +RLSV PVT  ++  +  
Sbjct: 121 GLEGLALIRRGNRLSVMPVTEQQWQIILA 149


>gi|22298285|ref|NP_681532.1| hypothetical protein tlr0743 [Thermosynechococcus elongatus BP-1]
 gi|22294464|dbj|BAC08294.1| tlr0743 [Thermosynechococcus elongatus BP-1]
          Length = 180

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 56/148 (37%), Positives = 75/148 (50%), Gaps = 16/148 (10%)

Query: 4   WLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSNK-GREIV 61
           WL+KSEPS +SW+  +   +    W GVRNYQARN MR  M+VGD+  FYHSN     I+
Sbjct: 30  WLLKSEPSVFSWEDLKAAPQQTTCWEGVRNYQARNFMRDHMQVGDRVLFYHSNANPPAIM 89

Query: 62  GIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKANPRL 108
           GI EV+   YPD              +   +  W  VDI        P+ L  ++    L
Sbjct: 90  GIAEVVRPAYPDHFAWNPDSPYFDPKSTPDNPRWLMVDIQYRRDFLPPLPLSELRQTRGL 149

Query: 109 SSMILI-VSSRLSVQPVTTDEYLEVCRM 135
             M+L+    RLSVQPVT  E+  +  +
Sbjct: 150 EGMLLLQKGCRLSVQPVTESEWQIILSL 177


>gi|319788229|ref|YP_004147704.1| hypothetical protein Psesu_2644 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466741|gb|ADV28473.1| protein of unknown function DUF55 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 158

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 56/154 (36%), Positives = 72/154 (46%), Gaps = 20/154 (12%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRK-MRVGDKGFFYHSN-KGRE 59
            YWL+KSEP  +S    +  G   E W GVRNYQARN MR  M+VGD   FYHSN K   
Sbjct: 6   RYWLMKSEPDAFSIDDLERVG--TEPWNGVRNYQARNFMRDGMKVGDGVLFYHSNTKVPG 63

Query: 60  IVGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANP 106
           IVGI +V +  YPD T                   W  VD+     +   + L  IK + 
Sbjct: 64  IVGIAKVASEAYPDETQFDPRSDYHDPKATREQPRWFLVDVSFERKLGRTIPLDEIKQHA 123

Query: 107 RL--SSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
                   L+   +RLSV PVT  ++  +  + K
Sbjct: 124 DELGEGFPLVARGNRLSVFPVTAAQWKLLLSLEK 157


>gi|15600422|ref|NP_253916.1| hypothetical protein PA5229 [Pseudomonas aeruginosa PAO1]
 gi|254238074|ref|ZP_04931397.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|9951537|gb|AAG08614.1|AE004935_11 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126170005|gb|EAZ55516.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 152

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 58/151 (38%), Positives = 76/151 (50%), Gaps = 17/151 (11%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKG-REI 60
           AYWL+KSEP E S +  Q  G     W GVRNYQARN +R M  GD  FFYHS+     I
Sbjct: 3   AYWLMKSEPDELSIRDLQRLG--TARWDGVRNYQARNFIRSMNPGDLFFFYHSSCPQPGI 60

Query: 61  VGIFEVITCTYPDPTAEQS-------------SCWECVDICAVCSMPCPVSLMAIKANPR 107
            GI  +    YPDPTA                + W   D+  V +    V L  +KA   
Sbjct: 61  AGIARIEGEAYPDPTALDPASPYHDPKASAGKNPWSARDVSFVEAFAEVVPLARLKAQDA 120

Query: 108 LSSMILI-VSSRLSVQPVTTDEYLEVCRMGK 137
           L+++ L+   SRLSV PV+ +E+  +  + K
Sbjct: 121 LANLALVQKGSRLSVMPVSAEEWQAILPLAK 151


>gi|254230116|ref|ZP_04923512.1| conserved hypothetical protein [Vibrio sp. Ex25]
 gi|151937361|gb|EDN56223.1| conserved hypothetical protein [Vibrio sp. Ex25]
          Length = 156

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 54/156 (34%), Positives = 78/156 (50%), Gaps = 18/156 (11%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMR-KMRVGDKGFFYHSN-KGR 58
           MAYWL K+EP  +S      + +    W GVRNYQARN MR +++VGD    YHS+ K  
Sbjct: 1   MAYWLFKTEPDTFSIDTL--RTQKVSCWEGVRNYQARNMMRDQVKVGDFVLIYHSSCKNV 58

Query: 59  EIVGIFEVITCTYPDP-------------TAEQSSCWECVDICAVCSMPCPVSLMAIKAN 105
            + GI +V+   YPD              +   +  W  VD+  V      + L  +KA 
Sbjct: 59  GVAGIAKVVREAYPDHFQFDPESDYYDPKSDPDNPRWIMVDVEFVRKTTRVIPLSVMKAM 118

Query: 106 PRLSSMILI-VSSRLSVQPVTTDEYLEVCRMGKLSN 140
           P L +M L+   +RLS+ PVT +E+  +    KL +
Sbjct: 119 PELENMPLVKRGNRLSIMPVTEEEWEAILGKEKLPS 154


>gi|253997873|ref|YP_003049936.1| hypothetical protein Msip34_0160 [Methylovorus sp. SIP3-4]
 gi|253984552|gb|ACT49409.1| protein of unknown function DUF55 [Met